Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NM_031130.1
FASTA Graphics
LOCUS NM_031130 2514 bp mRNA linear ROD 05-FEB-2018 DEFINITION Rattus norvegicus nuclear receptor subfamily 2, group F, member 1 (Nr2f1), mRNA. ACCESSION NM_031130 XM_346611 VERSION NM_031130.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2514) AUTHORS Chiang DY, Cuthbertson DW, Ruiz FR, Li N and Pereira FA. TITLE A coregulatory network of NR2F1 and microRNA-140 JOURNAL PLoS ONE 8 (12), e83358 (2013) PUBMED 24349493 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 2514) AUTHORS Armentano M, Chou SJ, Tomassy GS, Leingartner A, O'Leary DD and Studer M. TITLE COUP-TFI regulates the balance of cortical patterning between frontal/motor and sensory areas JOURNAL Nat. Neurosci. 10 (10), 1277-1286 (2007) PUBMED 17828260 REFERENCE 3 (bases 1 to 2514) AUTHORS Tripodi M, Filosa A, Armentano M and Studer M. TITLE The COUP-TF nuclear receptors regulate cell migration in the mammalian basal forebrain JOURNAL Development 131 (24), 6119-6129 (2004) PUBMED 15548577 REFERENCE 4 (bases 1 to 2514) AUTHORS Zhang Y and Dufau ML. TITLE Nuclear orphan receptors regulate transcription of the gene for the human luteinizing hormone receptor JOURNAL J. Biol. Chem. 275 (4), 2763-2770 (2000) PUBMED 10644740 REFERENCE 5 (bases 1 to 2514) AUTHORS Yoshikawa T, Xing GQ and Detera-Wadleigh SD. TITLE Detection, simultaneous display and direct sequencing of multiple nuclear hormone receptor genes using bilaterally targeted RNA fingerprinting JOURNAL Biochim. Biophys. Acta 1264 (1), 63-71 (1995) PUBMED 7578258 REFERENCE 6 (bases 1 to 2514) AUTHORS Connor H, Nornes H and Neuman T. TITLE Expression screening reveals an orphan receptor chick ovalbumin upstream promoter transcription factor I as a regulator of neurite/substrate-cell contacts and cell aggregation JOURNAL J. Biol. Chem. 270 (25), 15066-15070 (1995) PUBMED 7797489 REFERENCE 7 (bases 1 to 2514) AUTHORS Ben-Shushan E, Sharir H, Pikarsky E and Bergman Y. TITLE A dynamic balance between ARP-1/COUP-TFII, EAR-3/COUP-TFI, and retinoic acid receptor:retinoid X receptor heterodimers regulates Oct-3/4 expression in embryonal carcinoma cells JOURNAL Mol. Cell. Biol. 15 (2), 1034-1048 (1995) PUBMED 7823919 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from U10995.1. [WARNING] On Nov 25, 2020 this sequence was replaced by NM_031130.2. On Apr 19, 2005 this sequence version replaced XM_346611.2. Summary: acts as a transcriptional activator; inhibits neurite outgrowth; may regulate cell surface interactions during neurogenesis [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: U10995.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..2514 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="W" /db_xref="taxon:10116" /chromosome="2" /map="2q11" gene 1..2514 /gene="Nr2f1" /gene_synonym="COUP-TFI" /note="nuclear receptor subfamily 2, group F, member 1" /db_xref="GeneID:81808" /db_xref="RGD:621682" misc_feature 19..21 /gene="Nr2f1" /gene_synonym="COUP-TFI" /note="upstream in-frame stop codon" CDS 475..1734 /gene="Nr2f1" /gene_synonym="COUP-TFI" /codon_start=1 /product="COUP transcription factor 1" /protein_id="NP_112392.1" /db_xref="GeneID:81808" /db_xref="RGD:621682" /translation="MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGEQQQAGSG APHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEG CKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPP TQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICE LAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAVLAAA GLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDA AHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGK TPIETLIRDMLLSGSSFNWPYMSIQCS" ORIGIN 1 cgccgcctgt gccatttctg attttgcaac ttggggaaga agaaaaaagc gagagaaggg 61 agctcgctcg ccggggggtg gggagggggg agagagagcg cggccccccc aggaacggag 121 cgcggggggg agcgggcgag gggagcaggg gtgttggggg ggagcctgag agcctggggg 181 ggctgcaaaa agagagaaag aaaacagcag gaaccacaac aaaactccag cagggcgggc 241 gggctccgca gcagcagcgg ggcggccgag gcagtacggc agcggcggcg gcggcggagg 301 cagcggccgg tgtccggctc gggctcggct cctgcgaccc cggggcgccc ggcgggcccc 361 ccgccccctc cccctccccc cttccccttc cccttcccct cccagcgcgc ccgcgcgccc 421 cgccgccctc ggcgagcagc tcggctcccc ccagcgctcc ccgggcccaa agatatggca 481 atggtagtta gcagctggcg agatccgcag gacgacgtgg ccgggggcaa ccccggcggc 541 cccaaccccg cagcgcaggc agcccgcggc ggcggcggcg gcgagcaaca gcaggcgggc 601 tccggcgcgc cgcacacgcc gcagaccccg ggccagcccg gagcgcccgc cacccccggc 661 acggcagggg acaagggcca gggcccgccc ggttcaggcc agagccagca gcacatcgag 721 tgcgtggtgt gcggggacaa gtcgagcggc aagcactacg gccaattcac ctgcgagggc 781 tgcaaaagtt tcttcaagag gagcgtccgc aggaacttaa cttacacatg ccgtgccaac 841 aggaactgtc ccatcgacca gcaccaccgc aaccagtgcc aatactgccg cctcaagaag 901 tgcctcaaag tgggcatgag gcgggaagcg gttcagcgag gaagaatgcc tccaacccag 961 cccaatccag gccagtacgc actcacaaac ggggatcccc tcaatggcca ctgctacctg 1021 tccggctaca tctccctgct gctgcgagca gagccctacc ccacgtcgcg ttatggcagc 1081 cagtgcatgc agcccaacaa catcatgggc atcgagaaca tctgcgagct ggcagcccgc 1141 ctcctcttca gcgccgtcga gtgggcccgc aacatcccgt tcttcccgga tctgcagatc 1201 accgaccagg tgtccctcct acgcctcacc tggagcgagc tgttcgtgct caacgcggcc 1261 cagtgctcca tgcccctgca cgtggccgtg ctggcagcag ccggcctaca cgcctcgccc 1321 atgtccgcgg accgggtcgt ggccttcatg gaccacatcc gcatctttca ggaacaggtg 1381 gagaagctca aggcgctgca cgtcgactct gccgagtaca gctgcctcaa agccatcgtg 1441 ctgttcacgt cagatgcttg tggcctgtcg gatgctgcac acatcgaaag cctgcaggag 1501 aaatcgcagt gtgcactgga ggaatacgtg aggagccagt accccaacca gcccagccgc 1561 tttggcaaac tgctgctgcg attgccctct cttcgcacag tgtcctcttc tgtcatagag 1621 cagctcttct tcgtccgttt ggtaggtaaa acccccatcg aaactctcat ccgagacatg 1681 ttgttgtcag ggagcagttt caactggcct tacatgtcca tccagtgctc ctagaccttg 1741 ggtgtttccc acctgcccct gcacccccta acgccctaga gactaagcgg actcaccctg 1801 taccaaggac tcaaaagcct ttggggatgc tggtatcagg gcaggcaggg cggaggggag 1861 gagggccgag gagaggccca ctctgcagaa atacaatccg agctacaaag catgggaaaa 1921 agagactctt ttaggatcag atctgtgagc acgttggcga ggaaaaacaa aacaaacaaa 1981 aaaaagaacc ttgtgtctgt ctggtgaaaa aaagaaaaac aaattggaag agaggaccat 2041 gagaatttta ataaaacaga aggaaactaa tggaccttcc aggatttatt gtggacggat 2101 gtggatatat tctgtacagg aacaacacat atggaagtgg actgaagcct atgtagaaac 2161 acacacacac tgaacattgt tattcatttt gtaaaatact agtctttatt ttgcattttt 2221 cgtaaaattt aaacatcgta tgcgcataaa caaaaatgaa caagaattag gcggaaataa 2281 cattttccaa ataattataa aatataaata acattttcca aataattata aaatatttgt 2341 cctgtgtcta tgtatctata tctgttttgt atttttttct ggttccaaac cagatttcct 2401 gtgattctat actaataatt tttgatataa ccctttgctt cttataatga gtgcgatata 2461 tgttgtcgag gctgttcttc aagaattaaa attgaagtga aaatttaaac aaaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on