NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, December 17, 2024, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS42630.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42630.1 Public Homo sapiens 19 COX6B2 24 110 108 CCDS HistoryNCBI Gene:125965Re-query CCDS DB by CCDS ID:42630.1Re-query CCDS DB by GeneID:125965See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 42630.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000326529.9 ENSP00000320672.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000326529.9Link to Ensembl Protein Viewer:ENSP00000320672.3Re-query CCDS DB by Nucleotide ID:ENST00000326529Re-query CCDS DB by Protein ID:ENSP00000320672
Original member Current member EBI ENST00000590900.5 ENSP00000467128.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000590900.5Link to Ensembl Protein Viewer:ENSP00000467128.1Re-query CCDS DB by Nucleotide ID:ENST00000590900Re-query CCDS DB by Protein ID:ENSP00000467128
Original member Current member EBI ENST00000593184.5 ENSP00000467266.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000593184.5Link to Ensembl Protein Viewer:ENSP00000467266.1Re-query CCDS DB by Nucleotide ID:ENST00000593184Re-query CCDS DB by Protein ID:ENSP00000467266
Original member Current member EBI ENST00000588572.6 ENSP00000467959.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000588572.6Link to Ensembl Protein Viewer:ENSP00000467959.1Re-query CCDS DB by Nucleotide ID:ENST00000588572Re-query CCDS DB by Protein ID:ENSP00000467959
Original member Current member EBI ENST00000589467.1 ENSP00000476768.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000589467.1Link to Ensembl Protein Viewer:ENSP00000476768.1Re-query CCDS DB by Nucleotide ID:ENST00000589467Re-query CCDS DB by Protein ID:ENSP00000476768
Original member Current member NCBI NM_001369798.1 NP_001356727.1 Accepted alive Link to Nucleotide Sequence:NM_001369798.1Link to Protein Sequence:NP_001356727.1Re-query CCDS DB by Nucleotide ID:NM_001369798Re-query CCDS DB by Protein ID:NP_001356727Link to BLAST:NP_001356727.1
Original member Current member NCBI NM_001369799.1 NP_001356728.1 Accepted alive Link to Nucleotide Sequence:NM_001369799.1Link to Protein Sequence:NP_001356728.1Re-query CCDS DB by Nucleotide ID:NM_001369799Re-query CCDS DB by Protein ID:NP_001356728Link to BLAST:NP_001356728.1
Original member Current member NCBI NM_001369800.1 NP_001356729.1 Accepted alive Link to Nucleotide Sequence:NM_001369800.1Link to Protein Sequence:NP_001356729.1Re-query CCDS DB by Nucleotide ID:NM_001369800Re-query CCDS DB by Protein ID:NP_001356729Link to BLAST:NP_001356729.1
Original member Current member NCBI NM_144613.5 NP_653214.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_144613.5Link to Protein Sequence:NP_653214.2Re-query CCDS DB by Nucleotide ID:NM_144613Re-query CCDS DB by Protein ID:NP_653214Link to BLAST:NP_653214.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001356727.1 88 Q6YFQ2 88 100% 0 0
NP_001356728.1 88 Q6YFQ2 88 100% 0 0
NP_001356729.1 88 Q6YFQ2 88 100% 0 0
NP_653214.2 88 Q6YFQ2 88 100% 0 0

Chromosomal Locations for CCDS 42630.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 55353721 55353774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 55353866 55353966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 55354410 55354521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (267 nt):
ATGTTGGATGTGGAAGCCCAGGAGCCCCCCAAGGGGAAATGGTCGACGCCGCCCTTCGACCCGCGCTTCC
CC
AGCCAGAACCAGATCCGTAACTGCTACCAGAACTTCCTGGACTACCACCGCTGCCTCAAGACCAGGAC
C
CGCCGCGGGAAGAGCACGCAGCCCTGCGAGTACTATTTCCGCGTGTACCACTCGCTGTGCCCCATCAGC
TGG
GTGGAGAGCTGGAACGAGCAGATCAAGAACGGGATTTTCGCCGGCAAAATCTGA


Translation (88 aa):
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS
W
VESWNEQIKNGIFAGKI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser