NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, January 28, 2025, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS75499.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75499.1 Public Homo sapiens 6 CD24 24 110 108 CCDS HistoryNCBI Gene:100133941Re-query CCDS DB by CCDS ID:75499.1Re-query CCDS DB by GeneID:100133941See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 75499.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000606017.2 ENSP00000475625.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000606017.2Link to Ensembl Protein Viewer:ENSP00000475625.1Re-query CCDS DB by Nucleotide ID:ENST00000606017Re-query CCDS DB by Protein ID:ENSP00000475625
Original member Current member EBI ENST00000610952.1 ENSP00000483838.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000610952.1Link to Ensembl Protein Viewer:ENSP00000483838.1Re-query CCDS DB by Nucleotide ID:ENST00000610952Re-query CCDS DB by Protein ID:ENSP00000483838
Original member Current member EBI ENST00000619133.4 ENSP00000483985.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000619133.4Link to Ensembl Protein Viewer:ENSP00000483985.1Re-query CCDS DB by Nucleotide ID:ENST00000619133Re-query CCDS DB by Protein ID:ENSP00000483985
Original member Current member NCBI NM_001291737.1 NP_001278666.1 Accepted alive Link to Nucleotide Sequence:NM_001291737.1Link to Protein Sequence:NP_001278666.1Re-query CCDS DB by Nucleotide ID:NM_001291737Re-query CCDS DB by Protein ID:NP_001278666Link to BLAST:NP_001278666.1
Original member Current member NCBI NM_001291738.1 NP_001278667.1 Accepted alive Link to Nucleotide Sequence:NM_001291738.1Link to Protein Sequence:NP_001278667.1Re-query CCDS DB by Nucleotide ID:NM_001291738Re-query CCDS DB by Protein ID:NP_001278667Link to BLAST:NP_001278667.1
Original member Current member NCBI NM_001359084.1 NP_001346013.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001359084.1Link to Protein Sequence:NP_001346013.1Re-query CCDS DB by Nucleotide ID:NM_001359084Re-query CCDS DB by Protein ID:NP_001346013Link to BLAST:NP_001346013.1
Original member Current member NCBI NM_013230.3 NP_037362.1 Accepted alive Link to Nucleotide Sequence:NM_013230.3Link to Protein Sequence:NP_037362.1Re-query CCDS DB by Nucleotide ID:NM_013230Re-query CCDS DB by Protein ID:NP_037362Link to BLAST:NP_037362.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001278666.1 80 P25063-1 80 100% 0 0
NP_001278667.1 80 P25063-1 80 100% 0 0
NP_001346013.1 80 P25063-1 80 100% 0 0
NP_037362.1 80 P25063-1 80 100% 0 0

Chromosomal Locations for CCDS 75499.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 106971661 106971834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 106974578 106974646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (243 nt):
ATGGGCAGAGCAATGGTGGCCAGGCTCGGGCTGGGGCTGCTGCTGCTGGCACTGCTCCTACCCACGCAGA
TT
TATTCCAGTGAAACAACAACTGGAACTTCAAGTAACTCCTCCCAGAGTACTTCCAACTCTGGGTTGGC
C
CCAAATCCAACTAATGCCACCACCAAGGCGGCTGGTGGTGCCCTGCAGTCAACAGCCAGTCTCTTCGTG
GTC
TCACTCTCTCTTCTGCATCTCTACTCTTAA


Translation (80 aa):
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFV
V
SLSLLHLYS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser