NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS5513.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5513.1 Public Homo sapiens 7 SEC61G 24 110 108 CCDS HistoryNCBI Gene:23480Re-query CCDS DB by CCDS ID:5513.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5513.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000352861.9 ENSP00000341538.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000352861.9Link to Ensembl Protein Viewer:ENSP00000341538.4Re-query CCDS DB by Nucleotide ID:ENST00000352861Re-query CCDS DB by Protein ID:ENSP00000341538
Original member Current member EBI ENST00000395535.7 ENSP00000378906.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395535.7Link to Ensembl Protein Viewer:ENSP00000378906.3Re-query CCDS DB by Nucleotide ID:ENST00000395535Re-query CCDS DB by Protein ID:ENSP00000378906
Original member Current member EBI ENST00000415949.5 ENSP00000388337.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000415949.5Link to Ensembl Protein Viewer:ENSP00000388337.1Re-query CCDS DB by Nucleotide ID:ENST00000415949Re-query CCDS DB by Protein ID:ENSP00000388337
Original member Current member EBI ENST00000450622.1 ENSP00000409884.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000450622.1Link to Ensembl Protein Viewer:ENSP00000409884.1Re-query CCDS DB by Nucleotide ID:ENST00000450622Re-query CCDS DB by Protein ID:ENSP00000409884
Original member Current member NCBI NM_001012456.2 NP_001012474.1 Accepted alive Link to Nucleotide Sequence:NM_001012456.2Link to Protein Sequence:NP_001012474.1Re-query CCDS DB by Nucleotide ID:NM_001012456Re-query CCDS DB by Protein ID:NP_001012474Link to BLAST:NP_001012474.1
Original member Current member NCBI NM_014302.4 NP_055117.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_014302.4Link to Protein Sequence:NP_055117.1Re-query CCDS DB by Nucleotide ID:NM_014302Re-query CCDS DB by Protein ID:NP_055117Link to BLAST:NP_055117.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001012474.1 68 P60059 68 100% 0 0
NP_055117.1 68 P60059 68 100% 0 0

Chromosomal Locations for CCDS 5513.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 54752411 54752420 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 54755779 54755881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 54757495 54757588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (207 nt):
ATGGATCAGGTAATGCAGTTTGTTGAGCCAAGTCGGCAGTTTGTAAAGGACTCCATTCGGCTGGTTAAAA
GATGCACTAAACCTGATAGAAAAGAATTCCAGAAGATTGCCATGGCAACAGCAATAGGATTTGCTATAAT
GGGATTCATTGGCTTCTTTGTGAAATTGATCCATATTCCTATTAATAACATCATTGTTGGTGGCTGA

Translation (68 aa):
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH