Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_001100725.1
FASTA Graphics
LOCUS NM_001100725 1042 bp mRNA linear ROD 03-APR-2024 DEFINITION Rattus norvegicus exosome component 7 (Exosc7), mRNA. ACCESSION NM_001100725 XM_001078932 XM_236745 VERSION NM_001100725.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1042) AUTHORS Staals,R.H., Bronkhorst,A.W., Schilders,G., Slomovic,S., Schuster,G., Heck,A.J., Raijmakers,R. and Pruijn,G.J. TITLE Dis3-like 1: a novel exoribonuclease associated with the human exosome JOURNAL EMBO J 29 (14), 2358-2367 (2010) PUBMED 20531389 REFERENCE 2 (bases 1 to 1042) AUTHORS Liu,Q., Greimann,J.C. and Lima,C.D. TITLE Reconstitution, activities, and structure of the eukaryotic RNA exosome JOURNAL Cell 127 (6), 1223-1237 (2006) PUBMED 17174896 REMARK Erratum:[Cell. 2007 Oct 5;131(1):188-9] COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BF561514.1 and BC089995.1. On or before Nov 22, 2008 this sequence version replaced XM_001078932.1, XM_236745.4. ##Evidence-Data-START## Transcript exon combination :: FQ226090.1, SRR8487230.93536.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-109 BF561514.1 7-115 110-1042 BC089995.1 1-933 FEATURES Location/Qualifiers source 1..1042 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="8" /map="8q32" gene 1..1042 /gene="Exosc7" /note="exosome component 7" /db_xref="GeneID:316098" /db_xref="RGD:1309758" exon 1..64 /gene="Exosc7" /inference="alignment:Splign:2.1.0" CDS 8..883 /gene="Exosc7" /codon_start=1 /product="exosome complex component RRP42" /protein_id="NP_001094195.1" /db_xref="GeneID:316098" /db_xref="RGD:1309758" /translation="MASVSLSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSN TSGSARVKLGHTDILVGVKAEMGTPKLERPSEGYLEFFVDCSANATPEFEGRGGDDLG TEIANTLYRIFNNKSSVDLRSLCISPREHCWVLYVDVLLLECGGNLFDAISIAVKAAL FNTRIPRVRVLEDEEGSKDIELSDDPYDCIRLSVENVPCIVTLCKIGCRHVVDATLQE EACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMESSKRVGKVLHMSLQSLLHK EESLGPKRPKVGFLG" exon 65..166 /gene="Exosc7" /inference="alignment:Splign:2.1.0" exon 167..261 /gene="Exosc7" /inference="alignment:Splign:2.1.0" exon 262..427 /gene="Exosc7" /inference="alignment:Splign:2.1.0" exon 428..498 /gene="Exosc7" /inference="alignment:Splign:2.1.0" exon 499..622 /gene="Exosc7" /inference="alignment:Splign:2.1.0" exon 623..778 /gene="Exosc7" /inference="alignment:Splign:2.1.0" exon 779..1017 /gene="Exosc7" /inference="alignment:Splign:2.1.0" ORIGIN 1 gagcagcatg gcgtcggtgt cgctaagcga ggctgagaag gtctacatcg ttcatggagt 61 gcaggaagac cttcgggtgg atggccgtgg ctgtgaggac taccgatgtg ttgaagtaga 121 gactgatgtg gtgtctaaca ccagtgggtc tgccagagtc aagctgggtc atacagacat 181 cttggtggga gtgaaagcag agatggggac accgaagctg gagagaccaa gcgaaggcta 241 cctggagttc tttgttgact gttcagccaa tgctacccca gaattcgaag ggcgaggagg 301 tgatgacctc ggcacagaga ttgcaaatac cctctaccgg atatttaaca acaagagcag 361 cgtcgacctg aggtccctct gcatcagtcc tcgggagcac tgctgggtgc tgtatgtgga 421 cgtgctgctg ctggaatgtg gtgggaattt gttcgatgct atttccattg ctgtgaaagc 481 tgctctcttc aacacaagga taccaagggt tcgtgttctg gaggatgaag aagggtcgaa 541 ggacattgag ctgtctgatg atccttatga ctgcatccga ctgagtgtgg agaatgtccc 601 ctgcattgtc accctatgca agattggctg ccggcatgtg gtggatgcca cacttcaaga 661 ggaggcctgt tccctggcca gcttgctggt gtcggtgacc agcaaaggag tcgtgacatg 721 catgaggaaa gtggggaaag gaagcctgga tcctgagagt atcttcgaga tgatggagag 781 cagcaagcga gtgggcaaag tgctacacat gtccttgcag agtctcctgc acaaggaaga 841 aagtctgggg cccaagaggc caaaagtcgg gttcctgggg tgattgtctt cactgtcctg 901 gatggacatt ggttgctgca tttttccatt gagactggtt tgtatatatt tttcttaatt 961 gttaaattta agtcaacatt tgtaaatgta aaaataaagc ctattttttg gtctggtaaa 1021 aaaaaaaaaa aaaaaaaaaa aa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on