U.S. flag

An official website of the United States government

Rattus norvegicus Y box binding protein 3 (Ybx3), mRNA

NCBI Reference Sequence: NM_031979.3

FASTA Graphics 

LOCUS       NM_031979               1845 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus Y box binding protein 3 (Ybx3), mRNA.
ACCESSION   NM_031979 XM_001069862
VERSION     NM_031979.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1845)
  AUTHORS   Hou,A., Fu,J., Shi,Y., Qiao,L., Li,J., Xing,Y. and Xue,X.
  TITLE     Decreased ZONAB expression promotes excessive transdifferentiation
            of alveolar epithelial cells in hyperoxia-induced bronchopulmonary
            dysplasia
  JOURNAL   Int J Mol Med 41 (4), 2339-2349 (2018)
   PUBMED   29393348
  REMARK    GeneRIF: These results suggest that Csda expression in alveolar
            epithelial cells type II decreases under hyperoxia conditions,
            which promotes transdifferentiation and inhibits proliferation of
            alveolar epithelial cells.
REFERENCE   2  (bases 1 to 1845)
  AUTHORS   Nie,M., Balda,M.S. and Matter,K.
  TITLE     Stress- and Rho-activated ZO-1-associated nucleic acid binding
            protein binding to p21 mRNA mediates stabilization, translation,
            and cell survival
  JOURNAL   Proc Natl Acad Sci U S A 109 (27), 10897-10902 (2012)
   PUBMED   22711822
REFERENCE   3  (bases 1 to 1845)
  AUTHORS   Baltz,A.G., Munschauer,M., Schwanhausser,B., Vasile,A.,
            Murakawa,Y., Schueler,M., Youngs,N., Penfold-Brown,D., Drew,K.,
            Milek,M., Wyler,E., Bonneau,R., Selbach,M., Dieterich,C. and
            Landthaler,M.
  TITLE     The mRNA-bound proteome and its global occupancy profile on
            protein-coding transcripts
  JOURNAL   Mol Cell 46 (5), 674-690 (2012)
   PUBMED   22681889
REFERENCE   4  (bases 1 to 1845)
  AUTHORS   Castello,A., Fischer,B., Eichelbaum,K., Horos,R., Beckmann,B.M.,
            Strein,C., Davey,N.E., Humphreys,D.T., Preiss,T., Steinmetz,L.M.,
            Krijgsveld,J. and Hentze,M.W.
  TITLE     Insights into RNA biology from an atlas of mammalian mRNA-binding
            proteins
  JOURNAL   Cell 149 (6), 1393-1406 (2012)
   PUBMED   22658674
REFERENCE   5  (bases 1 to 1845)
  AUTHORS   Berghella,L., De Angelis,L., De Buysscher,T., Mortazavi,A.,
            Biressi,S., Forcales,S.V., Sirabella,D., Cossu,G. and Wold,B.J.
  TITLE     A highly conserved molecular switch binds MSY-3 to regulate
            myogenin repression in postnatal muscle
  JOURNAL   Genes Dev 22 (15), 2125-2138 (2008)
   PUBMED   18676817
REFERENCE   6  (bases 1 to 1845)
  AUTHORS   Dieterich,D.C., Bockers,T.M., Gundelfinger,E.D. and Kreutz,M.R.
  TITLE     Screening for differentially expressed genes in the rat inner
            retina and optic nerve after optic nerve crush
  JOURNAL   Neurosci Lett 317 (1), 29-32 (2002)
   PUBMED   11750989
REFERENCE   7  (bases 1 to 1845)
  AUTHORS   Iuchi,Y., Kobayashi,T., Kaneko,T., Takahara,M., Ogino,T. and
            Fujii,J.
  TITLE     Expression of a Y-box protein, YB2/RYB-a, precedes protamine 2
            expression during spermatogenesis in rodents
  JOURNAL   Mol Hum Reprod 7 (11), 1023-1031 (2001)
   PUBMED   11675468
REFERENCE   8  (bases 1 to 1845)
  AUTHORS   Davies,H.G., Giorgini,F., Fajardo,M.A. and Braun,R.E.
  TITLE     A sequence-specific RNA binding complex expressed in murine germ
            cells contains MSY2 and MSY4
  JOURNAL   Dev Biol 221 (1), 87-100 (2000)
   PUBMED   10772793
REFERENCE   9  (bases 1 to 1845)
  AUTHORS   Sapru,M.K., Gao,J.P., Walke,W., Burmeister,M. and Goldman,D.
  TITLE     Cloning and characterization of a novel transcriptional repressor
            of the nicotinic acetylcholine receptor delta-subunit gene
  JOURNAL   J Biol Chem 271 (12), 7203-7211 (1996)
   PUBMED   8636158
REFERENCE   10 (bases 1 to 1845)
  AUTHORS   Ito,K., Tsutsumi,K., Kuzumaki,T., Gomez,P.F., Otsu,K. and
            Ishikawa,K.
  TITLE     A novel growth-inducible gene that encodes a protein with a
            conserved cold-shock domain
  JOURNAL   Nucleic Acids Res 22 (11), 2036-2041 (1994)
   PUBMED   8029009
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U22893.1.
            
