NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS52733.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52733.1 Public Mus musculus 9 Ubl5 23 108 98 CCDS HistoryNCBI Gene:66177Re-query CCDS DB by CCDS ID:52733.1Re-query CCDS DB by GeneID:66177See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52733.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000129414.8 ENSMUSP00000123971.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000129414.8Link to Ensembl Protein Viewer:ENSMUSP00000123971.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000129414Re-query CCDS DB by Protein ID:ENSMUSP00000123971
Original member Current member EBI ENSMUST00000160682.7 ENSMUSP00000124672.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160682.7Link to Ensembl Protein Viewer:ENSMUSP00000124672.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000160682Re-query CCDS DB by Protein ID:ENSMUSP00000124672
Original member Current member EBI ENSMUST00000162303.7 ENSMUSP00000124812.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000162303.7Link to Ensembl Protein Viewer:ENSMUSP00000124812.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000162303Re-query CCDS DB by Protein ID:ENSMUSP00000124812
Original member Current member EBI ENSMUST00000160124.1 ENSMUSP00000125364.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160124.1Link to Ensembl Protein Viewer:ENSMUSP00000125364.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000160124Re-query CCDS DB by Protein ID:ENSMUSP00000125364
Original member Current member NCBI NM_001361025.1 NP_001347954.1 Accepted alive Link to Nucleotide Sequence:NM_001361025.1Link to Protein Sequence:NP_001347954.1Re-query CCDS DB by Nucleotide ID:NM_001361025Re-query CCDS DB by Protein ID:NP_001347954Link to BLAST:NP_001347954.1
Original member Current member NCBI NM_001361027.1 NP_001347956.1 Accepted alive Link to Nucleotide Sequence:NM_001361027.1Link to Protein Sequence:NP_001347956.1Re-query CCDS DB by Nucleotide ID:NM_001361027Re-query CCDS DB by Protein ID:NP_001347956Link to BLAST:NP_001347956.1
Original member Current member NCBI NM_025401.4 NP_079677.1 Accepted alive Link to Nucleotide Sequence:NM_025401.4Link to Protein Sequence:NP_079677.1Re-query CCDS DB by Nucleotide ID:NM_025401Re-query CCDS DB by Protein ID:NP_079677Link to BLAST:NP_079677.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001347954.1 73 Q9EPV8 73 100% 0 0
NP_001347956.1 73 Q9EPV8 73 100% 0 0
NP_079677.1 73 Q9EPV8 73 100% 0 0

Chromosomal Locations for CCDS 52733.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 20645204 20645259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 20645406 20645489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 20645622 20645659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 20646616 20646659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (222 nt):
ATGATTGAGGTGGTTTGCAACGACCGTCTCGGAAAGAAAGTCCGCGTTAAGTGCAACACCGATGACACCA
TCGGCGACTTGAAGAAACTGATAGCTGCTCAAACTGGCACCCGCTGGAACAAGATCGTTCTTAAAAAGTG
GTACACGATTTTTAAGGACCACGTGTCTCTGGGAGATTATGAAATCCACGATGGGATGAACCTGGAGCTT
TATTACCAGTAG

Translation (73 aa):
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLEL
YYQ


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH