NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS17537.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17537.1 Public Mus musculus 3 S100a3 23 108 98 CCDS HistoryNCBI Gene:20197Re-query CCDS DB by CCDS ID:17537.1Re-query CCDS DB by GeneID:20197See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17537.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000001047.7 ENSMUSP00000001047.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000001047.7Link to Ensembl Protein Viewer:ENSMUSP00000001047.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000001047Re-query CCDS DB by Protein ID:ENSMUSP00000001047
Original member Current member EBI ENSMUST00000200290.4 ENSMUSP00000142334.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000200290.4Link to Ensembl Protein Viewer:ENSMUSP00000142334.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000200290Re-query CCDS DB by Protein ID:ENSMUSP00000142334
Original member Current member EBI ENSMUST00000200508.4 ENSMUSP00000142747.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000200508.4Link to Ensembl Protein Viewer:ENSMUSP00000142747.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000200508Re-query CCDS DB by Protein ID:ENSMUSP00000142747
Original member NCBI NM_001355597.1 NP_001342526.1 Updated not alive Link to Nucleotide Sequence:NM_001355597.1Link to Protein Sequence:NP_001342526.1Re-query CCDS DB by Nucleotide ID:NM_001355597Re-query CCDS DB by Protein ID:NP_001342526
Current member NCBI NM_001355597.2 NP_001342526.1 Accepted alive Link to Nucleotide Sequence:NM_001355597.2Link to Protein Sequence:NP_001342526.1Re-query CCDS DB by Nucleotide ID:NM_001355597Re-query CCDS DB by Protein ID:NP_001342526Link to BLAST:NP_001342526.1
Original member NCBI NM_001355600.1 NP_001342529.1 Updated not alive Link to Nucleotide Sequence:NM_001355600.1Link to Protein Sequence:NP_001342529.1Re-query CCDS DB by Nucleotide ID:NM_001355600Re-query CCDS DB by Protein ID:NP_001342529
Current member NCBI NM_001355600.2 NP_001342529.1 Accepted alive Link to Nucleotide Sequence:NM_001355600.2Link to Protein Sequence:NP_001342529.1Re-query CCDS DB by Nucleotide ID:NM_001355600Re-query CCDS DB by Protein ID:NP_001342529Link to BLAST:NP_001342529.1
Original member NCBI NM_001355602.1 NP_001342531.1 Updated not alive Link to Nucleotide Sequence:NM_001355602.1Link to Protein Sequence:NP_001342531.1Re-query CCDS DB by Nucleotide ID:NM_001355602Re-query CCDS DB by Protein ID:NP_001342531
Current member NCBI NM_001355602.2 NP_001342531.1 Accepted alive Link to Nucleotide Sequence:NM_001355602.2Link to Protein Sequence:NP_001342531.1Re-query CCDS DB by Nucleotide ID:NM_001355602Re-query CCDS DB by Protein ID:NP_001342531Link to BLAST:NP_001342531.1
Original member Current member NCBI NM_011310.3 NP_035440.1 Accepted alive Link to Nucleotide Sequence:NM_011310.3Link to Protein Sequence:NP_035440.1Re-query CCDS DB by Nucleotide ID:NM_011310Re-query CCDS DB by Protein ID:NP_035440Link to BLAST:NP_035440.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001342526.1 101 P62818 101 100% 0 0
NP_001342529.1 101 P62818 101 100% 0 0
NP_001342531.1 101 P62818 101 100% 0 0
NP_035440.1 101 P62818 101 100% 0 0

Chromosomal Locations for CCDS 17537.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 90601785 90601925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 90602191 90602355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (306 nt):
ATGACCCGGCCCCTGGAGCAGGCAGTAGCTGCCATCGTGTGCACCTTCCAGGAGTATGCAGGGCGCTGTG
GGGATAAATACAAGATCTGCCAGTCGGAGCTCAAGGAGTTGTTGCAGAAGGAGCTGCCCACCTGGACGCC
GAGTGAGTTCCGGGAGTGTGACTACAATAAATTCATGAGTGTTCTGGATACCAACAAAGACTGCGAAGTG
GACTTTGGGGAGTACGTGCGCTCACTTGCCAGCCTCTGTCTCTACTGCCACGAGTACTTCAAAGAGTGCC
CCCCTGAGCCTCCTTGCCCCCAGTAG

Translation (101 aa):
MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEV
DFGEYVRSLASLCLYCHEYFKECPPEPPCPQ


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH