Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_054358174.1
FASTA Graphics
LOCUS XM_054358174 988 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens tripartite motif containing 74 (TRIM74), transcript variant X11, mRNA. ACCESSION XM_054358174 VERSION XM_054358174.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060931) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..988 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="7" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..988 /gene="TRIM74" /gene_synonym="TRIM50C" /note="tripartite motif containing 74; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:378108" /db_xref="HGNC:HGNC:17453" /db_xref="MIM:612550" CDS 140..988 /gene="TRIM74" /gene_synonym="TRIM50C" /codon_start=1 /product="tripartite motif-containing protein 74 isoform X6" /protein_id="XP_054214149.1" /db_xref="GeneID:378108" /db_xref="HGNC:HGNC:17453" /db_xref="MIM:612550" /translation="MAWQVSLLELEDRLQCPICLEVFKESLMLQCGHSYCKGCLVSLS YHLDTKVRCPMCWQVVDGSSSLPNVSLAWVIEALRLPGDPEPKVCVHHRNPLSLFCEK DQELICGLCGLLGSHQHHPVTPVSTICSRMKEELAALFSELKQEQKKVDELIAKLVNN RTRIVNESDVFSWVIRREFQELRHPVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGT RERLAQAECVLEQFGNEDHHEFIWKFHSMASRLTKTEELEKKWRNGLAASHSLPQQVR PQRRTP" ORIGIN 1 ggcgtccagc tgcacttccc acttctgact ctgtgcctgc tgttccctgc tgggaagaag 61 aaaagccagt gatgctggct tgaggccata gtgggaggcc cagtggatcc tgagaagcta 121 gcccgggcag tgagtgtgga tggcttggca ggtgagcctg ctggagctgg aggaccggct 181 tcagtgtccc atctgcctgg aggtcttcaa ggagtcccta atgctacagt gcggccactc 241 ctactgcaag ggctgcctgg tttccctgtc ctaccacctg gacaccaagg tgcgctgccc 301 catgtgctgg caggtggtgg acggcagcag ctccttgccc aacgtctccc tggcctgggt 361 gatcgaagcc ctgaggctcc ctggggaccc ggagcccaag gtctgcgtgc accaccggaa 421 cccgctcagc cttttctgcg agaaggacca ggagctcatc tgtggcctct gcggtctgct 481 gggctcccac caacaccacc cggtcacgcc cgtctccacc atctgcagcc gcatgaagga 541 ggagctcgca gccctcttct ctgagctgaa gcaggagcag aagaaggtgg atgagctcat 601 cgccaaactg gtgaacaacc ggacccgaat cgtcaatgag tcggatgtct tcagctgggt 661 gatccgccgc gagttccagg agctgcgcca cccggtggac gaggagaagg cccgctgcct 721 ggaggggata gggggtcaca cccgtggcct ggtggcctcc ctggacatgc agctggagca 781 ggcccaggga acccgggagc ggctggccca agccgagtgt gtgctggaac agttcggaaa 841 tgaggaccac catgagttca tctggaagtt ccactccatg gcctccagat tgacaaagac 901 tgaagaactg gagaagaagt ggcgaaacgg gctcgcagcg tcgcattccc taccccagca 961 ggtgcgcccg cagcgtcgca ctccctag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on