LOCUS NM_031979 1845 bp mRNA linear ROD 03-APR-2024
DEFINITION Rattus norvegicus Y box binding protein 3 (Ybx3), mRNA.
ACCESSION NM_031979 XM_001069862
VERSION NM_031979.3
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1845)
AUTHORS Hou,A., Fu,J., Shi,Y., Qiao,L., Li,J., Xing,Y. and Xue,X.
TITLE Decreased ZONAB expression promotes excessive transdifferentiation
of alveolar epithelial cells in hyperoxia-induced bronchopulmonary
dysplasia
JOURNAL Int J Mol Med 41 (4), 2339-2349 (2018)
PUBMED 29393348
REMARK GeneRIF: These results suggest that Csda expression in alveolar
epithelial cells type II decreases under hyperoxia conditions,
which promotes transdifferentiation and inhibits proliferation of
alveolar epithelial cells.
REFERENCE 2 (bases 1 to 1845)
AUTHORS Nie,M., Balda,M.S. and Matter,K.
TITLE Stress- and Rho-activated ZO-1-associated nucleic acid binding
protein binding to p21 mRNA mediates stabilization, translation,
and cell survival
JOURNAL Proc Natl Acad Sci U S A 109 (27), 10897-10902 (2012)
PUBMED 22711822
REFERENCE 3 (bases 1 to 1845)
AUTHORS Baltz,A.G., Munschauer,M., Schwanhausser,B., Vasile,A.,
Murakawa,Y., Schueler,M., Youngs,N., Penfold-Brown,D., Drew,K.,
Milek,M., Wyler,E., Bonneau,R., Selbach,M., Dieterich,C. and
Landthaler,M.
TITLE The mRNA-bound proteome and its global occupancy profile on
protein-coding transcripts
JOURNAL Mol Cell 46 (5), 674-690 (2012)
PUBMED 22681889
REFERENCE 4 (bases 1 to 1845)
AUTHORS Castello,A., Fischer,B., Eichelbaum,K., Horos,R., Beckmann,B.M.,
Strein,C., Davey,N.E., Humphreys,D.T., Preiss,T., Steinmetz,L.M.,
Krijgsveld,J. and Hentze,M.W.
TITLE Insights into RNA biology from an atlas of mammalian mRNA-binding
proteins
JOURNAL Cell 149 (6), 1393-1406 (2012)
PUBMED 22658674
REFERENCE 5 (bases 1 to 1845)
AUTHORS Berghella,L., De Angelis,L., De Buysscher,T., Mortazavi,A.,
Biressi,S., Forcales,S.V., Sirabella,D., Cossu,G. and Wold,B.J.
TITLE A highly conserved molecular switch binds MSY-3 to regulate
myogenin repression in postnatal muscle
JOURNAL Genes Dev 22 (15), 2125-2138 (2008)
PUBMED 18676817
REFERENCE 6 (bases 1 to 1845)
AUTHORS Dieterich,D.C., Bockers,T.M., Gundelfinger,E.D. and Kreutz,M.R.
TITLE Screening for differentially expressed genes in the rat inner
retina and optic nerve after optic nerve crush
JOURNAL Neurosci Lett 317 (1), 29-32 (2002)
PUBMED 11750989
REFERENCE 7 (bases 1 to 1845)
AUTHORS Iuchi,Y., Kobayashi,T., Kaneko,T., Takahara,M., Ogino,T. and
Fujii,J.
TITLE Expression of a Y-box protein, YB2/RYB-a, precedes protamine 2
expression during spermatogenesis in rodents
JOURNAL Mol Hum Reprod 7 (11), 1023-1031 (2001)
PUBMED 11675468
REFERENCE 8 (bases 1 to 1845)
AUTHORS Davies,H.G., Giorgini,F., Fajardo,M.A. and Braun,R.E.
TITLE A sequence-specific RNA binding complex expressed in murine germ
cells contains MSY2 and MSY4
JOURNAL Dev Biol 221 (1), 87-100 (2000)
PUBMED 10772793
REFERENCE 9 (bases 1 to 1845)
AUTHORS Sapru,M.K., Gao,J.P., Walke,W., Burmeister,M. and Goldman,D.
TITLE Cloning and characterization of a novel transcriptional repressor
of the nicotinic acetylcholine receptor delta-subunit gene
JOURNAL J Biol Chem 271 (12), 7203-7211 (1996)
PUBMED 8636158
REFERENCE 10 (bases 1 to 1845)
AUTHORS Ito,K., Tsutsumi,K., Kuzumaki,T., Gomez,P.F., Otsu,K. and
Ishikawa,K.
TITLE A novel growth-inducible gene that encodes a protein with a
conserved cold-shock domain
JOURNAL Nucleic Acids Res 22 (11), 2036-2041 (1994)
PUBMED 8029009
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from U22893.1.
On May 9, 2012 this sequence version replaced NM_031979.2.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U22893.1, BC105778.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA5760383, SAMEA5760389
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on conservation, longest protein
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-1845 U22893.1 4-1848
FEATURES Location/Qualifiers
source 1..1845
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="Sprague-Dawley"
/db_xref="taxon:10116"
/chromosome="4"
/map="4q42"
gene 1..1845
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Y box binding protein 3"
/db_xref="GeneID:83807"
/db_xref="RGD:621056"
exon 1..421
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
CDS 184..1269
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="DNA-binding protein A; RYB-A; Y-box-binding protein
A; cold shock domain-containing protein A; muscle Y-box
protein YB2; cold shock domain protein A"
/codon_start=1
/product="Y-box-binding protein 3"
/protein_id="NP_114185.3"
/db_xref="GeneID:83807"
/db_xref="RGD:621056"
/translation="MSEAGEATTGGTTLPQAAADAPAAAPPDPAPKSPAASGAPQAPA
PAALLAGSPGGDAAPGPAPASSAPAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRN
DTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGS
RYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFEPPAADGQFSGARNQLRRP
QYRPPYRQRRFPPYHVGQTFDRRSRVFPHPNRMQAGEIGEMKDGVPEGAQLQVHRNPT
YRPRFRRGPARPRPAPAIGEAEDKENQQAANGPNQPSARRGFRRPYNYRRRPRPLNAV
SQDGKETKAGEAPTENPAPATEQSSAE"
misc_feature 184..402
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="propagated from UniProtKB/Swiss-Prot (Q62764.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 187..189
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="N-acetylserine.
/evidence=ECO:0000250|UniProtKB:P16989; propagated from
UniProtKB/Swiss-Prot (Q62764.1); acetylation site"
misc_feature 187..189
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 280..282
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 337..339
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 559..561
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P16989; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 700..1266
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="propagated from UniProtKB/Swiss-Prot (Q62764.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 760..762
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 766..768
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 769..771
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 910..912
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Omega-N-methylarginine.
/evidence=ECO:0000250|UniProtKB:P16989; propagated from
UniProtKB/Swiss-Prot (Q62764.1); methylation site"
misc_feature 1120..1122
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P16989; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 1126..1128
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Omega-N-methylarginine.
/evidence=ECO:0000250|UniProtKB:P16989; propagated from
UniProtKB/Swiss-Prot (Q62764.1); methylation site"
misc_feature 1186..1188
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 1255..1257
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
misc_feature 1258..1260
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
exon 422..485
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 486..519
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 520..609
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 610..732
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 733..939
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 940..1031
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 1032..1203
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 1204..1302
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
exon 1303..1845
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/inference="alignment:Splign:2.1.0"
polyA_site 1845
/gene="Ybx3"
/gene_synonym="Csda; Dbpa; Yb2"
/note="14 A nucleotides"
ORIGIN
1 cttcggggcc gggagaccca gcgagaccgc gagcgcgcgc gtcccccgcc ctcgagccgc
61 cgcccgccgc cgcgccgcgc gatccgcacc ggcctccccg agagcgagcc ggccgccgcg
121 accgccaccg cgctaaccgc cgccaaccgc caccgaggtg cccggagaga gcggagaggc
181 ggcatgagcg aggcgggcga ggccaccacc ggcggcacca cgctcccgca ggccgcggcc
241 gacgcgcccg ccgcggcgcc cccggacccc gcgcctaaga gcccggcggc cagcggcgcg
301 ccccaggccc cggcgcccgc cgcgctgctc gcggggagcc ccggcggaga cgcagccccc
361 gggcccgccc cggcctcatc agcccccgcg ggaagcgagg acgcggagaa gaaagttctc
421 gccaccaaag tccttggcac tgtcaaatgg ttcaacgtca gaaatggata tggatttata
481 aaccgaaacg acaccaaaga agatgtgttt gtacaccaga ctgccatcaa gaagaataat
541 ccacgcaagt atctgcgcag tgtgggggat ggagaaactg tagagtttga tgtggttgaa
601 ggagaaaagg gtgctgaagc agcaaatgtg actggcccag atggagttcc tgtagaaggg
661 agtcgctatg ctgctgatcg gcgccggtac agacgcggct actatggcag gcgccgagga
721 cctccccgta attacgctgg ggaggaggag gaggaaggga gcggcagcag tgaaggattt
781 gagccccctg ccgcagatgg gcagttctct ggggccagga atcagctgcg ccgcccccag
841 tatcgccctc cgtaccggca gcggcgtttc ccgccttacc acgtgggaca gacctttgac
901 cgtcgctcac gggtctttcc ccatcccaac agaatgcagg ctggtgagat tggagagatg
961 aaggatggag tccccgaggg agcgcagctc caggttcatc ggaatcccac ttaccgccca
1021 aggttccgca ggggacctgc tcgcccacga cctgcccctg ctattggaga ggctgaagat
1081 aaagaaaatc agcaagcggc caatggtcca aaccagccgt ctgcccgccg tggattccga
1141 cgcccctaca actacaggcg ccgcccccgt cccctcaacg ctgtttcaca agatggcaaa
1201 gagaccaagg caggtgaagc accaactgag aaccccgctc cagccaccga acagagcagt
1261 gccgagtgac cctggctccc aggcaccttc accaccagca gggtgacctt aagaattaat
1321 gaccattcaa aaacaaggca aaaagcacac ccacgacctt accaacacca aagaaacatc
1381 taagcaataa aacggaagac taaccaagat ttggacatta gaatgtttac tgctattctc
1441 tacgaaacta acaactgcaa agggaaggag cccgcactgt ccatcaagct gcgtcccggg
1501 aacctgcaca ggcagagagc agcctcccca tttcagcaac ctagtgcttt atattttttt
1561 cctggttttt actgttttgg taatatgaat taaaagaaga aatattaata ccacatgggg
1621 attgccccaa ccaaagaaat ctgaaatata tagtaaatgc tctttttcct ttgttgttca
1681 ttttggatgc tggtgctaaa cttccaagtg tcatgattta agaagaaatt ttatgccctt
1741 atttattcct aggatgaggg gagaacattt ttgctttctt acatagctct ctctgaaatg
1801 tgcagtaaca agttcctcaa aaataaaatt tttaccttca aagga
//