LOCUS NM_022284 526 bp mRNA linear ROD 01-JUN-2024
DEFINITION Rattus norvegicus guanylate cyclase activator 2B (Guca2b), mRNA.
ACCESSION NM_022284 XM_346750
VERSION NM_022284.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 526)
AUTHORS Brenna,O., Furnes,M.W., Munkvold,B., Kidd,M., Sandvik,A.K. and
Gustafsson,B.I.
TITLE Cellular localization of guanylin and uroguanylin mRNAs in human
and rat duodenal and colonic mucosa
JOURNAL Cell Tissue Res 365 (2), 331-341 (2016)
PUBMED 27044258
REMARK GeneRIF: The specific cellular distribution of both GN and UGN
differs between duodenum and colon and between human and rat
intestines.
REFERENCE 2 (bases 1 to 526)
AUTHORS Lessa,L.M., Carraro-Lacroix,L.R., Crajoinas,R.O., Bezerra,C.N.,
Dariolli,R., Girardi,A.C., Fonteles,M.C. and Malnic,G.
TITLE Mechanisms underlying the inhibitory effects of uroguanylin on NHE3
transport activity in renal proximal tubule
JOURNAL Am J Physiol Renal Physiol 303 (10), F1399-F1408 (2012)
PUBMED 22952280
REMARK GeneRIF: our data suggest that the inhibitory effect of UGN on NHE3
transport activity in proximal tubule is mediated by activation of
both cGMP/PKG and cAMP/PKA signaling pathways
REFERENCE 3 (bases 1 to 526)
AUTHORS Hagstrom,S.A., Watson,R.F., Pauer,G.J. and Grossman,G.H.
TITLE Tulp1 is involved in specific photoreceptor protein transport
pathways
JOURNAL Adv Exp Med Biol 723, 783-789 (2012)
PUBMED 22183407
REFERENCE 4 (bases 1 to 526)
AUTHORS Qian,X., Moss,N.G., Fellner,R.C., Taylor-Blake,B. and Goy,M.F.
TITLE The rat kidney contains high levels of prouroguanylin (the
uroguanylin precursor) but does not express GC-C (the enteric
uroguanylin receptor)
JOURNAL Am J Physiol Renal Physiol 300 (2), F561-F573 (2011)
PUBMED 21106860
REMARK GeneRIF: these studies provide a comprehensive description of Ugn
and GC-C expression in the kidney of the Sprague-Dawley rat.
REFERENCE 5 (bases 1 to 526)
AUTHORS McCue,H.V., Haynes,L.P. and Burgoyne,R.D.
TITLE The diversity of calcium sensor proteins in the regulation of
neuronal function
JOURNAL Cold Spring Harb Perspect Biol 2 (8), a004085 (2010)
PUBMED 20668007
REMARK Review article
REFERENCE 6 (bases 1 to 526)
AUTHORS Santos-Neto,M.S., Carvalho,A.F., Monteiro,H.S., Forte,L.R. and
Fonteles,M.C.
TITLE Interaction of atrial natriuretic peptide, urodilatin, guanylin and
uroguanylin in the isolated perfused rat kidney
JOURNAL Regul Pept 136 (1-3), 14-22 (2006)
PUBMED 16814407
REMARK GeneRIF: atrial natriuretic peptide, urodilatin, guanylin and
uroguanylin interact in rat kidney
REFERENCE 7 (bases 1 to 526)
AUTHORS Lorenz,J.N., Nieman,M., Sabo,J., Sanford,L.P., Hawkins,J.A.,
Elitsur,N., Gawenis,L.R., Clarke,L.L. and Cohen,M.B.
TITLE Uroguanylin knockout mice have increased blood pressure and
impaired natriuretic response to enteral NaCl load
JOURNAL J Clin Invest 112 (8), 1244-1254 (2003)
PUBMED 14561709
REFERENCE 8 (bases 1 to 526)
AUTHORS Blanchard,R.K. and Cousins,R.J.
TITLE Upregulation of rat intestinal uroguanylin mRNA by dietary zinc
restriction
JOURNAL Am J Physiol 272 (5 Pt 1), G972-G978 (1997)
PUBMED 9176203
REFERENCE 9 (bases 1 to 526)
AUTHORS Li,Z., Perkins,A.G., Peters,M.F., Campa,M.J. and Goy,M.F.
TITLE Purification, cDNA sequence, and tissue distribution of rat
uroguanylin
JOURNAL Regul Pept 68 (1), 45-56 (1997)
PUBMED 9094754
REFERENCE 10 (bases 1 to 526)
AUTHORS Miyazato,M., Nakazato,M., Matsukura,S., Kangawa,K. and Matsuo,H.
TITLE Uroguanylin gene expression in the alimentary tract and
extra-gastrointestinal tissues
JOURNAL FEBS Lett 398 (2-3), 170-174 (1996)
PUBMED 8977100
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from U41322.1.
On Jun 3, 2007 this sequence version replaced NM_022284.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U41322.1, CB809177.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA5756307, SAMN06621351
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..526
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="5"
/map="5q36"
gene 1..526
/gene="Guca2b"
/note="guanylate cyclase activator 2B"
/db_xref="GeneID:64055"
/db_xref="RGD:620044"
exon 1..111
/gene="Guca2b"
/inference="alignment:Splign:2.1.0"
CDS 37..357
/gene="Guca2b"
/note="guanylate cyclase activator 2b (retina);
uroguanylin"
/codon_start=1
/product="guanylate cyclase activator 2B precursor"
/protein_id="NP_071620.1"
/db_xref="GeneID:64055"
/db_xref="RGD:620044"
/translation="MSGSQLWAAVLLLLVLQSAQGVYIKYHGFQVQLESVKKLNELEE
KQMSDPQQQKSGLLPDVCYNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVA
CTGC"
sig_peptide 37..99
/gene="Guca2b"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
exon 112..298
/gene="Guca2b"
/inference="alignment:Splign:2.1.0"
exon 299..526
/gene="Guca2b"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 gcagaaaccc agaggtgtga gctgggaagc cgggccatgt caggaagcca actgtgggct
61 gctgtactcc tgctgctggt gctgcagagt gcccagggtg tctacatcaa gtaccatggc
121 ttccaagtcc agctagaatc ggtgaagaag ctgaatgagt tggaagagaa gcagatgtcc
181 gatccccagc agcagaaaag tggcctcctc cccgatgtgt gctacaaccc cgccttgccc
241 ctggacctcc agcctgtttg tgcatcccag gaagctgcca gcaccttcaa ggccttgagg
301 accattgcca ctgatgaatg tgagctgtgt ataaatgttg cctgtacggg ctgctgatga
361 aatgactcca gacacctacc cccacagcct accctgccca tacttaggta ccattgacat
421 aattaccacc ctcccagcac aaatggatcc atagcaagac aatatggatg cagagccgcc
481 atatttggtc cccaggcagc tgcaccggaa taaaaatgtt acccgc
//