U.S. flag

An official website of the United States government

Rattus norvegicus guanylate cyclase activator 2B (Guca2b), mRNA

NCBI Reference Sequence: NM_022284.2

FASTA Graphics 

LOCUS       NM_022284                526 bp    mRNA    linear   ROD 01-JUN-2024
DEFINITION  Rattus norvegicus guanylate cyclase activator 2B (Guca2b), mRNA.
ACCESSION   NM_022284 XM_346750
VERSION     NM_022284.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 526)
  AUTHORS   Brenna,O., Furnes,M.W., Munkvold,B., Kidd,M., Sandvik,A.K. and
            Gustafsson,B.I.
  TITLE     Cellular localization of guanylin and uroguanylin mRNAs in human
            and rat duodenal and colonic mucosa
  JOURNAL   Cell Tissue Res 365 (2), 331-341 (2016)
   PUBMED   27044258
  REMARK    GeneRIF: The specific cellular distribution of both GN and UGN
            differs between duodenum and colon and between human and rat
            intestines.
REFERENCE   2  (bases 1 to 526)
  AUTHORS   Lessa,L.M., Carraro-Lacroix,L.R., Crajoinas,R.O., Bezerra,C.N.,
            Dariolli,R., Girardi,A.C., Fonteles,M.C. and Malnic,G.
  TITLE     Mechanisms underlying the inhibitory effects of uroguanylin on NHE3
            transport activity in renal proximal tubule
  JOURNAL   Am J Physiol Renal Physiol 303 (10), F1399-F1408 (2012)
   PUBMED   22952280
  REMARK    GeneRIF: our data suggest that the inhibitory effect of UGN on NHE3
            transport activity in proximal tubule is mediated by activation of
            both cGMP/PKG and cAMP/PKA signaling pathways
REFERENCE   3  (bases 1 to 526)
  AUTHORS   Hagstrom,S.A., Watson,R.F., Pauer,G.J. and Grossman,G.H.
  TITLE     Tulp1 is involved in specific photoreceptor protein transport
            pathways
  JOURNAL   Adv Exp Med Biol 723, 783-789 (2012)
   PUBMED   22183407
REFERENCE   4  (bases 1 to 526)
  AUTHORS   Qian,X., Moss,N.G., Fellner,R.C., Taylor-Blake,B. and Goy,M.F.
  TITLE     The rat kidney contains high levels of prouroguanylin (the
            uroguanylin precursor) but does not express GC-C (the enteric
            uroguanylin receptor)
  JOURNAL   Am J Physiol Renal Physiol 300 (2), F561-F573 (2011)
   PUBMED   21106860
  REMARK    GeneRIF: these studies provide a comprehensive description of Ugn
            and GC-C expression in the kidney of the Sprague-Dawley rat.
REFERENCE   5  (bases 1 to 526)
  AUTHORS   McCue,H.V., Haynes,L.P. and Burgoyne,R.D.
  TITLE     The diversity of calcium sensor proteins in the regulation of
            neuronal function
  JOURNAL   Cold Spring Harb Perspect Biol 2 (8), a004085 (2010)
   PUBMED   20668007
  REMARK    Review article
REFERENCE   6  (bases 1 to 526)
  AUTHORS   Santos-Neto,M.S., Carvalho,A.F., Monteiro,H.S., Forte,L.R. and
            Fonteles,M.C.
  TITLE     Interaction of atrial natriuretic peptide, urodilatin, guanylin and
            uroguanylin in the isolated perfused rat kidney
  JOURNAL   Regul Pept 136 (1-3), 14-22 (2006)
   PUBMED   16814407
  REMARK    GeneRIF: atrial natriuretic peptide, urodilatin, guanylin and
            uroguanylin interact in rat kidney
REFERENCE   7  (bases 1 to 526)
  AUTHORS   Lorenz,J.N., Nieman,M., Sabo,J., Sanford,L.P., Hawkins,J.A.,
            Elitsur,N., Gawenis,L.R., Clarke,L.L. and Cohen,M.B.
  TITLE     Uroguanylin knockout mice have increased blood pressure and
            impaired natriuretic response to enteral NaCl load
  JOURNAL   J Clin Invest 112 (8), 1244-1254 (2003)
   PUBMED   14561709
REFERENCE   8  (bases 1 to 526)
  AUTHORS   Blanchard,R.K. and Cousins,R.J.
  TITLE     Upregulation of rat intestinal uroguanylin mRNA by dietary zinc
            restriction
  JOURNAL   Am J Physiol 272 (5 Pt 1), G972-G978 (1997)
   PUBMED   9176203
REFERENCE   9  (bases 1 to 526)
  AUTHORS   Li,Z., Perkins,A.G., Peters,M.F., Campa,M.J. and Goy,M.F.
  TITLE     Purification, cDNA sequence, and tissue distribution of rat
            uroguanylin
  JOURNAL   Regul Pept 68 (1), 45-56 (1997)
   PUBMED   9094754
REFERENCE   10 (bases 1 to 526)
  AUTHORS   Miyazato,M., Nakazato,M., Matsukura,S., Kangawa,K. and Matsuo,H.
  TITLE     Uroguanylin gene expression in the alimentary tract and
            extra-gastrointestinal tissues
  JOURNAL   FEBS Lett 398 (2-3), 170-174 (1996)
   PUBMED   8977100
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U41322.1.
            
            On Jun 3, 2007 this sequence version replaced NM_022284.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U41322.1, CB809177.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMN06621351
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..526
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q36"
     gene            1..526
                     /gene="Guca2b"
                     /note="guanylate cyclase activator 2B"
                     /db_xref="GeneID:64055"
                     /db_xref="RGD:620044"
     exon            1..111
                     /gene="Guca2b"
                     /inference="alignment:Splign:2.1.0"
     CDS             37..357
                     /gene="Guca2b"
                     /note="guanylate cyclase activator 2b (retina);
                     uroguanylin"
                     /codon_start=1
                     /product="guanylate cyclase activator 2B precursor"
                     /protein_id="NP_071620.1"
                     /db_xref="GeneID:64055"
                     /db_xref="RGD:620044"
                     /translation="MSGSQLWAAVLLLLVLQSAQGVYIKYHGFQVQLESVKKLNELEE
                     KQMSDPQQQKSGLLPDVCYNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVA
                     CTGC"
     sig_peptide     37..99
                     /gene="Guca2b"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     exon            112..298
                     /gene="Guca2b"
                     /inference="alignment:Splign:2.1.0"
     exon            299..526
                     /gene="Guca2b"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 gcagaaaccc agaggtgtga gctgggaagc cgggccatgt caggaagcca actgtgggct
       61 gctgtactcc tgctgctggt gctgcagagt gcccagggtg tctacatcaa gtaccatggc
      121 ttccaagtcc agctagaatc ggtgaagaag ctgaatgagt tggaagagaa gcagatgtcc
      181 gatccccagc agcagaaaag tggcctcctc cccgatgtgt gctacaaccc cgccttgccc
      241 ctggacctcc agcctgtttg tgcatcccag gaagctgcca gcaccttcaa ggccttgagg
      301 accattgcca ctgatgaatg tgagctgtgt ataaatgttg cctgtacggg ctgctgatga
      361 aatgactcca gacacctacc cccacagcct accctgccca tacttaggta ccattgacat
      421 aattaccacc ctcccagcac aaatggatcc atagcaagac aatatggatg cagagccgcc
      481 atatttggtc cccaggcagc tgcaccggaa taaaaatgtt acccgc
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for guanylate cyclase activator 2B precursor (NP_071620.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.