LOCUS NM_181692 691 bp mRNA linear ROD 31-MAR-2024
DEFINITION Rattus norvegicus KiSS-1 metastasis-suppressor (Kiss1), transcript
variant 1, mRNA.
ACCESSION NM_181692
VERSION NM_181692.2
KEYWORDS RefSeq.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 691)
AUTHORS Uenoyama,Y., Inoue,N. and Tsukamura,H.
TITLE Kisspeptin and lactational anestrus: Current understanding and
future prospects
JOURNAL Peptides 166, 171026 (2023)
PUBMED 37230188
REMARK GeneRIF: Kisspeptin and lactational anestrus: Current understanding
and future prospects.
REFERENCE 2 (bases 1 to 691)
AUTHORS Olaniyi,K.S., Areloegbe,S.E. and Oyeleke,M.B.
TITLE Acetate restores hypothalamic-adipose kisspeptin status in a rat
model of PCOS by suppression of NLRP3 immunoreactivity
JOURNAL Endocrine 78 (3), 628-640 (2022)
PUBMED 36114434
REMARK GeneRIF: Acetate restores hypothalamic-adipose kisspeptin status in
a rat model of PCOS by suppression of NLRP3 immunoreactivity.
REFERENCE 3 (bases 1 to 691)
AUTHORS Dai,R., Xu,W., Chen,W., Cui,L., Li,L., Zhou,J., Jin,X., Wang,Y.,
Wang,L. and Sun,Y.
TITLE Epigenetic modification of Kiss1 gene expression in the AVPV is
essential for female reproductive aging
JOURNAL Biosci Trends 16 (5), 346-358 (2022)
PUBMED 36273897
REMARK GeneRIF: Epigenetic modification of Kiss1 gene expression in the
AVPV is essential for female reproductive aging.
REFERENCE 4 (bases 1 to 691)
AUTHORS Magata,F., Toda,L., Sato,M., Sakono,T., Chambers,J.K., Uchida,K.,
Tsukamura,H. and Matsuda,F.
TITLE Intrauterine LPS inhibited arcuate Kiss1 expression, LH pulses, and
ovarian function in rats
JOURNAL Reproduction 164 (5), 207-219 (2022)
PUBMED 36099331
REMARK GeneRIF: Intrauterine LPS inhibited arcuate Kiss1 expression, LH
pulses, and ovarian function in rats.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 691)
AUTHORS Okada,H., Kanasaki,H., Tumurbaatar,T., Tumurgan,Z., Oride,A. and
Kyo,S.
TITLE Hyperandrogenism induces proportional changes in the expression of
Kiss-1, Tac2, and DynA in hypothalamic KNDy neurons
JOURNAL Reprod Biol Endocrinol 20 (1), 91 (2022)
PUBMED 35729637
REMARK GeneRIF: Hyperandrogenism induces proportional changes in the
expression of Kiss-1, Tac2, and DynA in hypothalamic KNDy neurons.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 691)
AUTHORS Terao,Y., Kumano,S., Takatsu,Y., Hattori,M., Nishimura,A.,
Ohtaki,T. and Shintani,Y.
TITLE Expression of KiSS-1, a metastasis suppressor gene, in trophoblast
giant cells of the rat placenta
JOURNAL Biochim Biophys Acta 1678 (2-3), 102-110 (2004)
PUBMED 15157736
REMARK GeneRIF: metastin/OT7T175 signaling may participate in implantation
of the mammalian embryo, placenta formation, and maintenance of
pregnancy
REFERENCE 7 (bases 1 to 691)
AUTHORS Sanchez-Carbayo,M., Capodieci,P. and Cordon-Cardo,C.
TITLE Tumor suppressor role of KiSS-1 in bladder cancer: loss of KiSS-1
expression is associated with bladder cancer progression and
clinical outcome
JOURNAL Am J Pathol 162 (2), 609-617 (2003)
PUBMED 12547718
REFERENCE 8 (bases 1 to 691)
AUTHORS Dun,S.L., Brailoiu,G.C., Parsons,A., Yang,J., Zeng,Q., Chen,X.,
Chang,J.K. and Dun,N.J.
TITLE Metastin-like immunoreactivity in the rat medulla oblongata and
spinal cord
JOURNAL Neurosci Lett 335 (3), 197-201 (2003)
PUBMED 12531466
REMARK GeneRIF: Metastin-like immunoreactivity is present in the spinal
cord and medulla oblongata, and the pattern of distribution in
these regions suggests that this novel peptide may participate in
autonomic and sensory neural signaling.
REFERENCE 9 (bases 1 to 691)
AUTHORS Stafford,L.J., Xia,C., Ma,W., Cai,Y. and Liu,M.
TITLE Identification and characterization of mouse metastasis-suppressor
KiSS1 and its G-protein-coupled receptor
JOURNAL Cancer Res 62 (19), 5399-5404 (2002)
PUBMED 12359743
REFERENCE 10 (bases 1 to 691)
AUTHORS Kotani,M., Detheux,M., Vandenbogaerde,A., Communi,D.,
Vanderwinden,J.M., Le Poul,E., Brezillon,S., Tyldesley,R.,
Suarez-Huerta,N., Vandeput,F., Blanpain,C., Schiffmann,S.N.,
Vassart,G. and Parmentier,M.
TITLE The metastasis suppressor gene KiSS-1 encodes kisspeptins, the
natural ligands of the orphan G protein-coupled receptor GPR54
JOURNAL J Biol Chem 276 (37), 34631-34636 (2001)
PUBMED 11457843
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JAXUCZ010000013.1.
On Oct 13, 2022 this sequence version replaced NM_181692.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: JX139031.1, SRR26360194.1803802.1
[ECO:0000332]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-94 JAXUCZ010000013.1 47327159-47327252
95-306 JAXUCZ010000013.1 47330053-47330264
307-691 JAXUCZ010000013.1 47332375-47332759
FEATURES Location/Qualifiers
source 1..691
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="BN"
/db_xref="taxon:10116"
/chromosome="13"
/map="13q13"
gene 1..691
/gene="Kiss1"
/gene_synonym="Eseptin"
/note="KiSS-1 metastasis-suppressor"
/db_xref="GeneID:289023"
/db_xref="RGD:727850"
exon 1..94
/gene="Kiss1"
/gene_synonym="Eseptin"
/inference="alignment:Splign:2.1.0"
exon 95..306
/gene="Kiss1"
/gene_synonym="Eseptin"
/inference="alignment:Splign:2.1.0"
misc_feature 114..116
/gene="Kiss1"
/gene_synonym="Eseptin"
/note="upstream in-frame stop codon"
CDS 204..596
/gene="Kiss1"
/gene_synonym="Eseptin"
/note="metastasis-suppressor KiSS-1; kisspeptin-1; MLL
septin-like fusion; metastin; Kiss1 variant E1a-E2b-E3;
Kiss1 variant E1b-E2a-E3; Kiss1 variant E1b-E2b-E3"
/codon_start=1
/product="metastasis-suppressor KiSS-1 precursor"
/protein_id="NP_859043.1"
/db_xref="GeneID:289023"
/db_xref="RGD:727850"
/translation="MISLASWQLLLLLCVASFGEPLAKMAPVVNPEPTGQQSGPQELV
NAWQKGPRYAESKPGAAGLRARRTSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQ
REKDMSAYNWNSFGLRYGRRQVARAARG"
sig_peptide 204..260
/gene="Kiss1"
/gene_synonym="Eseptin"
/inference="COORDINATES: ab initio prediction:SignalP:6.0"
mat_peptide 261..593
/gene="Kiss1"
/gene_synonym="Eseptin"
/product="Metastasis-suppressor KiSS-1.
/id=PRO_0000021555"
/note="propagated from UniProtKB/Swiss-Prot (Q7TSB7.1)"
misc_feature 357..476
/gene="Kiss1"
/gene_synonym="Eseptin"
/note="propagated from UniProtKB/Swiss-Prot (Q7TSB7.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 531..560
/gene="Kiss1"
/gene_synonym="Eseptin"
/note="propagated from UniProtKB/Swiss-Prot (Q7TSB7.1);
Region: Essential for receptor binding and receptor
activation"
misc_feature 531..533
/gene="Kiss1"
/gene_synonym="Eseptin"
/note="Phosphotyrosine.
/evidence=ECO:0000250|UniProtKB:Q15726; propagated from
UniProtKB/Swiss-Prot (Q7TSB7.1); phosphorylation site"
misc_feature 558..560
/gene="Kiss1"
/gene_synonym="Eseptin"
/note="Tyrosine amide. /evidence=ECO:0000250; propagated
from UniProtKB/Swiss-Prot (Q7TSB7.1); amidation site"
exon 307..691
/gene="Kiss1"
/gene_synonym="Eseptin"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 agaggaagcc caggagccag aggctcccct cagtgtgctc caactaccca agtggctctt
61 ctccctccgg ccctcaagcc aggacccagc caaggcgctc tctttgacct aggtaggctc
121 tggtgaatac taactctggc ctggtcttca ttgcctctct tcgtctcagc ctctggacac
181 cctgtggatc tgcctcttcc agaatgatct cgctggcttc ttggcagctg ctgcttctcc
241 tctgtgtggc ctcttttggg gagccactgg caaaaatggc acctgtggtg aaccctgaac
301 ccacaggcca acagtccgga ccccaggaac tcgttaatgc ctggcaaaag ggcccgcggt
361 atgcagagag caagcctggg gctgcaggac tgcgcgctcg ccgaacatcg ccatgcccgc
421 cggtggagaa ccccacgggg caccagcggc ccccgtgtgc cacccgcagt cgcctgatcc
481 ctgcgccccg cggatcggtg ctggtgcagc gcgagaagga catgtcagcc tacaactgga
541 actcctttgg cctgcgctac ggcaggaggc aggtggcgcg ggcggcacgg ggctgagtgc
601 agggttgcag gtggattgca gcccacccca tggcagaggc caaggcaggg agcttctaga
661 cttgtgcaat aaaagcaatg ctgtcgcctt a
//