U.S. flag

An official website of the United States government

Rattus norvegicus cholinergic receptor nicotinic alpha 3 subunit (Chrna3), mRNA

NCBI Reference Sequence: NM_052805.2

FASTA Graphics 

LOCUS       NM_052805               1500 bp    mRNA    linear   ROD 01-MAR-2022
DEFINITION  Rattus norvegicus cholinergic receptor nicotinic alpha 3 subunit
            (Chrna3), mRNA.
ACCESSION   NM_052805 XM_001072823
VERSION     NM_052805.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1500)
  AUTHORS   Elayouby KS, Ishikawa M, Dukes AJ, Smith ACW, Lu Q, Fowler CD and
            Kenny PJ.
  TITLE     alpha3* Nicotinic Acetylcholine Receptors in the
            Habenula-Interpeduncular Nucleus Circuit Regulate Nicotine Intake
  JOURNAL   J Neurosci 41 (8), 1779-1787 (2021)
   PUBMED   33380469
  REMARK    GeneRIF: alpha3* Nicotinic Acetylcholine Receptors in the
            Habenula-Interpeduncular Nucleus Circuit Regulate Nicotine Intake.
REFERENCE   2  (bases 1 to 1500)
  AUTHORS   Perez-Morales R, Gonzalez-Zamora A, Gonzalez-Delgado MF, Calleros
            Rincon EY, Olivas Calderon EH, Martinez-Ramirez OC and Rubio J.
  TITLE     CHRNA3 rs1051730 and CHRNA5 rs16969968 polymorphisms are associated
            with heavy smoking, lung cancer, and chronic obstructive pulmonary
            disease in a mexican population
  JOURNAL   Ann Hum Genet 82 (6), 415-424 (2018)
   PUBMED   29993116
REFERENCE   3  (bases 1 to 1500)
  AUTHORS   Sun Y, Li J, Zheng C and Zhou B.
  TITLE     Study on polymorphisms in CHRNA5/CHRNA3/CHRNB4 gene cluster and the
            associated with the risk of non-small cell lung cancer
  JOURNAL   Oncotarget 9 (2), 2435-2444 (2017)
   PUBMED   29416783
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1500)
  AUTHORS   Han S, Yang SH, Kim JY, Mo S, Yang E, Song KM, Ham BJ, Mechawar N,
            Turecki G, Lee HW and Kim H.
  TITLE     Down-regulation of cholinergic signaling in the habenula induces
            anhedonia-like behavior
  JOURNAL   Sci Rep 7 (1), 900 (2017)
   PUBMED   28420875
  REMARK    Erratum:[Sci Rep. 2017 Dec 1;7(1):17090. PMID: 29196669]
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1500)
  AUTHORS   Kupiainen H, Kuokkanen M, Kontto J, Virtamo J, Salomaa V, Lindqvist
            A, Kilpelainen M and Laitinen T.
  TITLE     CHRNA5/CHRNA3 Locus Associates with Increased Mortality among
            Smokers
  JOURNAL   COPD 13 (4), 464-470 (2016)
   PUBMED   26751916
REFERENCE   6  (bases 1 to 1500)
  AUTHORS   Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE,
            Johnson EC, Velicelebi G and Harpold MM.
  TITLE     Comparative structure of human neuronal alpha 2-alpha 7 and beta
            2-beta 4 nicotinic acetylcholine receptor subunits and functional
            expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and
            beta 4 subunits
  JOURNAL   J Mol Neurosci 7 (3), 217-228 (1996)
   PUBMED   8906617
REFERENCE   7  (bases 1 to 1500)
  AUTHORS   Yang X, McDonough J, Fyodorov D, Morris M, Wang F and Deneris ES.
  TITLE     Characterization of an acetylcholine receptor alpha 3 gene promoter
            and its activation by the POU domain factor SCIP/Tst-1
  JOURNAL   J Biol Chem 269 (14), 10252-10264 (1994)
   PUBMED   8144606
REFERENCE   8  (bases 1 to 1500)
  AUTHORS   Loring RH, Sah DW, Landis SC and Zigmond RE.
  TITLE     The ultrastructural distribution of putative nicotinic receptors on
            cultured neurons from the rat superior cervical ganglion
  JOURNAL   Neuroscience 24 (3), 1071-1080 (1988)
   PUBMED   3380297
REFERENCE   9  (bases 1 to 1500)
  AUTHORS   Boulter J, Connolly J, Deneris E, Goldman D, Heinemann S and
            Patrick J.
  TITLE     Functional expression of two neuronal nicotinic acetylcholine
            receptors from cDNA clones identifies a gene family
  JOURNAL   Proc Natl Acad Sci U S A 84 (21), 7763-7767 (1987)
   PUBMED   2444984
REFERENCE   10 (bases 1 to 1500)
  AUTHORS   Boulter,J., Evans,K., Goldman,D., Martin,G., Treco,D., Heinemann,S.
            and Patrick,J.
  TITLE     Isolation of a cDNA clone coding for a possible neural nicotinic
            acetylcholine receptor alpha-subunit
  JOURNAL   Nature 319 (6052), 368-374 (1986)
   PUBMED   3753746
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY574254.1.
            
            [WARNING] On Sep 22, 2022 this sequence was replaced by
            NM_052805.3.
            
            On Jun 10, 2007 this sequence version replaced NM_052805.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY574254.1, L31621.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1500
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="8"
                     /map="8q24"
     gene            1..1500
                     /gene="Chrna3"
                     /note="cholinergic receptor nicotinic alpha 3 subunit"
                     /db_xref="GeneID:25101"
                     /db_xref="RGD:2345"
     CDS             1..1500
                     /gene="Chrna3"
                     /note="neuronal acetylcholine receptor subunit alpha-3;
                     cholinergic receptor, nicotinic, alpha polypeptide 3;
                     Acetylcholine receptor alpha 3 (neuronal nicotine);
                     cetylcholine receptor alpha 3 (neuronal nicotine);
                     acetylcholine receptor alpha3; cholinergic receptor
                     nicotinic alpha polypeptide 4; cholinergic receptor,
                     nicotinic, alpha 3 (neuronal)"
                     /codon_start=1
                     /product="neuronal acetylcholine receptor subunit alpha-3
                     precursor"
                     /protein_id="NP_434692.2"
                     /db_xref="GeneID:25101"
                     /db_xref="RGD:2345"
                     /translation="MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEII
                     RPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEF
                     MRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYF
                     PFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCC
                     EEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLS
                     LTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPT
                     WVKAVFLNLLPRVMFMTRPTSGEGDTPKTRTFYGAELSNLNCFSRADSKSCKEGYPCQ
                     DGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMK
                     AQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQPLMARDDT"
     sig_peptide     1..75
                     /gene="Chrna3"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    145..147
                     /gene="Chrna3"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P04757.1); glycosylation site"
     misc_feature    496..498
                     /gene="Chrna3"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (P04757.1); glycosylation site"
     misc_feature    703..777
                     /gene="Chrna3"
                     /note="propagated from UniProtKB/Swiss-Prot (P04757.1);
                     transmembrane region"
     misc_feature    799..855
                     /gene="Chrna3"
                     /note="propagated from UniProtKB/Swiss-Prot (P04757.1);
                     transmembrane region"
     misc_feature    901..966
                     /gene="Chrna3"
                     /note="propagated from UniProtKB/Swiss-Prot (P04757.1);
                     transmembrane region"
     misc_feature    1219..1221
                     /gene="Chrna3"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:16641100; propagated from
                     UniProtKB/Swiss-Prot (P04757.1); phosphorylation site"
     misc_feature    1228..1230
                     /gene="Chrna3"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:16641100; propagated from
                     UniProtKB/Swiss-Prot (P04757.1); phosphorylation site"
     misc_feature    1414..1473
                     /gene="Chrna3"
                     /note="propagated from UniProtKB/Swiss-Prot (P04757.1);
                     transmembrane region"
     exon            1..64
                     /gene="Chrna3"
                     /inference="alignment:Splign:2.1.0"
     exon            65..204
                     /gene="Chrna3"
                     /inference="alignment:Splign:2.1.0"
     exon            205..249
                     /gene="Chrna3"
                     /inference="alignment:Splign:2.1.0"
     exon            250..359
                     /gene="Chrna3"
                     /inference="alignment:Splign:2.1.0"
     exon            360..1371
                     /gene="Chrna3"
                     /inference="alignment:Splign:2.1.0"
     exon            1372..1500
                     /gene="Chrna3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 atgggtgttg tgctgctccc gccgccgctg tccatgctga tgctggtgct gatgctgctg
       61 ccagcggcca gtgcctcaga agctgagcac cgcctgttcc agtacctgtt cgaagattac
      121 aacgagatca tccggccagt ggctaatgtg tcccatccag tcatcatcca gtttgaggtg
      181 tccatgtctc agctggtgaa ggtggatgaa gtaaaccaga tcatggaaac caacctgtgg
      241 ctgaagcaaa tctggaatga ctacaagctg aaatggaaac cctctgacta ccaaggggtg
      301 gagttcatgc gtgttcctgc agagaagatc tggaaaccag acatcgtact gtacaacaac
      361 gctgatgggg atttccaggt ggatgacaag accaaagctc tactcaagta cacaggagaa
      421 gtgacttgga tcccgccggc catctttaag agctcatgca aaatcgacgt gacctacttc
      481 ccattcgact accaaaactg caccatgaag ttcggctcct ggtcctacga caaggcaaag
      541 atcgacctgg tcctcatcgg ctcctccatg aacctcaagg actactggga gagtggcgag
      601 tgggctatca ttaaagcccc gggctacaaa catgaaatca agtacaactg ctgtgaggag
      661 atctaccaag acatcacgta ctcgctgtac atccgtcgcc tgccgctgtt ctacaccatc
      721 aacctcatca tcccctgcct gctcatctcc ttcctcactg tgcttgtctt ctacctgccc
      781 tccgactgtg gggagaaggt gacactctgc atctctgtgc tcctctccct gactgtcttt
      841 ctcctggtga tcaccgagac cattccttcc acctcgctgg tcatccccct gattggggag
      901 tacctcctct tcactatgat ttttgtcacc ttgtccattg tcatcacagt ctttgtgctc
      961 aatgtgcact atagaactcc aaccacacac accatgccca cttgggtcaa ggccgtgttc
     1021 ttgaacctgc tccccagggt catgtttatg actaggccga ccagtggtga gggggacact
     1081 cctaagacga ggaccttcta cggcgctgag ctctcaaacc tgaactgctt cagccgtgca
     1141 gactccaaaa gctgcaagga aggctacccc tgccaagatg ggacctgtgg ctactgccac
     1201 caccgtaggg taaaaatctc aaatttcagt gccaacctca caagaagctc cagttctgag
     1261 tctgtcgacg ctgtgttgtc cctctctgcc ctgtcaccag aaatcaaaga agccatccaa
     1321 agtgtgaagt acattgccga aaacatgaaa gcacagaatg tagccaaaga gattcaagat
     1381 gattggaagt acgttgccat ggtgattgat cgcatctttc tctgggtttt catcctggtg
     1441 tgcattttag gaacggcggg attatttctg caacccttga tggccagaga tgacacatag
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.