NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS6291.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6291.1 Public Homo sapiens 8 ZNF706 24 110 108 CCDS HistoryNCBI Gene:51123Re-query CCDS DB by CCDS ID:6291.1Re-query CCDS DB by GeneID:51123See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6291.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000311212.9 ENSP00000311768.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000311212.9Link to Ensembl Protein Viewer:ENSP00000311768.4Re-query CCDS DB by Nucleotide ID:ENST00000311212Re-query CCDS DB by Protein ID:ENSP00000311768
Original member Current member EBI ENST00000520984.5 ENSP00000427761.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000520984.5Link to Ensembl Protein Viewer:ENSP00000427761.1Re-query CCDS DB by Nucleotide ID:ENST00000520984Re-query CCDS DB by Protein ID:ENSP00000427761
Original member Current member EBI ENST00000517844.5 ENSP00000428227.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000517844.5Link to Ensembl Protein Viewer:ENSP00000428227.1Re-query CCDS DB by Nucleotide ID:ENST00000517844Re-query CCDS DB by Protein ID:ENSP00000428227
Original member Current member EBI ENST00000518336.5 ENSP00000428696.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000518336.5Link to Ensembl Protein Viewer:ENSP00000428696.1Re-query CCDS DB by Nucleotide ID:ENST00000518336Re-query CCDS DB by Protein ID:ENSP00000428696
Original member Current member EBI ENST00000519882.5 ENSP00000428985.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000519882.5Link to Ensembl Protein Viewer:ENSP00000428985.1Re-query CCDS DB by Nucleotide ID:ENST00000519882Re-query CCDS DB by Protein ID:ENSP00000428985
Original member Current member EBI ENST00000521272.5 ENSP00000430165.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000521272.5Link to Ensembl Protein Viewer:ENSP00000430165.1Re-query CCDS DB by Nucleotide ID:ENST00000521272Re-query CCDS DB by Protein ID:ENSP00000430165
Original member Current member EBI ENST00000520347.5 ENSP00000430823.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000520347.5Link to Ensembl Protein Viewer:ENSP00000430823.1Re-query CCDS DB by Nucleotide ID:ENST00000520347Re-query CCDS DB by Protein ID:ENSP00000430823
Original member Current member NCBI NM_001042510.2 NP_001035975.1 Accepted alive Link to Nucleotide Sequence:NM_001042510.2Link to Protein Sequence:NP_001035975.1Re-query CCDS DB by Nucleotide ID:NM_001042510Re-query CCDS DB by Protein ID:NP_001035975Link to BLAST:NP_001035975.1
Original member Current member NCBI NM_001267708.2 NP_001254637.1 Accepted alive Link to Nucleotide Sequence:NM_001267708.2Link to Protein Sequence:NP_001254637.1Re-query CCDS DB by Nucleotide ID:NM_001267708Re-query CCDS DB by Protein ID:NP_001254637Link to BLAST:NP_001254637.1
Original member Current member NCBI NM_001267709.2 NP_001254638.1 Accepted alive Link to Nucleotide Sequence:NM_001267709.2Link to Protein Sequence:NP_001254638.1Re-query CCDS DB by Nucleotide ID:NM_001267709Re-query CCDS DB by Protein ID:NP_001254638Link to BLAST:NP_001254638.1
Original member Current member NCBI NM_016096.5 NP_057180.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_016096.5Link to Protein Sequence:NP_057180.1Re-query CCDS DB by Nucleotide ID:NM_016096Re-query CCDS DB by Protein ID:NP_057180Link to BLAST:NP_057180.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001035975.1 76 Q9Y5V0 76 100% 0 0
NP_001254637.1 76 Q9Y5V0 76 100% 0 0
NP_001254638.1 76 Q9Y5V0 76 100% 0 0
NP_057180.1 76 Q9Y5V0 76 100% 0 0

Chromosomal Locations for CCDS 6291.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 101200002 101200097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 101201607 101201741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (231 nt):
ATGGCTCGTGGACAGCAGAAAATTCAGTCTCAGCAGAAAAATGCCAAAAAGCAAGCTGGACAAAAGAAGA
AACAAGGACATGACCAAAAGGCTGCTGCCAAAGCTGCCTTAATATATACCTGCACTGTCTGTAGGACACA
AATGCCAGACCCTAAGACCTTCAAGCAGCACTTTGAGAGCAAGCATCCTAAGACTCCACTTCCTCCAGAA
TTAGCTGATGTTCAGGCATAA

Translation (76 aa):
MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE
LADVQA


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH