U.S. flag

An official website of the United States government

Rattus norvegicus NCK adaptor protein 1 (Nck1), mRNA

NCBI Reference Sequence: NM_001106851.2

FASTA Graphics 

LOCUS       NM_001106851            1778 bp    mRNA    linear   ROD 26-FEB-2024
DEFINITION  Rattus norvegicus NCK adaptor protein 1 (Nck1), mRNA.
ACCESSION   NM_001106851 XM_001066601 XM_001066651 XM_217246
VERSION     NM_001106851.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1778)
  AUTHORS   Guo,Z., Neilson,L.J., Zhong,H., Murray,P.S., Zanivan,S. and
            Zaidel-Bar,R.
  TITLE     E-cadherin interactome complexity and robustness resolved by
            quantitative proteomics
  JOURNAL   Sci Signal 7 (354), rs7 (2014)
   PUBMED   25468996
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1778)
  AUTHORS   Liang,Y., Cucchetti,M., Roncagalli,R., Yokosuka,T., Malzac,A.,
            Bertosio,E., Imbert,J., Nijman,I.J., Suchanek,M., Saito,T.,
            Wulfing,C., Malissen,B. and Malissen,M.
  TITLE     The lymphoid lineage-specific actin-uncapping protein Rltpr is
            essential for costimulation via CD28 and the development of
            regulatory T cells
  JOURNAL   Nat Immunol 14 (8), 858-866 (2013)
   PUBMED   23793062
REFERENCE   3  (bases 1 to 1778)
  AUTHORS   Lee,H. and Bennett,A.M.
  TITLE     Receptor protein tyrosine phosphatase-receptor tyrosine kinase
            substrate screen identifies EphA2 as a target for LAR in cell
            migration
  JOURNAL   Mol Cell Biol 33 (7), 1430-1441 (2013)
   PUBMED   23358419
REFERENCE   4  (bases 1 to 1778)
  AUTHORS   Garber,J.J., Takeshima,F., Anton,I.M., Oyoshi,M.K., Lyubimova,A.,
            Kapoor,A., Shibata,T., Chen,F., Alt,F.W., Geha,R.S., Leong,J.M. and
            Snapper,S.B.
  TITLE     Enteropathogenic Escherichia coli and vaccinia virus do not require
            the family of WASP-interacting proteins for pathogen-induced actin
            assembly
  JOURNAL   Infect Immun 80 (12), 4071-4077 (2012)
   PUBMED   22966049
REFERENCE   5  (bases 1 to 1778)
  AUTHORS   Wu,C.L., Buszard,B., Teng,C.H., Chen,W.L., Warr,C.G., Tiganis,T.
            and Meng,T.C.
  TITLE     Dock/Nck facilitates PTP61F/PTP1B regulation of insulin signalling
  JOURNAL   Biochem J 439 (1), 151-159 (2011)
   PUBMED   21707536
REFERENCE   6  (bases 1 to 1778)
  AUTHORS   Benesch,S., Lommel,S., Steffen,A., Stradal,T.E., Scaplehorn,N.,
            Way,M., Wehland,J. and Rottner,K.
  TITLE     Phosphatidylinositol 4,5-biphosphate (PIP2)-induced vesicle
            movement depends on N-WASP and involves Nck, WIP, and Grb2
  JOURNAL   J Biol Chem 277 (40), 37771-37776 (2002)
   PUBMED   12147689
REFERENCE   7  (bases 1 to 1778)
  AUTHORS   Gil,D., Schamel,W.W., Montoya,M., Sanchez-Madrid,F. and Alarcon,B.
  TITLE     Recruitment of Nck by CD3 epsilon reveals a ligand-induced
            conformational change essential for T cell receptor signaling and
            synapse formation
  JOURNAL   Cell 109 (7), 901-912 (2002)
   PUBMED   12110186
REFERENCE   8  (bases 1 to 1778)
  AUTHORS   Kebache,S., Zuo,D., Chevet,E. and Larose,L.
  TITLE     Modulation of protein translation by Nck-1
  JOURNAL   Proc Natl Acad Sci U S A 99 (8), 5406-5411 (2002)
   PUBMED   11959995
  REMARK    GeneRIF: Modulation of protein translation by Nck-1.
REFERENCE   9  (bases 1 to 1778)
  AUTHORS   Braverman,L.E. and Quilliam,L.A.
  TITLE     Identification of Grb4/Nckbeta, a src homology 2 and 3
            domain-containing adapter protein having similar binding and
            biological properties to Nck
  JOURNAL   J Biol Chem 274 (9), 5542-5549 (1999)
   PUBMED   10026169
REFERENCE   10 (bases 1 to 1778)
  AUTHORS   Ren,R., Mayer,B.J., Cicchetti,P. and Baltimore,D.
  TITLE     Identification of a ten-amino acid proline-rich SH3 binding site
  JOURNAL   Science 259 (5098), 1157-1161 (1993)
   PUBMED   8438166
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC167009.1.
            
            On May 11, 2008 this sequence version replaced NM_001106851.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC167009.1, SRR8487231.18874.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760494
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1778
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="8"
                     /map="8q31"
     gene            1..1778
                     /gene="Nck1"
                     /note="NCK adaptor protein 1"
                     /db_xref="GeneID:300955"
                     /db_xref="RGD:1310688"
     exon            1..117
                     /gene="Nck1"
                     /inference="alignment:Splign:2.1.0"
     exon            118..358
                     /gene="Nck1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    127..129
                     /gene="Nck1"
                     /note="upstream in-frame stop codon"
     CDS             133..1266
                     /gene="Nck1"
                     /note="cytoplasmic protein NCK1; non-catalytic region of
                     tyrosine kinase adaptor protein 1"
                     /codon_start=1
                     /product="SH2/SH3 adapter protein NCK1"
                     /protein_id="NP_001100321.1"
                     /db_xref="GeneID:300955"
                     /db_xref="RGD:1310688"
                     /translation="MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNS
                     MNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGE
                     RLYDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYV
                     TEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMD
                     VIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGK
                     FAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQL
                     KETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS"
     exon            359..1071
                     /gene="Nck1"
                     /inference="alignment:Splign:2.1.0"
     exon            1072..1750
                     /gene="Nck1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
        1 ctgagagcta cgcggcggcg cagcacaggc ctcgtgcggt aacggcatcc ggccagccgc
       61 ggtggcgtcc cggtgcagtc ctcaggtgac tggagccgcg ggctcggcgg agggaagtga
      121 ggctgctgaa acatggctga agaagtggtg gtggtggcca aatttgatta tgtggcacag
      181 caggaacaag agctggatat caagaagaat gagagattat ggctcctgga tgactctaag
      241 tcctggtggc gagttcgaaa ttccatgaat aaaacaggtt ttgtcccttc taactatgtg
      301 gaaagaaaaa atagtgctcg gaaagcatct attgttaaaa acctgaagga caccttaggc
      361 attggaaaag tgaaaagaaa acccagtgtt ccagatacgg catctcctgc tgatgatagc
      421 tttgttgatc caggagaacg tctctatgac ctcaacatgc ctgcttttgt gaagtttaac
      481 tacatggctg agagagagga tgaattgtca ttgataaaag ggaccaaggt gatagtcatg
      541 gagaaatgca gtgacggatg gtggcgtggc agctacaatg gacaaattgg atggttccct
      601 tcaaactatg taactgaaga aggtgacagt cctttgggtg accatgtagg ttctctgtca
      661 gagaagttag cagcagttgt caataaccta aatacaggtc aagtattgca cgttgtacag
      721 gctctttacc cgttcagctc atccaatgat gaagaactca attttgagaa aggtgatgta
      781 atggatgtta ttgaaaagcc ggaaaatgac ccagaatggt ggaaatgcag gaaaatcaat
      841 ggcatggttg gcctggtgcc aaaaaactat gttaccgtca tgcagaataa tccgctaacc
      901 tcaggtttgg aaccatcgcc tccacagtgt gattacatta ggccttcact cacggggaag
      961 tttgctggca atccttggta ttatggcaaa gtcaccaggc accaggcaga gatggcattg
     1021 aatgaaagag ggcatgaagg agacttcctc attcgcgaca gtgagtcttc gccaaatgat
     1081 ttctcagtat cactaaaagc acaagggaaa aacaagcatt ttaaagtcca gctgaaagag
     1141 actgtctact gcattgggca gcggaaattc agcaccatgg aggaacttgt agaacattac
     1201 aaaaaggcac cgatctttac aagtgaacaa ggagagaaat tgtatctcgt caagcatttg
     1261 tcttgatact gctcgtcagc aatgactgct acacacttta actcgtcacg cagcggaaga
     1321 ctgagaaagt gttgggccag ttgtgcttgc tgggaaagtg ctgtttctaa ctgtatgaga
     1381 actgactgta caatacatga gtattttgtt atgactcagc ccatacatac atattgcata
     1441 ggcagtgcat ctcgtgtaga agaggtcttt attcttggtc ttctgtctta ctgttttctt
     1501 tgctgttttt ctctttcctt ccaacaatta aggttttgta ttctgaaaac aaataatttg
     1561 gttcaaaatc tttatatgga agaatccttt tattgctgtt tctttatttc ctcgtaaagc
     1621 tatcctgttt ccccacagtc cctcttcata taaaattata tctatatggc atatgataaa
     1681 ggacatttct tgtaaagtgt taatcttttc tgtgactaaa tagcaataat aaacagaaaa
     1741 taagacatta aaaaaaaaaa aaaaaaaaaa aaaaaaaa
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

  • RefSeq protein product
    See the reference protein sequence for SH2/SH3 adapter protein NCK1 (NP_001100321.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.