NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS40559.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40559.1 Public Mus musculus 9 Elof1 23 108 98 CCDS HistoryNCBI Gene:66126Re-query CCDS DB by CCDS ID:40559.1Re-query CCDS DB by GeneID:66126See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40559.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000013966.7 ENSMUSP00000013966.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000013966.7Link to Ensembl Protein Viewer:ENSMUSP00000013966.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000013966Re-query CCDS DB by Protein ID:ENSMUSP00000013966
Original member Current member EBI ENSMUST00000166335.1 ENSMUSP00000128173.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166335.1Link to Ensembl Protein Viewer:ENSMUSP00000128173.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000166335Re-query CCDS DB by Protein ID:ENSMUSP00000128173
Original member Current member EBI ENSMUST00000216837.1 ENSMUSP00000149885.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000216837.1Link to Ensembl Protein Viewer:ENSMUSP00000149885.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000216837Re-query CCDS DB by Protein ID:ENSMUSP00000149885
Original member Current member EBI ENSMUST00000213233.1 ENSMUSP00000150169.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000213233.1Link to Ensembl Protein Viewer:ENSMUSP00000150169.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000213233Re-query CCDS DB by Protein ID:ENSMUSP00000150169
Original member Current member EBI ENSMUST00000214394.1 ENSMUSP00000150536.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000214394.1Link to Ensembl Protein Viewer:ENSMUSP00000150536.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000214394Re-query CCDS DB by Protein ID:ENSMUSP00000150536
Original member Current member NCBI NM_001357309.1 NP_001344238.1 Accepted alive Link to Nucleotide Sequence:NM_001357309.1Link to Protein Sequence:NP_001344238.1Re-query CCDS DB by Nucleotide ID:NM_001357309Re-query CCDS DB by Protein ID:NP_001344238Link to BLAST:NP_001344238.1
Original member Current member NCBI NM_001357310.1 NP_001344239.1 Accepted alive Link to Nucleotide Sequence:NM_001357310.1Link to Protein Sequence:NP_001344239.1Re-query CCDS DB by Nucleotide ID:NM_001357310Re-query CCDS DB by Protein ID:NP_001344239Link to BLAST:NP_001344239.1
Original member Current member NCBI NM_001357311.1 NP_001344240.1 Accepted alive Link to Nucleotide Sequence:NM_001357311.1Link to Protein Sequence:NP_001344240.1Re-query CCDS DB by Nucleotide ID:NM_001357311Re-query CCDS DB by Protein ID:NP_001344240Link to BLAST:NP_001344240.1
Original member Current member NCBI NM_001357312.1 NP_001344241.1 Accepted alive Link to Nucleotide Sequence:NM_001357312.1Link to Protein Sequence:NP_001344241.1Re-query CCDS DB by Nucleotide ID:NM_001357312Re-query CCDS DB by Protein ID:NP_001344241Link to BLAST:NP_001344241.1
Original member Current member NCBI NM_001357313.1 NP_001344242.1 Accepted alive Link to Nucleotide Sequence:NM_001357313.1Link to Protein Sequence:NP_001344242.1Re-query CCDS DB by Nucleotide ID:NM_001357313Re-query CCDS DB by Protein ID:NP_001344242Link to BLAST:NP_001344242.1
Original member Current member NCBI NM_001357314.1 NP_001344243.1 Accepted alive Link to Nucleotide Sequence:NM_001357314.1Link to Protein Sequence:NP_001344243.1Re-query CCDS DB by Nucleotide ID:NM_001357314Re-query CCDS DB by Protein ID:NP_001344243Link to BLAST:NP_001344243.1
Original member Current member NCBI NM_170777.4 NP_740747.1 Accepted alive Link to Nucleotide Sequence:NM_170777.4Link to Protein Sequence:NP_740747.1Re-query CCDS DB by Nucleotide ID:NM_170777Re-query CCDS DB by Protein ID:NP_740747Link to BLAST:NP_740747.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001344238.1 83 P60003 83 100% 0 0
NP_001344239.1 83 P60003 83 100% 0 0
NP_001344240.1 83 P60003 83 100% 0 0
NP_001344241.1 83 P60003 83 100% 0 0
NP_001344242.1 83 P60003 83 100% 0 0
NP_001344243.1 83 P60003 83 100% 0 0
NP_740747.1 83 P60003 83 100% 0 0

Chromosomal Locations for CCDS 40559.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 22113544 22113679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 22113808 22113923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (252 nt):
ATGGGACGAAGAAAGTCCAAACGGAAGCCGCCCCCAAAAAAGAAGATGACAGGCACCCTGGAGACCCAGT
TCACCTGCCCTTTCTGCAACCACGAGAAGTCTTGTGATGTGAAAATGGACCGTGCTCGAAACACTGGAGT
CATCTCCTGTACTGTGTGCCTAGAGGAATTCCAGACACCCATCACATACCTGTCAGAACCAGTGGATGTG
TACAGCGACTGGATAGATGCCTGCGAGGCAGCCAATCAGTAG

Translation (83 aa):
MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDV
YSDWIDACEAANQ


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH