Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AF007554.1
FASTA Graphics
LOCUS AF007554 447 bp mRNA linear ROD 24-JUL-2016 DEFINITION Rattus norvegicus mucin 1 (Muc1) mRNA, partial cds. ACCESSION AF007554 VERSION AF007554.1 KEYWORDS . SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 447) AUTHORS DeSouza,M.M., Mani,S.K., Julian,J. and Carson,D.D. TITLE Reduction of mucin-1 expression during the receptive phase in the rat uterus JOURNAL Biol. Reprod. 58 (6), 1503-1507 (1998) PUBMED 9623612 REFERENCE 2 (bases 1 to 447) AUTHORS DeSouza,M.M., Mani,S., Julian,J. and Carson,D.D. TITLE Direct Submission JOURNAL Submitted (09-JUN-1997) Biochemistry and Molecular Biology, Univ. of Texas-M.D. Anderson Cancer Center, 1515 Holcombe Blvd., Box 117, Houston, TX 77030, USA FEATURES Location/Qualifiers source 1..447 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" gene 1..447 /gene="Muc1" CDS <1..225 /gene="Muc1" /note="cytoplasmic domain" /codon_start=1 /product="mucin 1" /protein_id="AAB62948.1" /translation="AVCQCRRKSYGQLDLFPTRDTYHPMSEYPTYHTHGRYVPPATTK RSPYEEVSTGNGSSGLSYTNPAVATTSANL" ORIGIN 1 gcagtgtgcc agtgccgccg aaagagctat gggcagctgg acctctttcc aacccgggac 61 acctaccatc ctatgagtga atatcctacc taccacactc acggacgcta tgtgccccct 121 gccactacca aacgtagccc ctatgaagag gtttcgacag gcaatggcag tagcggtctc 181 tcttacacca acccggctgt ggcaaccact tcggccaact tgtaggagca agtcacccta 241 cccactcggg cagtggcagt tggctccagc agtccactcc ctcagtggtc gctgccagac 301 ccctgcactc tgatctgggc tggtgagcca ggactcctga taggctgatc acagccttcc 361 tcagaggctt tgtcaccacg ttagcctggt gaagcccagc cctgccctga gggacactgg 421 ggtagtggtg gctctcagaa agactga //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on