NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS24837.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24837.1 Public Mus musculus 11 Pmp22 23 108 98 CCDS HistoryNCBI Gene:18858Re-query CCDS DB by CCDS ID:24837.1Re-query CCDS DB by GeneID:18858See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24837.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000018361.9 ENSMUSP00000018361.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018361.9Link to Ensembl Protein Viewer:ENSMUSP00000018361.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000018361Re-query CCDS DB by Protein ID:ENSMUSP00000018361
Original member Current member EBI ENSMUST00000108700.1 ENSMUSP00000104340.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108700.1Link to Ensembl Protein Viewer:ENSMUSP00000104340.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108700Re-query CCDS DB by Protein ID:ENSMUSP00000104340
Original member Current member EBI ENSMUST00000108701.7 ENSMUSP00000104341.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108701.7Link to Ensembl Protein Viewer:ENSMUSP00000104341.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108701Re-query CCDS DB by Protein ID:ENSMUSP00000104341
Original member Current member EBI ENSMUST00000108702.7 ENSMUSP00000104342.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108702.7Link to Ensembl Protein Viewer:ENSMUSP00000104342.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108702Re-query CCDS DB by Protein ID:ENSMUSP00000104342
Original member NCBI NM_001302255.1 NP_001289184.1 Updated not alive Link to Nucleotide Sequence:NM_001302255.1Link to Protein Sequence:NP_001289184.1Re-query CCDS DB by Nucleotide ID:NM_001302255Re-query CCDS DB by Protein ID:NP_001289184
Current member NCBI NM_001302255.2 NP_001289184.1 Accepted alive Link to Nucleotide Sequence:NM_001302255.2Link to Protein Sequence:NP_001289184.1Re-query CCDS DB by Nucleotide ID:NM_001302255Re-query CCDS DB by Protein ID:NP_001289184Link to BLAST:NP_001289184.1
Original member NCBI NM_001302257.1 NP_001289186.1 Updated not alive Link to Nucleotide Sequence:NM_001302257.1Link to Protein Sequence:NP_001289186.1Re-query CCDS DB by Nucleotide ID:NM_001302257Re-query CCDS DB by Protein ID:NP_001289186
Current member NCBI NM_001302257.2 NP_001289186.1 Accepted alive Link to Nucleotide Sequence:NM_001302257.2Link to Protein Sequence:NP_001289186.1Re-query CCDS DB by Nucleotide ID:NM_001302257Re-query CCDS DB by Protein ID:NP_001289186Link to BLAST:NP_001289186.1
Original member NCBI NM_001302258.1 NP_001289187.1 Updated not alive Link to Nucleotide Sequence:NM_001302258.1Link to Protein Sequence:NP_001289187.1Re-query CCDS DB by Nucleotide ID:NM_001302258Re-query CCDS DB by Protein ID:NP_001289187
Current member NCBI NM_001302258.2 NP_001289187.1 Accepted alive Link to Nucleotide Sequence:NM_001302258.2Link to Protein Sequence:NP_001289187.1Re-query CCDS DB by Nucleotide ID:NM_001302258Re-query CCDS DB by Protein ID:NP_001289187Link to BLAST:NP_001289187.1
Original member NCBI NM_001302259.1 NP_001289188.1 Updated not alive Link to Nucleotide Sequence:NM_001302259.1Link to Protein Sequence:NP_001289188.1Re-query CCDS DB by Nucleotide ID:NM_001302259Re-query CCDS DB by Protein ID:NP_001289188
Current member NCBI NM_001302259.2 NP_001289188.1 Accepted alive Link to Nucleotide Sequence:NM_001302259.2Link to Protein Sequence:NP_001289188.1Re-query CCDS DB by Nucleotide ID:NM_001302259Re-query CCDS DB by Protein ID:NP_001289188Link to BLAST:NP_001289188.1
Original member NCBI NM_001302260.1 NP_001289189.1 Updated not alive Link to Nucleotide Sequence:NM_001302260.1Link to Protein Sequence:NP_001289189.1Re-query CCDS DB by Nucleotide ID:NM_001302260Re-query CCDS DB by Protein ID:NP_001289189
Current member NCBI NM_001302260.2 NP_001289189.1 Accepted alive Link to Nucleotide Sequence:NM_001302260.2Link to Protein Sequence:NP_001289189.1Re-query CCDS DB by Nucleotide ID:NM_001302260Re-query CCDS DB by Protein ID:NP_001289189Link to BLAST:NP_001289189.1
Original member NCBI NM_008885.3 NP_032911.1 Updated not alive Link to Nucleotide Sequence:NM_008885.3Link to Protein Sequence:NP_032911.1Re-query CCDS DB by Nucleotide ID:NM_008885Re-query CCDS DB by Protein ID:NP_032911
Current member NCBI NM_008885.4 NP_032911.1 Accepted alive Link to Nucleotide Sequence:NM_008885.4Link to Protein Sequence:NP_032911.1Re-query CCDS DB by Nucleotide ID:NM_008885Re-query CCDS DB by Protein ID:NP_032911Link to BLAST:NP_032911.1

Chromosomal Locations for CCDS 24837.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 63133167 63133244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63134421 63134520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63151119 63151259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 63158252 63158415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (483 nt):
ATGCTCCTACTCTTGTTGGGGATCCTGTTCCTGCACATCGCGGTGCTAGTGTTGCTCTTCGTCTCCACCA
TC
GTCAGCCAATGGCTCGTGGGCAATGGACACACGACTGATCTCTGGCAGAACTGTACCACATCCGCCTT
G
GGAGCCGTCCAACACTGCTACTCCTCATCAGTGAGCGAATGGCTGCAGTCTGTCCAGGCCACCATGATC
CTG
TCTGTCATCTTCAGCGTCCTGGCTCTGTTCCTGTTCTTCTGCCAGCTCTTCACTCTCACCAAAGGCG
GC
CGGTTTTACATCACTGGATTCTTCCAAATCCTTGCTGGTCTGTGCGTGATGAGTGCAGCGGCCATCTA
C
ACAGTGAGGCACAGTGAGTGGCATGTCAACACTGACTACTCCTATGGCTTCGCCTACATCCTGGCCTGG
GTG
GCCTTTCCCCTAGCCCTCCTCAGTGGTATCATCTATGTGATCCTGCGGAAACGCGAATGA


Translation (160 aa):
MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHTTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMI
L
SVIFSVLALFLFFCQLFTLTKGGRFYITGFFQILA
GLCVMSAAAIYTVRHSEWHVNTDYSYGFAYILAW
V
AFPLALLSGIIYVILRKRE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser