U.S. flag

An official website of the United States government

Rattus norvegicus KiSS-1 metastasis-suppressor (Kiss1), transcript variant 1, mRNA

NCBI Reference Sequence: NM_181692.2

FASTA Graphics 

LOCUS       NM_181692                691 bp    mRNA    linear   ROD 31-MAR-2024
DEFINITION  Rattus norvegicus KiSS-1 metastasis-suppressor (Kiss1), transcript
            variant 1, mRNA.
ACCESSION   NM_181692
VERSION     NM_181692.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 691)
  AUTHORS   Uenoyama,Y., Inoue,N. and Tsukamura,H.
  TITLE     Kisspeptin and lactational anestrus: Current understanding and
            future prospects
  JOURNAL   Peptides 166, 171026 (2023)
   PUBMED   37230188
  REMARK    GeneRIF: Kisspeptin and lactational anestrus: Current understanding
            and future prospects.
REFERENCE   2  (bases 1 to 691)
  AUTHORS   Olaniyi,K.S., Areloegbe,S.E. and Oyeleke,M.B.
  TITLE     Acetate restores hypothalamic-adipose kisspeptin status in a rat
            model of PCOS by suppression of NLRP3 immunoreactivity
  JOURNAL   Endocrine 78 (3), 628-640 (2022)
   PUBMED   36114434
  REMARK    GeneRIF: Acetate restores hypothalamic-adipose kisspeptin status in
            a rat model of PCOS by suppression of NLRP3 immunoreactivity.
REFERENCE   3  (bases 1 to 691)
  AUTHORS   Dai,R., Xu,W., Chen,W., Cui,L., Li,L., Zhou,J., Jin,X., Wang,Y.,
            Wang,L. and Sun,Y.
  TITLE     Epigenetic modification of Kiss1 gene expression in the AVPV is
            essential for female reproductive aging
  JOURNAL   Biosci Trends 16 (5), 346-358 (2022)
   PUBMED   36273897
  REMARK    GeneRIF: Epigenetic modification of Kiss1 gene expression in the
            AVPV is essential for female reproductive aging.
REFERENCE   4  (bases 1 to 691)
  AUTHORS   Magata,F., Toda,L., Sato,M., Sakono,T., Chambers,J.K., Uchida,K.,
            Tsukamura,H. and Matsuda,F.
  TITLE     Intrauterine LPS inhibited arcuate Kiss1 expression, LH pulses, and
            ovarian function in rats
  JOURNAL   Reproduction 164 (5), 207-219 (2022)
   PUBMED   36099331
  REMARK    GeneRIF: Intrauterine LPS inhibited arcuate Kiss1 expression, LH
            pulses, and ovarian function in rats.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 691)
  AUTHORS   Okada,H., Kanasaki,H., Tumurbaatar,T., Tumurgan,Z., Oride,A. and
            Kyo,S.
  TITLE     Hyperandrogenism induces proportional changes in the expression of
            Kiss-1, Tac2, and DynA in hypothalamic KNDy neurons
  JOURNAL   Reprod Biol Endocrinol 20 (1), 91 (2022)
   PUBMED   35729637
  REMARK    GeneRIF: Hyperandrogenism induces proportional changes in the
            expression of Kiss-1, Tac2, and DynA in hypothalamic KNDy neurons.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 691)
  AUTHORS   Terao,Y., Kumano,S., Takatsu,Y., Hattori,M., Nishimura,A.,
            Ohtaki,T. and Shintani,Y.
  TITLE     Expression of KiSS-1, a metastasis suppressor gene, in trophoblast
            giant cells of the rat placenta
  JOURNAL   Biochim Biophys Acta 1678 (2-3), 102-110 (2004)
   PUBMED   15157736
  REMARK    GeneRIF: metastin/OT7T175 signaling may participate in implantation
            of the mammalian embryo, placenta formation, and maintenance of
            pregnancy
REFERENCE   7  (bases 1 to 691)
  AUTHORS   Sanchez-Carbayo,M., Capodieci,P. and Cordon-Cardo,C.
  TITLE     Tumor suppressor role of KiSS-1 in bladder cancer: loss of KiSS-1
            expression is associated with bladder cancer progression and
            clinical outcome
  JOURNAL   Am J Pathol 162 (2), 609-617 (2003)
   PUBMED   12547718
REFERENCE   8  (bases 1 to 691)
  AUTHORS   Dun,S.L., Brailoiu,G.C., Parsons,A., Yang,J., Zeng,Q., Chen,X.,
            Chang,J.K. and Dun,N.J.
  TITLE     Metastin-like immunoreactivity in the rat medulla oblongata and
            spinal cord
  JOURNAL   Neurosci Lett 335 (3), 197-201 (2003)
   PUBMED   12531466
  REMARK    GeneRIF: Metastin-like immunoreactivity is present in the spinal
            cord and medulla oblongata, and the pattern of distribution in
            these regions suggests that this novel peptide may participate in
            autonomic and sensory neural signaling.
REFERENCE   9  (bases 1 to 691)
  AUTHORS   Stafford,L.J., Xia,C., Ma,W., Cai,Y. and Liu,M.
  TITLE     Identification and characterization of mouse metastasis-suppressor
            KiSS1 and its G-protein-coupled receptor
  JOURNAL   Cancer Res 62 (19), 5399-5404 (2002)
   PUBMED   12359743
REFERENCE   10 (bases 1 to 691)
  AUTHORS   Kotani,M., Detheux,M., Vandenbogaerde,A., Communi,D.,
            Vanderwinden,J.M., Le Poul,E., Brezillon,S., Tyldesley,R.,
            Suarez-Huerta,N., Vandeput,F., Blanpain,C., Schiffmann,S.N.,
            Vassart,G. and Parmentier,M.
  TITLE     The metastasis suppressor gene KiSS-1 encodes kisspeptins, the
            natural ligands of the orphan G protein-coupled receptor GPR54
  JOURNAL   J Biol Chem 276 (37), 34631-34636 (2001)
   PUBMED   11457843
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000013.1.
            
            On Oct 13, 2022 this sequence version replaced NM_181692.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: JX139031.1, SRR26360194.1803802.1
                                           [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-94                JAXUCZ010000013.1  47327159-47327252
            95-306              JAXUCZ010000013.1  47330053-47330264
            307-691             JAXUCZ010000013.1  47332375-47332759
FEATURES             Location/Qualifiers
     source          1..691
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="13"
                     /map="13q13"
     gene            1..691
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /note="KiSS-1 metastasis-suppressor"
                     /db_xref="GeneID:289023"
                     /db_xref="RGD:727850"
     exon            1..94
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /inference="alignment:Splign:2.1.0"
     exon            95..306
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    114..116
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /note="upstream in-frame stop codon"
     CDS             204..596
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /note="metastasis-suppressor KiSS-1; kisspeptin-1; MLL
                     septin-like fusion; metastin; Kiss1 variant E1a-E2b-E3;
                     Kiss1 variant E1b-E2a-E3; Kiss1 variant E1b-E2b-E3"
                     /codon_start=1
                     /product="metastasis-suppressor KiSS-1 precursor"
                     /protein_id="NP_859043.1"
                     /db_xref="GeneID:289023"
                     /db_xref="RGD:727850"
                     /translation="MISLASWQLLLLLCVASFGEPLAKMAPVVNPEPTGQQSGPQELV
                     NAWQKGPRYAESKPGAAGLRARRTSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQ
                     REKDMSAYNWNSFGLRYGRRQVARAARG"
     sig_peptide     204..260
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     261..593
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /product="Metastasis-suppressor KiSS-1.
                     /id=PRO_0000021555"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7TSB7.1)"
     misc_feature    357..476
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7TSB7.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    531..560
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7TSB7.1);
                     Region: Essential for receptor binding and receptor
                     activation"
     misc_feature    531..533
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /note="Phosphotyrosine.
                     /evidence=ECO:0000250|UniProtKB:Q15726; propagated from
                     UniProtKB/Swiss-Prot (Q7TSB7.1); phosphorylation site"
     misc_feature    558..560
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /note="Tyrosine amide. /evidence=ECO:0000250; propagated
                     from UniProtKB/Swiss-Prot (Q7TSB7.1); amidation site"
     exon            307..691
                     /gene="Kiss1"
                     /gene_synonym="Eseptin"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 agaggaagcc caggagccag aggctcccct cagtgtgctc caactaccca agtggctctt
       61 ctccctccgg ccctcaagcc aggacccagc caaggcgctc tctttgacct aggtaggctc
      121 tggtgaatac taactctggc ctggtcttca ttgcctctct tcgtctcagc ctctggacac
      181 cctgtggatc tgcctcttcc agaatgatct cgctggcttc ttggcagctg ctgcttctcc
      241 tctgtgtggc ctcttttggg gagccactgg caaaaatggc acctgtggtg aaccctgaac
      301 ccacaggcca acagtccgga ccccaggaac tcgttaatgc ctggcaaaag ggcccgcggt
      361 atgcagagag caagcctggg gctgcaggac tgcgcgctcg ccgaacatcg ccatgcccgc
      421 cggtggagaa ccccacgggg caccagcggc ccccgtgtgc cacccgcagt cgcctgatcc
      481 ctgcgccccg cggatcggtg ctggtgcagc gcgagaagga catgtcagcc tacaactgga
      541 actcctttgg cctgcgctac ggcaggaggc aggtggcgcg ggcggcacgg ggctgagtgc
      601 agggttgcag gtggattgca gcccacccca tggcagaggc caaggcaggg agcttctaga
      661 cttgtgcaat aaaagcaatg ctgtcgcctt a
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.