Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AJ251687.1
FASTA Graphics
LOCUS AJ251687 1333 bp mRNA linear ROD 15-APR-2005 DEFINITION Rattus norvegicus mRNA for pepsinogen F protein, strain SD. ACCESSION AJ251687 VERSION AJ251687.1 KEYWORDS pepsinogen F protein. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 AUTHORS Kageyama,T., Ichinose,M., Tsukada-Kato,S., Omata,M., Narita,Y., Moriyama,A. and Yonezawa,S. TITLE Molecular cloning of neonate/infant-specific pepsinogens from rat stomach mucosa and their expressional change during development JOURNAL Biochem. Biophys. Res. Commun. 267 (3), 806-812 (2000) PUBMED 10673373 REFERENCE 2 (bases 1 to 1333) AUTHORS Kageyama,T. TITLE Direct Submission JOURNAL Submitted (25-NOV-1999) Kageyama T., Center for Human Evolutionary Modeling Research, Primate Research Institute, Kyoto University, Inuyama, 484-8506, JAPAN FEATURES Location/Qualifiers source 1..1333 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="SD" /db_xref="taxon:10116" /clone="pRT723" /dev_stage="4-day-old infant" CDS 21..1184 /function="unknown" /codon_start=1 /product="pepsinogen F protein" /protein_id="CAB75982.1" /db_xref="GOA:Q9JJX2" /db_xref="HSSP:4CMS" /db_xref="InterPro:IPR001461" /db_xref="InterPro:IPR001969" /db_xref="InterPro:IPR009007" /db_xref="InterPro:IPR012848" /db_xref="InterPro:IPR021109" /db_xref="UniProtKB/TrEMBL:Q9JJX2" /translation="MKWLWVLGLVALSECLVKIPLMKIKSMRENLRESHMLKDYLEKY PRSRAHVLLEQRRNPSVTYEPMRNYLDLVYIGTISIGTPPQEFKVVLDTGSSDLWVPS IYCSSPACAHHKVFNPLQSSTFLVSGRPVNVAYGSGEMSGFLAYDTVKIGDLTVVAQA FGLSLEEPGRFMEHAVFDGILGLGYPNLGLQGVTPVFDNLWIQGLIPQNLFAFYLSSK DEKGSVLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSISMNGEIIACDGGCQGIMDT GTSLVTGPRSSILNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIDSVTYPVPASAY IRKDHSHNCRSNFEESTDDPSDPELWVLGDVFLRLYFTVFDRANNRIGLASAA" sig_peptide 21..65 mat_peptide 66..1181 /product="pepsinogen F protein" ORIGIN 1 ccttagcctg ggaaaggatc atgaaatggc tttgggtcct cgggcttgtg gccctctcag 61 agtgcttggt caaaatccct ctgatgaaga ttaagtccat gcgagaaaac ctgcgggaaa 121 gccacatgct gaaggattac ctggagaagt accctcgcag ccgtgcccac gtgcttcttg 181 agcagcgcag gaacccatca gtaacttatg agcctatgag gaactaccta gacctggtct 241 acatcggcac catcagcatt ggcacgcccc ctcaggagtt caaggttgtc ttggatactg 301 gttcttcaga cctgtgggta ccatccatct actgctccag cccagcctgc gctcatcaca 361 aagtcttcaa ccctcttcag tcttccactt tcctggtctc aggccgacct gtgaatgttg 421 cctatggctc aggagagatg tctggatttc ttgcctatga cactgtcaag attggagacc 481 tcacggttgt ggcccaggca tttggcctga gcctggaaga acctggccgt ttcatggaac 541 atgctgtctt tgatggtatc ctgggactgg gataccccaa ccttggtctt cagggagtca 601 cacctgtctt tgacaaccta tggatacaag gcctcatccc ccagaatctc tttgccttct 661 acttgagcag caaggatgaa aagggcagcg tgctgatgct aggtggggtg gacccctcct 721 attaccatgg agagcttcac tgggtaccag tgtccaagcc cagctactgg cagttagctg 781 tggacagcat ctccatgaac ggggagatca ttgcctgtga tggtggctgc caaggtatca 841 tggatacagg gacctccttg gtgaccggcc cacgaagctc aatccttaac atccagaacc 901 tcattggtgc caaggcttct ggtgatggcg agtacttcct caagtgtgac accatcaaca 961 ccctacctga cattgtcttc accatcgaca gtgtgaccta cccagtgcca gccagtgcct 1021 acatccggaa ggatcattca cacaattgcc gaagcaactt tgaagaaagc acagatgacc 1081 cgtcagaccc tgagttgtgg gtgctggggg atgttttcct gaggctgtac ttcaccgtgt 1141 ttgatcgggc aaataacagg attggtctgg cttctgctgc atgagtgctg ggcctccttc 1201 agggaatggc caggcacacc cctcaacacg gaattgagta tgggtcattt catccaggaa 1261 gctgacccca ggctaggagg agctctgcaa gaccctgttc tgtgtaagaa ataaagattg 1321 cattcgcaaa gcc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on