Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_001108986.1
FASTA Graphics
LOCUS NM_001108986 1164 bp mRNA linear ROD 23-MAR-2023 DEFINITION Rattus norvegicus PYM homolog 1, exon junction complex associated factor (Pym1), mRNA. ACCESSION NM_001108986 XM_001068398 XM_345769 VERSION NM_001108986.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1164) AUTHORS Baltz AG, Munschauer M, Schwanhausser B, Vasile A, Murakawa Y, Schueler M, Youngs N, Penfold-Brown D, Drew K, Milek M, Wyler E, Bonneau R, Selbach M, Dieterich C and Landthaler M. TITLE The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts JOURNAL Mol Cell 46 (5), 674-690 (2012) PUBMED 22681889 REFERENCE 2 (bases 1 to 1164) AUTHORS Gehring NH, Lamprinaki S, Kulozik AE and Hentze MW. TITLE Disassembly of exon junction complexes by PYM JOURNAL Cell 137 (3), 536-548 (2009) PUBMED 19410547 REFERENCE 3 (bases 1 to 1164) AUTHORS Diem MD, Chan CC, Younis I and Dreyfuss G. TITLE PYM binds the cytoplasmic exon-junction complex and ribosomes to enhance translation of spliced mRNAs JOURNAL Nat Struct Mol Biol 14 (12), 1173-1179 (2007) PUBMED 18026120 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH474104.2. On or before Oct 4, 2007 this sequence version replaced XM_345769.3, XM_001068398.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1164 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="7" /map="7q11" gene 1..1164 /gene="Pym1" /gene_synonym="RGD1306096; Wibg" /note="PYM homolog 1, exon junction complex associated factor" /db_xref="GeneID:366790" /db_xref="RGD:1306096" exon 1..105 /gene="Pym1" /gene_synonym="RGD1306096; Wibg" /inference="alignment:Splign:2.1.0" CDS 69..680 /gene="Pym1" /gene_synonym="RGD1306096; Wibg" /note="within bgcn homolog" /codon_start=1 /product="partner of Y14 and mago" /protein_id="NP_001102456.1" /db_xref="GeneID:366790" /db_xref="RGD:1306096" /translation="MKTSSTPEATGTGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPV YENKYVKFFKSKPELPPGLSPEATTQVTPSRPDSGEAGLSKTAKRNLKRKEKRRQQQE KDAEALSRTLDKVSLGDSAQMPSAHHGPQATPPAASDAPDSAATTEKAKKIKNLRKKL RQVEELQQRIQAGEISQPSREQLEKLARRRVLEEELEDLELGL" exon 106..199 /gene="Pym1" /gene_synonym="RGD1306096; Wibg" /inference="alignment:Splign:2.1.0" exon 200..1164 /gene="Pym1" /gene_synonym="RGD1306096; Wibg" /inference="alignment:Splign:2.1.0" ORIGIN 1 cactactgag cagcaggcca agaagttacc tcgccgctga atccccaggg ctgctcgcca 61 actcagtcat gaaaacctcc agcacccctg aggccacggg cacaggcaag tacattgcct 121 caacacagag acccgacggg acatggcgca agcaacggag ggtcaaagaa ggatacgtgc 181 cccaagagga ggtcccagtc tatgaaaaca agtatgtgaa gtttttcaag agtaaaccgg 241 aacttccccc agggctgagc cctgaggcca ccacacaggt cacaccatcc agacctgaca 301 gtggtgaagc aggcctctcc aagacagcca aacgcaacct gaagcggaag gagaagagga 361 ggcagcagca ggagaaagac gcggaggcct tgagcaggac tcttgataag gtgtctctgg 421 gagactcagc ccagatgccc agtgctcacc atggccccca agccacccct ccagctgcct 481 ccgatgcacc tgactctgct gccaccacag agaaagccaa gaagatcaag aacctgagga 541 agaagctgcg acaggtggag gagctgcagc agcgcatcca ggccggggag atcagccagc 601 ctagcagaga gcagctggag aagctggcac ggcggagggt gctggaggag gagctggagg 661 acttggagtt gggcctgtga ggcttcagga gtaggggagt ggactgcaga acaaaccatg 721 gggtgctctg gggtccaggg agcgtgggcc gcagcagtca ggaggggcac ccccatactg 781 gctcacttcc acctcctctg gcccgactcc gtcctccaga gccgaggctc tctctccttc 841 atccctttcc cttctcagct cccatttttg aacttttccc ttccatccat tgttcacagt 901 ctgagtgctg accccaggta cctctgctgc tgatctgggt gtcttgttga aaaggaaccc 961 caggagggtg ggagtctgtc ggagatctga ggctgagggt acaaggagta cccacgtttt 1021 agagtcttgg ttcctgttca gtgtttatga gttacttccc tgccatcccg aacctcttct 1081 tcctcttcct cttcctcctc ctcctcctct tttttttttt tttttttttt ttaaaggcag 1141 taagaataaa ttcaactaga cggc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on