            On May 9, 2012 this sequence version replaced NM_031979.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U22893.1, BC105778.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1845              U22893.1           4-1848
FEATURES             Location/Qualifiers
     source          1..1845
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q42"
     gene            1..1845
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Y box binding protein 3"
                     /db_xref="GeneID:83807"
                     /db_xref="RGD:621056"
     exon            1..421
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     CDS             184..1269
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="DNA-binding protein A; RYB-A; Y-box-binding protein
                     A; cold shock domain-containing protein A; muscle Y-box
                     protein YB2; cold shock domain protein A"
                     /codon_start=1
                     /product="Y-box-binding protein 3"
                     /protein_id="NP_114185.3"
                     /db_xref="GeneID:83807"
                     /db_xref="RGD:621056"
                     /translation="MSEAGEATTGGTTLPQAAADAPAAAPPDPAPKSPAASGAPQAPA
                     PAALLAGSPGGDAAPGPAPASSAPAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRN
                     DTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGS
                     RYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFEPPAADGQFSGARNQLRRP
                     QYRPPYRQRRFPPYHVGQTFDRRSRVFPHPNRMQAGEIGEMKDGVPEGAQLQVHRNPT
                     YRPRFRRGPARPRPAPAIGEAEDKENQQAANGPNQPSARRGFRRPYNYRRRPRPLNAV
                     SQDGKETKAGEAPTENPAPATEQSSAE"
     misc_feature    184..402
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q62764.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    187..189
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="N-acetylserine.
                     /evidence=ECO:0000250|UniProtKB:P16989; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); acetylation site"
     misc_feature    187..189
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    280..282
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    337..339
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    559..561
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P16989; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    700..1266
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q62764.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    760..762
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    766..768
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    769..771
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    910..912
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Omega-N-methylarginine.
                     /evidence=ECO:0000250|UniProtKB:P16989; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); methylation site"
     misc_feature    1120..1122
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:P16989; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    1126..1128
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Omega-N-methylarginine.
                     /evidence=ECO:0000250|UniProtKB:P16989; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); methylation site"
     misc_feature    1186..1188
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    1255..1257
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     misc_feature    1258..1260
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62764.1); phosphorylation site"
     exon            422..485
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            486..519
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            520..609
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            610..732
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            733..939
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            940..1031
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            1032..1203
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            1204..1302
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     exon            1303..1845
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /inference="alignment:Splign:2.1.0"
     polyA_site      1845
                     /gene="Ybx3"
                     /gene_synonym="Csda; Dbpa; Yb2"
                     /note="14 A nucleotides"
ORIGIN      
        1 cttcggggcc gggagaccca gcgagaccgc gagcgcgcgc gtcccccgcc ctcgagccgc
       61 cgcccgccgc cgcgccgcgc gatccgcacc ggcctccccg agagcgagcc ggccgccgcg
      121 accgccaccg cgctaaccgc cgccaaccgc caccgaggtg cccggagaga gcggagaggc
      181 ggcatgagcg aggcgggcga ggccaccacc ggcggcacca cgctcccgca ggccgcggcc
      241 gacgcgcccg ccgcggcgcc cccggacccc gcgcctaaga gcccggcggc cagcggcgcg
      301 ccccaggccc cggcgcccgc cgcgctgctc gcggggagcc ccggcggaga cgcagccccc
      361 gggcccgccc cggcctcatc agcccccgcg ggaagcgagg acgcggagaa gaaagttctc
      421 gccaccaaag tccttggcac tgtcaaatgg ttcaacgtca gaaatggata tggatttata
      481 aaccgaaacg acaccaaaga agatgtgttt gtacaccaga ctgccatcaa gaagaataat
      541 ccacgcaagt atctgcgcag tgtgggggat ggagaaactg tagagtttga tgtggttgaa
      601 ggagaaaagg gtgctgaagc agcaaatgtg actggcccag atggagttcc tgtagaaggg
      661 agtcgctatg ctgctgatcg gcgccggtac agacgcggct actatggcag gcgccgagga
      721 cctccccgta attacgctgg ggaggaggag gaggaaggga gcggcagcag tgaaggattt
      781 gagccccctg ccgcagatgg gcagttctct ggggccagga atcagctgcg ccgcccccag
      841 tatcgccctc cgtaccggca gcggcgtttc ccgccttacc acgtgggaca gacctttgac
      901 cgtcgctcac gggtctttcc ccatcccaac agaatgcagg ctggtgagat tggagagatg
      961 aaggatggag tccccgaggg agcgcagctc caggttcatc ggaatcccac ttaccgccca
     1021 aggttccgca ggggacctgc tcgcccacga cctgcccctg ctattggaga ggctgaagat
     1081 aaagaaaatc agcaagcggc caatggtcca aaccagccgt ctgcccgccg tggattccga
     1141 cgcccctaca actacaggcg ccgcccccgt cccctcaacg ctgtttcaca agatggcaaa
     1201 gagaccaagg caggtgaagc accaactgag aaccccgctc cagccaccga acagagcagt
     1261 gccgagtgac cctggctccc aggcaccttc accaccagca gggtgacctt aagaattaat
     1321 gaccattcaa aaacaaggca aaaagcacac ccacgacctt accaacacca aagaaacatc
     1381 taagcaataa aacggaagac taaccaagat ttggacatta gaatgtttac tgctattctc
     1441 tacgaaacta acaactgcaa agggaaggag cccgcactgt ccatcaagct gcgtcccggg
     1501 aacctgcaca ggcagagagc agcctcccca tttcagcaac ctagtgcttt atattttttt
     1561 cctggttttt actgttttgg taatatgaat taaaagaaga aatattaata ccacatgggg
     1621 attgccccaa ccaaagaaat ctgaaatata tagtaaatgc tctttttcct ttgttgttca
     1681 ttttggatgc tggtgctaaa cttccaagtg tcatgattta agaagaaatt ttatgccctt
     1741 atttattcct aggatgaggg gagaacattt ttgctttctt acatagctct ctctgaaatg
     1801 tgcagtaaca agttcctcaa aaataaaatt tttaccttca aagga
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.