NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS39801.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39801.1 Public Mus musculus 7 Apoc2 23 108 98 CCDS HistoryNCBI Gene:11813Re-query CCDS DB by CCDS ID:39801.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39801.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000003074.15 ENSMUSP00000003074.9 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003074.15Link to Ensembl Protein Viewer:ENSMUSP00000003074.9Re-query CCDS DB by Nucleotide ID:ENSMUST00000003074Re-query CCDS DB by Protein ID:ENSMUSP00000003074
Original member Current member EBI ENSMUST00000150569.8 ENSMUSP00000114512.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000150569.8Link to Ensembl Protein Viewer:ENSMUSP00000114512.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000150569Re-query CCDS DB by Protein ID:ENSMUSP00000114512
Original member Current member EBI ENSMUST00000142352.8 ENSMUSP00000115173.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000142352.8Link to Ensembl Protein Viewer:ENSMUSP00000115173.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000142352Re-query CCDS DB by Protein ID:ENSMUSP00000115173
Original member Current member EBI ENSMUST00000134116.7 ENSMUSP00000118291.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000134116.7Link to Ensembl Protein Viewer:ENSMUSP00000118291.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000134116Re-query CCDS DB by Protein ID:ENSMUSP00000118291
Original member Current member EBI ENSMUST00000127648.3 ENSMUSP00000118305.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000127648.3Link to Ensembl Protein Viewer:ENSMUSP00000118305.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000127648Re-query CCDS DB by Protein ID:ENSMUSP00000118305
Original member Current member NCBI NM_001277944.1 NP_001264873.1 Accepted alive Link to Nucleotide Sequence:NM_001277944.1Link to Protein Sequence:NP_001264873.1Re-query CCDS DB by Nucleotide ID:NM_001277944Re-query CCDS DB by Protein ID:NP_001264873Link to BLAST:NP_001264873.1
Original member Current member NCBI NM_001309795.1 NP_001296724.1 Accepted alive Link to Nucleotide Sequence:NM_001309795.1Link to Protein Sequence:NP_001296724.1Re-query CCDS DB by Nucleotide ID:NM_001309795Re-query CCDS DB by Protein ID:NP_001296724Link to BLAST:NP_001296724.1
Original member NCBI NM_001309799.1 NP_001296728.1 Removed alive Link to Nucleotide Sequence:NM_001309799.1Link to Protein Sequence:NP_001296728.1Re-query CCDS DB by Nucleotide ID:NM_001309799Re-query CCDS DB by Protein ID:NP_001296728Link to BLAST:NP_001296728.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001264873.1 97 Q05020 97 100% 0 0
NP_001296724.1 97 Q05020 97 100% 0 0
NP_001296728.1 97 Q05020 97 100% 0 0

Chromosomal Locations for CCDS 39801.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 19671761 19671848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19673229 19673379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 19673547 19673601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (294 nt):
ATGGGGTCTCGGTTCTTCCTGGCTCTATTCCTGGTCATCCTGATGTTGGGAAATGAGGTCCAGGGGAACC
AGGAAGATGACTCGGGCAGCCTGGCTCTGCTGGGCACGGTGCAGGGCTCCCTCTTAAGTTACTGGACCTC
TGCCAAGGAGGTTGCCAAAGACCTGTACCAGAAGACATACCCGATCAGCATGGATGAGAAACTCAGGGAC
ATGTACAGCAAAAGCTCGGCGGCCATGAGCACTTACGCAGGCATTTTTACAGACCAGCTCCTTACTCTCC
TGAGGGGAGAGTAG

Translation (97 aa):
MGSRFFLALFLVILMLGNEVQGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRD
MYSKSSAAMSTYAGIFTDQLLTLLRGE


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH