Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_182675.1
FASTA Graphics
LOCUS NM_182675 846 bp mRNA linear ROD 12-JAN-2022 DEFINITION Rattus norvegicus Rab40c, member RAS oncogene family (Rab40c), mRNA. ACCESSION NM_182675 VERSION NM_182675.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 846) AUTHORS Rodriguez-Gabin AG, Almazan G and Larocca JN. TITLE Vesicle transport in oligodendrocytes: probable role of Rab40c protein JOURNAL J Neurosci Res 76 (6), 758-770 (2004) PUBMED 15160388 REMARK GeneRIF: A novel Rab protein, Rab40c, was cloned from an oligodendrocyte cDNA library. Rab40c is localized in the perinuclear recycling compartment, suggesting its involvement in endocytic events such as receptor recycling. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AY190240.1. [WARNING] On Oct 29, 2022 this sequence was replaced by NM_182675.2. ##Evidence-Data-START## Transcript exon combination :: AY190240.1, BC128720.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..846 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="10" /map="10q12" gene 1..846 /gene="Rab40c" /note="Rab40c, member RAS oncogene family" /db_xref="GeneID:359728" /db_xref="RGD:727914" CDS 1..846 /gene="Rab40c" /note="localized in perinuclear recycling compartment" /codon_start=1 /product="ras-related protein Rab-40C" /protein_id="NP_872616.1" /db_xref="GeneID:359728" /db_xref="RGD:727914" /translation="MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYA YSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSF DGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCN FNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTI KSHLKSFSMANGMNAVMMHGRSYSLASGAGGSGSKGNSLKRSKSIRPPQSPPQNCSRS NCKIS" exon 1..142 /gene="Rab40c" /inference="alignment:Splign:2.1.0" exon 143..203 /gene="Rab40c" /inference="alignment:Splign:2.1.0" exon 204..264 /gene="Rab40c" /inference="alignment:Splign:2.1.0" exon 265..342 /gene="Rab40c" /inference="alignment:Splign:2.1.0" exon 343..565 /gene="Rab40c" /inference="alignment:Splign:2.1.0" exon 566..846 /gene="Rab40c" /inference="alignment:Splign:2.1.0" ORIGIN 1 atgggcaccc agggcagtcc agtgaagagc tacgattacc tgctcaagtt cctgctggtg 61 ggcgacagcg acgtgggcaa aggcgagatt ctggagagtc ttcaggacgg agcagccgaa 121 tccccgtacg cctacagcaa cggaatagac tataagacta ccaccatcct actagatgga 181 cggcgtgtca agctggagct atgggatact tcgggccagg gaaggttctg taccatcttc 241 aggtcctact cgaggggtgc gcagggaatc cttctggtgt acgacatcac caaccgttgg 301 tcctttgatg gcattgaccg gtggatcaag gagattgatg agcatgcacc tggtgttccc 361 cggatcctgg ttggaaaccg gctgcacctc gccttcaagc ggcaagtccc aacggagcag 421 gccagagcct acgcagagaa gaactgcatg accttctttg aagtcagccc gctgtgcaac 481 ttcaacgtca ttgagtcctt cactgagctc tcccgcattg tgctcatgcg gcatggcatg 541 gagaagatct ggaggcccaa tcgagttttc agcctgcagg acctctgctg ccgtgccatt 601 gtctcctgta ctcctgtgca cctcatcgac aagctccctc tacctgtcac catcaagagc 661 cacctcaagt ccttttccat ggccaacggc atgaatgctg tcatgatgca cggccgctcc 721 tactccctgg caagtggggc cgggggcagt ggcagcaagg gcaacagcct taagaggtcc 781 aagtccatcc gtccccccca gagcccacct cagaactgct ctcggagcaa ctgcaagatc 841 tcctag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on