NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS13293.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13293.1 Public Homo sapiens 20 MANBAL 24 110 108 CCDS HistoryNCBI Gene:63905Re-query CCDS DB by CCDS ID:13293.1Re-query CCDS DB by GeneID:63905See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13293.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000373605.7 ENSP00000362707.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373605.7Link to Ensembl Protein Viewer:ENSP00000362707.3Re-query CCDS DB by Nucleotide ID:ENST00000373605Re-query CCDS DB by Protein ID:ENSP00000362707
Original member Current member EBI ENST00000373606.8 ENSP00000362708.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000373606.8Link to Ensembl Protein Viewer:ENSP00000362708.3Re-query CCDS DB by Nucleotide ID:ENST00000373606Re-query CCDS DB by Protein ID:ENSP00000362708
Original member Current member EBI ENST00000397151.1 ENSP00000380338.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397151.1Link to Ensembl Protein Viewer:ENSP00000380338.1Re-query CCDS DB by Nucleotide ID:ENST00000397151Re-query CCDS DB by Protein ID:ENSP00000380338
Original member Current member EBI ENST00000397152.7 ENSP00000380339.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397152.7Link to Ensembl Protein Viewer:ENSP00000380339.3Re-query CCDS DB by Nucleotide ID:ENST00000397152Re-query CCDS DB by Protein ID:ENSP00000380339
Original member Current member NCBI NM_001003897.2 NP_001003897.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001003897.2Link to Protein Sequence:NP_001003897.1Re-query CCDS DB by Nucleotide ID:NM_001003897Re-query CCDS DB by Protein ID:NP_001003897Link to BLAST:NP_001003897.1
Original member Current member NCBI NM_001369742.1 NP_001356671.1 Accepted alive Link to Nucleotide Sequence:NM_001369742.1Link to Protein Sequence:NP_001356671.1Re-query CCDS DB by Nucleotide ID:NM_001369742Re-query CCDS DB by Protein ID:NP_001356671Link to BLAST:NP_001356671.1
Original member Current member NCBI NM_001369743.1 NP_001356672.1 Accepted alive Link to Nucleotide Sequence:NM_001369743.1Link to Protein Sequence:NP_001356672.1Re-query CCDS DB by Nucleotide ID:NM_001369743Re-query CCDS DB by Protein ID:NP_001356672Link to BLAST:NP_001356672.1
Original member Current member NCBI NM_001376529.1 NP_001363458.1 Accepted alive Link to Nucleotide Sequence:NM_001376529.1Link to Protein Sequence:NP_001363458.1Re-query CCDS DB by Nucleotide ID:NM_001376529Re-query CCDS DB by Protein ID:NP_001363458Link to BLAST:NP_001363458.1
Original member Current member NCBI NM_001376530.1 NP_001363459.1 Accepted alive Link to Nucleotide Sequence:NM_001376530.1Link to Protein Sequence:NP_001363459.1Re-query CCDS DB by Nucleotide ID:NM_001376530Re-query CCDS DB by Protein ID:NP_001363459Link to BLAST:NP_001363459.1
Original member Current member NCBI NM_001376531.1 NP_001363460.1 Accepted alive Link to Nucleotide Sequence:NM_001376531.1Link to Protein Sequence:NP_001363460.1Re-query CCDS DB by Nucleotide ID:NM_001376531Re-query CCDS DB by Protein ID:NP_001363460Link to BLAST:NP_001363460.1
Original member Current member NCBI NM_001376532.1 NP_001363461.1 Accepted alive Link to Nucleotide Sequence:NM_001376532.1Link to Protein Sequence:NP_001363461.1Re-query CCDS DB by Nucleotide ID:NM_001376532Re-query CCDS DB by Protein ID:NP_001363461Link to BLAST:NP_001363461.1
Original member Current member NCBI NM_001376533.1 NP_001363462.1 Accepted alive Link to Nucleotide Sequence:NM_001376533.1Link to Protein Sequence:NP_001363462.1Re-query CCDS DB by Nucleotide ID:NM_001376533Re-query CCDS DB by Protein ID:NP_001363462Link to BLAST:NP_001363462.1
Original member Current member NCBI NM_001387335.1 NP_001374264.1 Accepted alive Link to Nucleotide Sequence:NM_001387335.1Link to Protein Sequence:NP_001374264.1Re-query CCDS DB by Nucleotide ID:NM_001387335Re-query CCDS DB by Protein ID:NP_001374264Link to BLAST:NP_001374264.1
Original member Current member NCBI NM_022077.4 NP_071360.1 Accepted alive Link to Nucleotide Sequence:NM_022077.4Link to Protein Sequence:NP_071360.1Re-query CCDS DB by Nucleotide ID:NM_022077Re-query CCDS DB by Protein ID:NP_071360Link to BLAST:NP_071360.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001003897.1 85 Q9NQG1 85 100% 0 0
NP_001356671.1 85 Q9NQG1 85 100% 0 0
NP_001356672.1 85 Q9NQG1 85 100% 0 0
NP_001363458.1 85 Q9NQG1 85 100% 0 0
NP_001363459.1 85 Q9NQG1 85 100% 0 0
NP_001363460.1 85 Q9NQG1 85 100% 0 0
NP_001363461.1 85 Q9NQG1 85 100% 0 0
NP_001363462.1 85 Q9NQG1 85 100% 0 0
NP_001374264.1 85 Q9NQG1 85 100% 0 0
NP_071360.1 85 Q9NQG1 85 100% 0 0

Chromosomal Locations for CCDS 13293.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 37301264 37301413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 37316308 37316415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (258 nt):
ATGGCCTCTGACCTAGACTTCTCACCTCCGGAGGTGCCCGAGCCCACTTTCCTGGAGAACCTGCTACGGT
ACGGACTCTTCCTGGGAGCCATCTTCCAGCTCATCTGTGTGCTGGCCATCATCGTACCCATTCCCAAGTC
CCACGAGGCGGAGGCTGAACCGTCTGAGCCCAGAAGTGCTGAGGTGACGAGGAAGCCCAAGGCTGCTGTT
CCTTCTGTGAACAAGAGGCCCAAGAAAGAGACTAAGAAGAAGCGGTAG

Translation (85 aa):
MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV
PSVNKRPKKETKKKR


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH