NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS32218.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32218.1 Public Homo sapiens 15 SERF2 24 110 108 CCDS HistoryNCBI Gene:10169Re-query CCDS DB by CCDS ID:32218.1Re-query CCDS DB by GeneID:10169See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32218.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000249786.9 ENSP00000249786.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000249786.9Link to Ensembl Protein Viewer:ENSP00000249786.4Re-query CCDS DB by Nucleotide ID:ENST00000249786Re-query CCDS DB by Protein ID:ENSP00000249786
Original member Current member EBI ENST00000381359.5 ENSP00000370764.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381359.5Link to Ensembl Protein Viewer:ENSP00000370764.1Re-query CCDS DB by Nucleotide ID:ENST00000381359Re-query CCDS DB by Protein ID:ENSP00000370764
Original member Current member EBI ENST00000445816.5 ENSP00000400178.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000445816.5Link to Ensembl Protein Viewer:ENSP00000400178.1Re-query CCDS DB by Nucleotide ID:ENST00000445816Re-query CCDS DB by Protein ID:ENSP00000400178
Original member Current member NCBI NM_001018108.4 NP_001018118.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001018108.4Link to Protein Sequence:NP_001018118.1Re-query CCDS DB by Nucleotide ID:NM_001018108Re-query CCDS DB by Protein ID:NP_001018118Link to BLAST:NP_001018118.1
Original member Current member NCBI NM_001199877.2 NP_001186806.1 Accepted alive Link to Nucleotide Sequence:NM_001199877.2Link to Protein Sequence:NP_001186806.1Re-query CCDS DB by Nucleotide ID:NM_001199877Re-query CCDS DB by Protein ID:NP_001186806Link to BLAST:NP_001186806.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001018118.1 59 P84101-1 59 100% 0 0
NP_001186806.1 59 P84101-1 59 100% 0 0

Chromosomal Locations for CCDS 32218.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 43792377 43792383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43792975 43793083 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 43793710 43793773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (180 nt):
ATGACCCGCGGTAACCAGCGTGAGCTCGCCCGCCAGAAGAATATGAAAAAGCAGAGCGACTCGGTTAAGG
GAAAGCGCCGAGATGACGGGCTTTCTGCTGCCGCCCGCAAGCAGAGGGACTCGGAGATCATGCAGCAGAA
GCAGAAAAAGGCAAACGAGAAGAAGGAGGAACCCAAGTAG

Translation (59 aa):
MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH