NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS35899.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35899.1 Public Mus musculus 10 Pln 23 108 98 CCDS HistoryNCBI Gene:18821Re-query CCDS DB by CCDS ID:35899.1Re-query CCDS DB by GeneID:18821See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35899.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000046221.7 ENSMUSP00000045709.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046221.7Link to Ensembl Protein Viewer:ENSMUSP00000045709.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000046221Re-query CCDS DB by Protein ID:ENSMUSP00000045709
Original member Current member EBI ENSMUST00000163319.8 ENSMUSP00000132743.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000163319.8Link to Ensembl Protein Viewer:ENSMUSP00000132743.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000163319Re-query CCDS DB by Protein ID:ENSMUSP00000132743
Original member Current member EBI ENSMUST00000219491.1 ENSMUSP00000151641.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000219491.1Link to Ensembl Protein Viewer:ENSMUSP00000151641.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000219491Re-query CCDS DB by Protein ID:ENSMUSP00000151641
Original member Current member EBI ENSMUST00000218468.1 ENSMUSP00000151745.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000218468.1Link to Ensembl Protein Viewer:ENSMUSP00000151745.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000218468Re-query CCDS DB by Protein ID:ENSMUSP00000151745
Original member Current member EBI ENSMUST00000219921.1 ENSMUSP00000151860.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000219921.1Link to Ensembl Protein Viewer:ENSMUSP00000151860.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000219921Re-query CCDS DB by Protein ID:ENSMUSP00000151860
Original member Current member EBI ENSMUST00000220197.1 ENSMUSP00000151966.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000220197.1Link to Ensembl Protein Viewer:ENSMUSP00000151966.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000220197Re-query CCDS DB by Protein ID:ENSMUSP00000151966
Original member Current member NCBI NM_001141927.1 NP_001135399.1 Accepted alive Link to Nucleotide Sequence:NM_001141927.1Link to Protein Sequence:NP_001135399.1Re-query CCDS DB by Nucleotide ID:NM_001141927Re-query CCDS DB by Protein ID:NP_001135399Link to BLAST:NP_001135399.1
Original member Current member NCBI NM_023129.5 NP_075618.1 Accepted alive Link to Nucleotide Sequence:NM_023129.5Link to Protein Sequence:NP_075618.1Re-query CCDS DB by Nucleotide ID:NM_023129Re-query CCDS DB by Protein ID:NP_075618Link to BLAST:NP_075618.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001135399.1 52 P61014 52 100% 0 0
NP_075618.1 52 P61014 52 100% 0 0

Chromosomal Locations for CCDS 35899.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 53343864 53344022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (159 nt):
ATGGAAAAAGTGCAATACCTCACTCGCTCGGCTATCAGGAGAGCCTCCACTATTGAAATGCCTCAGCAAG
CA
CGTCAGAATCTCCAGAACCTATTTATCAATTTCTGCCTCATCTTGATATGTCTGCTGCTGATCTGCAT
C
ATTGTGATGCTTCTGTGA


Translation (52 aa):
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser