U.S. flag

An official website of the United States government

PREDICTED: Rattus norvegicus protein phosphatase 1, regulatory (inhibitor) subunit 14A (Ppp1r14a), transcript variant X2, mRNA

NCBI Reference Sequence: XM_063261307.1

FASTA Graphics 

LOCUS       XM_063261307             988 bp    mRNA    linear   ROD 22-FEB-2024
DEFINITION  PREDICTED: Rattus norvegicus protein phosphatase 1, regulatory
            (inhibitor) subunit 14A (Ppp1r14a), transcript variant X2, mRNA.
ACCESSION   XM_063261307
VERSION     XM_063261307.1
DBLINK      BioProject: PRJNA1074393
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_086019) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_036323735.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/09/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..988
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /bio_material="RGD 61498"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /sex="male"
                     /tissue_type="kidney, spleen, liver"
                     /geo_loc_name="USA: Wisconsin, Milwaukee"
                     /lat_lon="43.05 N 88.04 W"
                     /collected_by="Rebecca Schilling, Melinda Dwinell"
     gene            1..988
                     /gene="Ppp1r14a"
                     /gene_synonym="CPI-17; Cpi17"
                     /note="protein phosphatase 1, regulatory (inhibitor)
                     subunit 14A; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 mRNAs, 7 ESTs, 294 long SRA
                     reads, 8 Proteins"
                     /db_xref="GeneID:114004"
                     /db_xref="RGD:620536"
     CDS             473..916
                     /gene="Ppp1r14a"
                     /gene_synonym="CPI-17; Cpi17"
                     /codon_start=1
                     /product="protein phosphatase 1 regulatory subunit 14A
                     isoform X1"
                     /protein_id="XP_063117377.1"
                     /db_xref="GeneID:114004"
                     /db_xref="RGD:620536"
                     /translation="MAAQRLGKRVLSKLQSPSRARGPGGSPSGLQKRHARVTVKYDRR
                     ELQRRLDVEKWIDGRLEELYRGREADMPDEVNIDELLELDSEEERCRKIRGLLEACLN
                     PTEDFVQELLAKLRGLHKQPGFPQPSPSDDPSLSPRQDPAHTAPP"
     polyA_site      988
                     /gene="Ppp1r14a"
                     /gene_synonym="CPI-17; Cpi17"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgccccaacc ggaccttgag aggggtgggt gtgcggagcg ttctcgcttt tccgtgtggg
       61 catctgccac gacgtcattg cgccttcgtg ctttcgctgc gactaagagc tggggaccga
      121 acccagggcc ttgcacttcc tagatcggat ctctcagtga acctcgatct agcatccctg
      181 aggtcctcga gtctgttccg atcaccttct agtcgaaaaa gaaacacgga aagaacgaaa
      241 gaaagaatga aagaaagaaa gaaagagaaa aagttgttcc tcaggaccca gaggtcgaag
      301 cctgcacatt agcctgcacg tctctgtagg aagggaaact gaggcccgct ggtcggagtg
      361 gggcgggtcc cagaacacga gcccccgccc ccggtggccc cgccccaccc cggcccgtta
      421 gagacccaag cgcaagacag agcgtaaagt gcagacagcg gacggcggcg tgatggcagc
      481 gcagcggctg ggcaagcgcg tgctgagcaa gctgcagtcc ccttcgcgtg cccgcggccc
      541 ggggggcagc cctagtgggc tgcagaagcg gcacgcgcga gtcaccgtca aatacgaccg
      601 gcgagagctg cagcggcgac tggacgtgga gaagtggatc gacggacgct tggaagagct
      661 gtaccgcggc agggaggcag acatgccaga tgaggtcaac atcgacgagc tgctggaatt
      721 ggacagtgag gaggaaagat gccggaaaat ccggggactc ttggaggctt gcctgaatcc
      781 cacagaggac ttcgtccagg agctattggc caagcttcgg ggcctgcaca agcagccggg
      841 cttcccgcag cccagcccct cagatgaccc cagcctgagc ccccgccagg acccggctca
      901 cactgctcca ccgtgactgc gcccgcctct gctccacccc caaagcccag attgtttcta
      961 agttgtattt aatggttccg taactggc
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for protein phosphatase 1 regulatory subunit 14A isoform X1 (XP_063117377.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.