U.S. flag

An official website of the United States government

Rattus norvegicus glial fibrillary acidic protein (Gfap), mRNA

NCBI Reference Sequence: NM_017009.2

FASTA Graphics 

LOCUS       NM_017009               2714 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus glial fibrillary acidic protein (Gfap), mRNA.
ACCESSION   NM_017009 XM_346410
VERSION     NM_017009.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2714)
  AUTHORS   Dandi,Epsilon., Theotokis,P., Petri,M.C., Sideropoulou,V.,
            Spandou,E. and Tata,D.A.
  TITLE     Environmental enrichment initiated in adolescence restores the
            reduced expression of synaptophysin and GFAP in the hippocampus of
            chronically stressed rats in a sex-specific manner
  JOURNAL   Dev Psychobiol 65 (7), e22422 (2023)
   PUBMED   37796476
  REMARK    GeneRIF: Environmental enrichment initiated in adolescence restores
            the reduced expression of synaptophysin and GFAP in the hippocampus
            of chronically stressed rats in a sex-specific manner.
REFERENCE   2  (bases 1 to 2714)
  AUTHORS   Gok,E. and Deveci,E.
  TITLE     Histopathological evaluation of IBA-1, GFAP activity in the brain
            cortex of rats administered cadmium chloride
  JOURNAL   Arch Ital Biol 160 (1-2), 20-27 (2022)
   PUBMED   35913387
  REMARK    GeneRIF: Histopathological evaluation of IBA-1, GFAP activity in
            the brain cortex of rats administered cadmium chloride.
REFERENCE   3  (bases 1 to 2714)
  AUTHORS   Aamodt,A.H., Hogestol,E.A., Popperud,T.H., Holter,J.C.,
            Dyrhol-Riise,A.M., Tonby,K., Stiksrud,B., Quist-Paulsen,E.,
            Berge,T., Barratt-Due,A., Aukrust,P., Heggelund,L., Blennow,K.,
            Zetterberg,H. and Harbo,H.F.
  TITLE     Blood neurofilament light concentration at admittance: a potential
            prognostic marker in COVID-19
  JOURNAL   J Neurol 268 (10), 3574-3583 (2021)
   PUBMED   33743046
REFERENCE   4  (bases 1 to 2714)
  AUTHORS   Othman,H., Lopez-Furelos,A., Leiro-Vidal,J.M., Ammari,M., Sakly,M.,
            Abdelmelek,H., Salas-Sanchez,A.A., Ares-Pena,F. and Lopez-Martin,E.
  TITLE     Exposure to 2.45 GHz Radiation Triggers Changes in HSP-70,
            Glucocorticoid Receptors and GFAP Biomarkers in Rat Brain
  JOURNAL   Int J Mol Sci 22 (10), 5103 (2021)
   PUBMED   34065959
  REMARK    GeneRIF: Exposure to 2.45 GHz Radiation Triggers Changes in HSP-70,
            Glucocorticoid Receptors and GFAP Biomarkers in Rat Brain.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2714)
  AUTHORS   Tsyba,D.L., Kirik,O.V., Kolpakova,M.E., Yakovleva,A.A. and
            Korzhevskii,D.E.
  TITLE     Expression of Nestin and Glial Fibrillary Acidic Protein in the
            Marginal Ischemic Zone of the Brain in SHR Rats
  JOURNAL   Bull Exp Biol Med 169 (4), 576-581 (2020)
   PUBMED   32910393
  REMARK    GeneRIF: Expression of Nestin and Glial Fibrillary Acidic Protein
            in the Marginal Ischemic Zone of the Brain in SHR Rats.
REFERENCE   6  (bases 1 to 2714)
  AUTHORS   McCall,M.A., Gregg,R.G., Behringer,R.R., Brenner,M., Delaney,C.L.,
            Galbreath,E.J., Zhang,C.L., Pearce,R.A., Chiu,S.Y. and Messing,A.
  TITLE     Targeted deletion in astrocyte intermediate filament (Gfap) alters
            neuronal physiology
  JOURNAL   Proc Natl Acad Sci U S A 93 (13), 6361-6366 (1996)
   PUBMED   8692820
REFERENCE   7  (bases 1 to 2714)
  AUTHORS   Molthagen,M., Schachner,M. and Bartsch,U.
  TITLE     Apoptotic cell death of photoreceptor cells in mice deficient for
            the adhesion molecule on glia (AMOG, the beta 2- subunit of the Na,
            K-ATPase)
  JOURNAL   J Neurocytol 25 (4), 243-255 (1996)
   PUBMED   8793730
REFERENCE   8  (bases 1 to 2714)
  AUTHORS   Condorelli,D.F., Nicoletti,V.G., Barresi,V., Caruso,A.,
            Conticello,S., de Vellis,J. and Giuffrida Stella,A.M.
  TITLE     Tissue-specific DNA methylation patterns of the rat glial
            fibrillary acidic protein gene
  JOURNAL   J Neurosci Res 39 (6), 694-707 (1994)
   PUBMED   7897704
REFERENCE   9  (bases 1 to 2714)
  AUTHORS   Feinstein,D.L., Weinmaster,G.A. and Milner,R.J.
  TITLE     Isolation of cDNA clones encoding rat glial fibrillary acidic
            protein: expression in astrocytes and in Schwann cells
  JOURNAL   J Neurosci Res 32 (1), 1-14 (1992)
   PUBMED   1629938
REFERENCE   10 (bases 1 to 2714)
  AUTHORS   Nichols,N.R., Osterburg,H.H., Masters,J.N., Millar,S.L. and
            Finch,C.E.
  TITLE     Messenger RNA for glial fibrillary acidic protein is decreased in
            rat brain following acute and chronic corticosterone treatment
  JOURNAL   Brain Res Mol Brain Res 7 (1), 1-7 (1990)
   PUBMED   2153890
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC088851.1.
            
            On Oct 12, 2007 this sequence version replaced NM_017009.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC088851.1, U03700.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760393, SAMEA5760433
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..2714
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q32.1"
     gene            1..2714
                     /gene="Gfap"
                     /note="glial fibrillary acidic protein"
                     /db_xref="GeneID:24387"
                     /db_xref="RGD:2679"
     exon            1..456
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     CDS             2..1294
                     /gene="Gfap"
                     /note="intermediate filament; glial fibrillary acidic
                     protein alpha; glial fibrillary acidic protein delta"
                     /codon_start=1
                     /product="glial fibrillary acidic protein"
                     /protein_id="NP_058705.2"
                     /db_xref="GeneID:24387"
                     /db_xref="RGD:2679"
                     /translation="MERRRITSARRSYASSETMVRGHGPTRHLGTIPRLSLSRMTPPL
                     PARVDFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQL
                     RAKEPTKLADVYQAELRELRLRLDQLTTNSARLEVERDNLTQDLGTLRQKLQDETNLR
                     LEAENNLAVYRQEADEATLARVDLERKVESLEEEIQFLRKIHEEEVRELQEQLAQQQV
                     HVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDVASRNAELLRQA
                     KHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQ
                     SLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSL
                     DTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM"
     misc_feature    2..211
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Head"
     misc_feature    2..94
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    20..22
                     /gene="Gfap"
                     /note="Phosphothreonine, by AURKB and ROCK1.
                     /evidence=ECO:0000250|UniProtKB:P14136; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    32..34
                     /gene="Gfap"
                     /note="Omega-N-methylarginine.
                     /evidence=ECO:0000250|UniProtKB:P03995; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); methylation site"
     misc_feature    35..37
                     /gene="Gfap"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    62..64
                     /gene="Gfap"
                     /note="Omega-N-methylarginine.
                     /evidence=ECO:0000250|UniProtKB:P03995; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); methylation site"
     misc_feature    107..109
                     /gene="Gfap"
                     /note="Phosphoserine, by AURKB and ROCK1.
                     /evidence=ECO:0000250|UniProtKB:P14136; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    122..124
                     /gene="Gfap"
                     /note="Phosphothreonine.
                     /evidence=ECO:0000250|UniProtKB:P03995; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    212..307
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Coil 1A"
     misc_feature    239..241
                     /gene="Gfap"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    308..340
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Linker 1"
     misc_feature    323..325
                     /gene="Gfap"
                     /note="Phosphothreonine. /evidence=ECO:0000269|Ref.9;
                     propagated from UniProtKB/Swiss-Prot (P47819.2);
                     phosphorylation site"
     misc_feature    341..637
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Coil 1B"
     misc_feature    443..445
                     /gene="Gfap"
                     /note="Phosphothreonine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    638..685
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Linker 12"
     misc_feature    686..751
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Coil 2A"
     misc_feature    752..763
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Linker 2"
     misc_feature    764..1126
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Coil 2B"
     misc_feature    800..802
                     /gene="Gfap"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    962..964
                     /gene="Gfap"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     misc_feature    1127..1291
                     /gene="Gfap"
                     /note="propagated from UniProtKB/Swiss-Prot (P47819.2);
                     Region: Tail"
     misc_feature    1142..1144
                     /gene="Gfap"
                     /note="Phosphothreonine. /evidence=ECO:0000269|Ref.9;
                     propagated from UniProtKB/Swiss-Prot (P47819.2);
                     phosphorylation site"
     misc_feature    1148..1150
                     /gene="Gfap"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P47819.2); phosphorylation site"
     exon            457..517
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     exon            518..613
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     exon            614..775
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     exon            776..901
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     exon            902..1122
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     exon            1123..1166
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     exon            1167..1252
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
     exon            1253..2688
                     /gene="Gfap"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 gatggagcgg agacgtatca cctctgcacg ccgctcctat gcctcctccg agacgatggt
       61 caggggccat ggtcctacca gacacctggg taccattccg cgcctctccc tgtctcgaat
      121 gacgcctcca ctccctgcca gggtagactt ctccctggcc ggggcgctca atgccggctt
      181 caaagagact cgggccagcg agcgtgcgga gatgatggag ctcaatgacc gctttgctag
      241 ctacatcgag aaggtccgct tcctggaaca gcaaaacaag gcgctggcag ctgagctgaa
      301 ccagcttcga gccaaggagc ccaccaaact ggctgacgtt taccaggcag aacttcggga
      361 gctgcggctg cgtctggacc agcttactac caacagtgcc cggctggagg tggagaggga
      421 caatctcaca caggacctcg gcaccctgag gcagaagctc caagatgaaa ccaacctgag
      481 gctggaggcg gagaacaacc tggctgtgta cagacaggag gcggatgaag ccaccttggc
      541 tcgtgtggat ctggagagga aggttgagtc gctggaggag gagatccagt tcttgaggaa
      601 gatccatgag gaggaagttc gagaactcca ggagcagctg gcccagcagc aggtccacgt
      661 ggagatggat gtggccaagc cagacctcac agcggctctg agagagattc gcactcagta
      721 cgaggcagtg gccaccagta acatgcaaga aacagaagag tggtatcggt ccaagtttgc
      781 agacctcaca gacgttgctt cccgcaacgc agagctgctc cgccaggcca agcacgaggc
      841 taatgactat cgccgccaac tgcaggcctt gacctgcgac cttgagtcct tgcgcggcac
      901 gaacgagtcc ttggagaggc aaatgcgcga acaggaggag cgccacgcgc gggagtcggc
      961 gagttaccag gaggcactcg ctcggctgga ggaggagggc caaagcctca aggaggagat
     1021 ggcccgccac ctgcaggagt accaggatct actcaacgtt aagctagccc tggacatcga
     1081 gatcgccacc tacaggaaat tgctggaggg cgaagaaaac cgcatcacca ttcctgtaca
     1141 gactttctcc aacctccaga tccgagaaac cagcctggac accaaatctg tgtcagaagg
     1201 ccacctcaag aggaacatcg tggtaaagac ggtggagatg cgggatggcg aggtcattaa
     1261 ggagtcgaag caggagcaca aggatgtgat gtgaggtgtg cccagctggc agcccttgcc
     1321 atacagtgtg agggcctaaa gctccctcct cagatagtct tgtttgctag gcccaattcc
     1381 catccacacc agtgctcccc ttccttctgt ttttatgccc acggctcggt cagtgcggag
     1441 tctcatggac ggcacagacc accctgcatc tccaactaac aggatactca ccccaaaggg
     1501 gcaatcagga ggggaggacc cccctccccc cagctgggtt agaactggaa gaaagaggaa
     1561 agacaggggc agggagactt aacaaatccc ttccttcatc cttgttgtta tggaaaccgt
     1621 tgccagagct ggaggtctct gggaactgga ctttgagttt tcataggctg ctggagcaag
     1681 acaaacattc agacagaaag gaaaagatcc cgaggcaaag aatctctagc cagaggccta
     1741 ggcatctgga agaaccctga cgatgtagga gtgggtaggg cagacttgct acctggaatg
     1801 gccactaagg cagtcctgaa gggcccccct ccggagggat gaccctcgtg tatcggcccc
     1861 actgagcagc cctgcaggtt gatgccccac gagcgtgtga aaacttggtt cttggcatgt
     1921 ggcaggctct atagcataag tggagaggga aggtgtactg gagggtatag aggagggctc
     1981 tctggcccct aagtatggat gcggagaggg gggagcccag gaaggctacc ccgctcaggc
     2041 tgcaggggtg ccatggcgga ggaaccggtg gagataactt ggacaatgga gttggaagtt
     2101 gtaggcaact agttacactt ggctctgaat ccttggaatc aaggaaatga cctgttctct
     2161 caaagacact gaaacaggag agagggactt ccatccactg ggcagggtac aggcgcgtct
     2221 cagttgtgaa ggtctattcc tggttgctca gtccccaact gcgcatcacc ctgggcttct
     2281 caacctggaa gagtccacaa ccatccttct gaggccctcc atccccacaa ccactagctg
     2341 ttgttctcca agccaagggc cccattccct ttcttatgca tgtacggagt atcgcctaga
     2401 ctttaagcgt ccatcctgtt tgaaagtttg ggaaactgac acacgttgtg ttcaagcagc
     2461 ctggtgtgga gtgccttcgt attagtgtac cctctcggaa gctggttggt gggcaggtga
     2521 ggaagaaatg gagctgaaag tgtcccctca gttgtccttt cctccccctc taaggtccct
     2581 cccttttccc aggacatcgt acactccccc ccttgtcacc tctgctaacc ttcagagcag
     2641 tactgtcacc tttactcact gggcagaaat aaagacagtg tcagaggcaa aaaaaaaaaa
     2701 aaaaaaaaaa aaaa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for glial fibrillary acidic protein (NP_058705.2).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.