Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_063261307.1
FASTA Graphics
LOCUS XM_063261307 988 bp mRNA linear ROD 22-FEB-2024 DEFINITION PREDICTED: Rattus norvegicus protein phosphatase 1, regulatory (inhibitor) subunit 14A (Ppp1r14a), transcript variant X2, mRNA. ACCESSION XM_063261307 VERSION XM_063261307.1 DBLINK BioProject: PRJNA1074393 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_086019) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_036323735.1-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/09/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..988 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="1" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..988 /gene="Ppp1r14a" /gene_synonym="CPI-17; Cpi17" /note="protein phosphatase 1, regulatory (inhibitor) subunit 14A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 7 ESTs, 294 long SRA reads, 8 Proteins" /db_xref="GeneID:114004" /db_xref="RGD:620536" CDS 473..916 /gene="Ppp1r14a" /gene_synonym="CPI-17; Cpi17" /codon_start=1 /product="protein phosphatase 1 regulatory subunit 14A isoform X1" /protein_id="XP_063117377.1" /db_xref="GeneID:114004" /db_xref="RGD:620536" /translation="MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRR ELQRRLDVEKWIDGRLEELYRGREADMPDEVNIDELLELDSEEERCRKIRGLLEACLN PTEDFVQELLAKLRGLHKQPGFPQPSPSDDPSLSPRQDPAHTAPP" polyA_site 988 /gene="Ppp1r14a" /gene_synonym="CPI-17; Cpi17" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgccccaacc ggaccttgag aggggtgggt gtgcggagcg ttctcgcttt tccgtgtggg 61 catctgccac gacgtcattg cgccttcgtg ctttcgctgc gactaagagc tggggaccga 121 acccagggcc ttgcacttcc tagatcggat ctctcagtga acctcgatct agcatccctg 181 aggtcctcga gtctgttccg atcaccttct agtcgaaaaa gaaacacgga aagaacgaaa 241 gaaagaatga aagaaagaaa gaaagagaaa aagttgttcc tcaggaccca gaggtcgaag 301 cctgcacatt agcctgcacg tctctgtagg aagggaaact gaggcccgct ggtcggagtg 361 gggcgggtcc cagaacacga gcccccgccc ccggtggccc cgccccaccc cggcccgtta 421 gagacccaag cgcaagacag agcgtaaagt gcagacagcg gacggcggcg tgatggcagc 481 gcagcggctg ggcaagcgcg tgctgagcaa gctgcagtcc ccttcgcgtg cccgcggccc 541 ggggggcagc cctagtgggc tgcagaagcg gcacgcgcga gtcaccgtca aatacgaccg 601 gcgagagctg cagcggcgac tggacgtgga gaagtggatc gacggacgct tggaagagct 661 gtaccgcggc agggaggcag acatgccaga tgaggtcaac atcgacgagc tgctggaatt 721 ggacagtgag gaggaaagat gccggaaaat ccggggactc ttggaggctt gcctgaatcc 781 cacagaggac ttcgtccagg agctattggc caagcttcgg ggcctgcaca agcagccggg 841 cttcccgcag cccagcccct cagatgaccc cagcctgagc ccccgccagg acccggctca 901 cactgctcca ccgtgactgc gcccgcctct gctccacccc caaagcccag attgtttcta 961 agttgtattt aatggttccg taactggc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on