LOCUS NM_175602 1017 bp mRNA linear ROD 11-DEC-2024
DEFINITION Rattus norvegicus trace amine-associated receptor 9 (Taar9), mRNA.
ACCESSION NM_175602
VERSION NM_175602.1
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1017)
AUTHORS Murtazina,R.Z., Zhukov,I.S., Korenkova,O.M., Popova,E.A.,
Kuvarzin,S.R., Efimova,E.V., Kubarskaya,L.G., Batotsyrenova,E.G.,
Zolotoverkhaya,E.A., Vaganova,A.N., Apryatin,S.A., Alenina,N.V. and
Gainetdinov,R.R.
TITLE Genetic Deletion of Trace-Amine Associated Receptor 9 (TAAR9) in
Rats Leads to Decreased Blood Cholesterol Levels
JOURNAL Int J Mol Sci 22 (6), 2942 (2021)
PUBMED 33799339
REMARK GeneRIF: Genetic Deletion of Trace-Amine Associated Receptor 9
(TAAR9) in Rats Leads to Decreased Blood Cholesterol Levels.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1017)
AUTHORS Ferrero,D.M., Wacker,D., Roque,M.A., Baldwin,M.W., Stevens,R.C. and
Liberles,S.D.
TITLE Agonists for 13 trace amine-associated receptors provide insight
into the molecular basis of odor selectivity
JOURNAL ACS Chem Biol 7 (7), 1184-1189 (2012)
PUBMED 22545963
REFERENCE 3 (bases 1 to 1017)
AUTHORS Borowsky,B., Adham,N., Jones,K.A., Raddatz,R., Artymyshyn,R.,
Ogozalek,K.L., Durkin,M.M., Lakhlani,P.P., Bonini,J.A.,
Pathirana,S., Boyle,N., Pu,X., Kouranova,E., Lichtblau,H.,
Ochoa,F.Y., Branchek,T.A. and Gerald,C.
TITLE Trace amines: identification of a family of mammalian G
protein-coupled receptors
JOURNAL Proc Natl Acad Sci U S A 98 (16), 8966-8971 (2001)
PUBMED 11459929
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AF380190.1.
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..1017
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="Sprague-Dawley"
/db_xref="taxon:10116"
/chromosome="1"
/map="1p12"
gene 1..1017
/gene="Taar9"
/gene_synonym="Ta3"
/note="trace amine-associated receptor 9"
/db_xref="GeneID:319107"
/db_xref="RGD:631383"
CDS 1..1017
/gene="Taar9"
/gene_synonym="Ta3"
/note="taR-3; taR-9; trace amine receptor 9; trace amine
receptor 3"
/codon_start=1
/product="trace amine-associated receptor 9"
/protein_id="NP_783192.1"
/db_xref="GeneID:319107"
/db_xref="RGD:631383"
/translation="MELCYENVNGSCIKSSYSPWPRAILYAVLGLGALLAVFGNLLVI
TAILHFKQLHTPTNFLVASLACADFLVGVTVMPFSTVRSVEGCWYFGDTYCKFHTCFD
TSFCFASLFHLCCISIDRYVAVTDPLTYPTKFTISVSGVCIALSWFFSVTYSFSIFYT
GANEEGIEELVVALTCVGGCQAPLNQNWVLLCFLLFFLPTVVMVFLYGRIFLVAKQQA
RKIEGSANQPQASSESYKERVARRERKAAKTLGIAMAAFLVSWLPYIIDAVIDAYMNF
ITPAYVYEILVWCVYYNSAMNPLIYAFFYPWFRKAIKLIVSGKVFRADSSRTNLFSEE
AGAG"
misc_feature 25..27
/gene="Taar9"
/gene_synonym="Ta3"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q923Y6.1); glycosylation site"
misc_feature 70..144
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
transmembrane region"
misc_feature 175..240
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
transmembrane region"
misc_feature 286..354
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
transmembrane region"
misc_feature 415..480
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
transmembrane region"
misc_feature 490..531
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
Region: Extracellular Loop 2 (ECL2).
/evidence=ECO:0000250|UniProtKB:Q5QD04"
misc_feature 559..624
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
transmembrane region"
misc_feature 739..810
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
transmembrane region"
misc_feature 850..912
/gene="Taar9"
/gene_synonym="Ta3"
/note="propagated from UniProtKB/Swiss-Prot (Q923Y6.1);
transmembrane region"
exon 1..1017
/gene="Taar9"
/gene_synonym="Ta3"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 atggagctct gctacgagaa cgtgaatgga tcttgcatta aaagctccta ctcgccctgg
61 cctcgagcca tcctctatgc ggtccttggt ttgggagccc tgctggcagt gtttgggaac
121 ttactggtca tcaccgctat cctccacttt aaacagttgc acacgcctac aaactttctg
181 gtggcctcgc tggcctgtgc tgacttcttg gtgggggtga ctgtgatgcc ctttagcacg
241 gtgcggtctg tggagggctg ctggtacttt ggggacactt actgtaagtt ccacacgtgt
301 ttcgacacct ccttctgctt tgcgtctctg tttcacttat gctgcatctc cattgacagg
361 tacgttgcag tcaccgaccc actgacctat ccgaccaagt tcaccatttc ggtttctggc
421 gtgtgcatcg ctctctcgtg gttcttttct gtcacctaca gcttttccat cttttacaca
481 ggagccaacg aggaagggat tgaggaacta gtggttgctc tgacctgtgt gggaggctgc
541 caggctccac tgaatcagaa ttgggtttta ctttgtttcc ttttgttctt tctgcccact
601 gtcgtcatgg tgtttctcta tggtcggata tttttggtgg cgaagcaaca ggctaggaag
661 atagagggtt cggccaacca accccaggcc tcctctgaga gctacaagga aagagtagcc
721 agacgagaga ggaaggcggc caaaaccttg gggatcgcca tggctgcatt tctcgtgtcc
781 tggctgccat acattatcga tgccgtgatt gatgcctaca tgaacttcat aactcctgcc
841 tacgtctatg agatattagt gtggtgtgtt tactataatt cagctatgaa ccctttgata
901 tatgccttct tttatccttg gtttcgcaag gcaataaaac ttattgtgag tggcaaagtc
961 ttcagggctg actcatcaag aactaatctg ttctctgaag aagcaggtgc aggttaa
//