NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS42792.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42792.1 Public Homo sapiens 2 C2orf88 24 110 108 CCDS HistoryNCBI Gene:84281Re-query CCDS DB by CCDS ID:42792.1Re-query CCDS DB by GeneID:84281See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42792.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000340623.4 ENSP00000345107.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000340623.4Link to Ensembl Protein Viewer:ENSP00000345107.4Re-query CCDS DB by Nucleotide ID:ENST00000340623Re-query CCDS DB by Protein ID:ENSP00000345107
Original member Current member EBI ENST00000396974.2 ENSP00000380172.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396974.2Link to Ensembl Protein Viewer:ENSP00000380172.2Re-query CCDS DB by Nucleotide ID:ENST00000396974Re-query CCDS DB by Protein ID:ENSP00000380172
Original member Current member EBI ENST00000409870.1 ENSP00000386649.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409870.1Link to Ensembl Protein Viewer:ENSP00000386649.1Re-query CCDS DB by Nucleotide ID:ENST00000409870Re-query CCDS DB by Protein ID:ENSP00000386649
Original member Current member EBI ENST00000443551.2 ENSP00000405225.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000443551.2Link to Ensembl Protein Viewer:ENSP00000405225.2Re-query CCDS DB by Nucleotide ID:ENST00000443551Re-query CCDS DB by Protein ID:ENSP00000405225
Original member Current member NCBI NM_001042519.2 NP_001035984.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001042519.2Link to Protein Sequence:NP_001035984.1Re-query CCDS DB by Nucleotide ID:NM_001042519Re-query CCDS DB by Protein ID:NP_001035984Link to BLAST:NP_001035984.1
Original member Current member NCBI NM_001042520.2 NP_001035985.1 Accepted alive Link to Nucleotide Sequence:NM_001042520.2Link to Protein Sequence:NP_001035985.1Re-query CCDS DB by Nucleotide ID:NM_001042520Re-query CCDS DB by Protein ID:NP_001035985Link to BLAST:NP_001035985.1
Original member Current member NCBI NM_001042521.2 NP_001035986.1 Accepted alive Link to Nucleotide Sequence:NM_001042521.2Link to Protein Sequence:NP_001035986.1Re-query CCDS DB by Nucleotide ID:NM_001042521Re-query CCDS DB by Protein ID:NP_001035986Link to BLAST:NP_001035986.1
Original member Current member NCBI NM_032321.3 NP_115697.2 Accepted alive Link to Nucleotide Sequence:NM_032321.3Link to Protein Sequence:NP_115697.2Re-query CCDS DB by Nucleotide ID:NM_032321Re-query CCDS DB by Protein ID:NP_115697Link to BLAST:NP_115697.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001035984.1 95 Q9BSF0 95 100% 0 0
NP_001035985.1 95 Q9BSF0 95 100% 0 0
NP_001035986.1 95 Q9BSF0 95 100% 0 0
NP_115697.2 95 Q9BSF0 95 100% 0 0

Chromosomal Locations for CCDS 42792.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 190199861 190200148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (288 nt):
ATGGGCTGCATGAAATCAAAGCAAACTTTCCCATTTCCTACCATATATGAAGGTGAGAAGCAGCATGAGA
GTGAAGAACCCTTTATGCCAGAAGAGAGATGTCTACCTAGGATGGCTTCTCCAGTTAATGTCAAAGAGGA
AGTGAAGGAACCTCCAGGGACCAATACTGTGATCTTGGAATATGCACACCGCCTGTCTCAGGATATCTTG
TGTGATGCCTTGCAGCAATGGGCATGCAATAACATCAAGTACCATGACATTCCATACATTGAGAGTGAGG
GGCCTTGA

Translation (95 aa):
MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDIL
CDALQQWACNNIKYHDIPYIESEGP


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH