Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_001037362.1
FASTA Graphics
LOCUS NM_001037362 1109 bp mRNA linear ROD 04-JUN-2024 DEFINITION Rattus norvegicus Idnk, gluconokinase (Idnk), mRNA. ACCESSION NM_001037362 XM_573980 VERSION NM_001037362.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1109) AUTHORS Gaudet,P., Livstone,M.S., Lewis,S.E. and Thomas,P.D. TITLE Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium JOURNAL Brief Bioinform 12 (5), 449-462 (2011) PUBMED 21873635 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC107923.1. On Nov 25, 2005 this sequence version replaced XM_573980.1. ##Evidence-Data-START## Transcript exon combination :: BC107923.1, CV105650.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMD00132261, SAMD00132263 [ECO:0006172] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1109 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="17" /map="17p14" gene 1..1109 /gene="Idnk" /note="Idnk, gluconokinase" /db_xref="GeneID:498695" /db_xref="RGD:1564546" exon 1..54 /gene="Idnk" /inference="alignment:Splign:2.1.0" CDS 5..562 /gene="Idnk" /EC_number="2.7.1.12" /note="gluconate kinase; idnK, gluconokinase homolog" /codon_start=1 /product="probable gluconokinase" /protein_id="NP_001032439.1" /db_xref="GeneID:498695" /db_xref="RGD:1564546" /translation="METPGVLLVMGVSGSGKSTVGALLANKLGWKFYDADDYHSEENR IKMGKGVPLNDQDRIPWLCSLHDILLRDVASGQSVVLACSALKKMYRDILNRGGSDVP PRSDESAKEEPLAGGKFLVVHLCGSFELIYGRLLQRRGHFMPPELLQSQFSILEPPSA PENFIHISVDKGLPEIAAAVLEALK" exon 55..85 /gene="Idnk" /inference="alignment:Splign:2.1.0" exon 86..172 /gene="Idnk" /inference="alignment:Splign:2.1.0" exon 173..216 /gene="Idnk" /inference="alignment:Splign:2.1.0" exon 217..1085 /gene="Idnk" /inference="alignment:Splign:2.1.0" ORIGIN 1 ggacatggag acacccgggg tgctgctggt gatgggagtg agcggctctg ggaaatccac 61 tgtgggtgcg ctgctggcca acaagctggg atggaaattc tatgatgccg atgattacca 121 ctctgaggag aatcggataa agatggggaa aggggtacca ctgaatgacc aggacaggat 181 tccatggctt tgcagcttgc acgacatttt actaagagat gtggcttcgg gacagtctgt 241 cgttctagcc tgttcagctc tgaagaaaat gtacagggac atcttgaacc gaggcggaag 301 tgacgtgcct ccgagaagtg atgagtcagc aaaggaggag ccgctggctg gcgggaagtt 361 cctggtggtc cacctctgcg ggtcgtttga gctcatttat ggacgcttgc tccaaaggag 421 aggacatttc atgccacccg agttactgca gtcccagttc agtattctgg agcccccatc 481 agctcccgaa aacttcatcc atatcagtgt ggacaaaggt ctcccagaga tcgcggctgc 541 agttctggaa gccctcaagt gaagtattcg cttcacgcct gtggggtcca gcgcgctctg 601 cctccaagtc ccactgtata ttctgaattc attgttttag agacagggtt tctctgtgta 661 gaccaggctg gtccggaact cagagatctg cctgcctctg ccactctgga gggctggaat 721 taaaggcgag gaccaccatg gtcaggctgt attctgaatt cttaattggg aacaaaccgc 781 agcgcgtgga ggtgtggcgg tggagacggt tgtttgactg tattaggagt ccgcggtgtg 841 cttggaaaga caagggggag gatgttaaat gttaaaaaac tggggctgga gagatggctc 901 ggcagttatg agcactgact gctcttctag aggtcctgag ttcaattccc agcaaccaca 961 tggtggctca caaccatctg taatgggatc caatgtcctc ttctggtgtg tctgaagaca 1021 gctgcggtgt actcccataa ataaatgagt aaaaataaat aaatcttttt ttaaaaagtt 1081 aaaaaaaaaa aaaaaaaaaa aaaaaaaaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on