NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS59259.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59259.1 Public Homo sapiens 16 SMIM22 24 110 108 CCDS HistoryNCBI Gene:440335Re-query CCDS DB by CCDS ID:59259.1Re-query CCDS DB by GeneID:440335See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 12, NCBI annotation release 104, Ensembl annotation release 71

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 59259.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000586005.6 ENSP00000464748.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000586005.6Link to Ensembl Protein Viewer:ENSP00000464748.1Re-query CCDS DB by Nucleotide ID:ENST00000586005Re-query CCDS DB by Protein ID:ENSP00000464748
Original member Current member EBI ENST00000586440.1 ENSP00000465037.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000586440.1Link to Ensembl Protein Viewer:ENSP00000465037.1Re-query CCDS DB by Nucleotide ID:ENST00000586440Re-query CCDS DB by Protein ID:ENSP00000465037
Original member Current member EBI ENST00000589327.5 ENSP00000468237.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000589327.5Link to Ensembl Protein Viewer:ENSP00000468237.1Re-query CCDS DB by Nucleotide ID:ENST00000589327Re-query CCDS DB by Protein ID:ENSP00000468237
Original member Current member EBI ENST00000615889.4 ENSP00000481592.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000615889.4Link to Ensembl Protein Viewer:ENSP00000481592.1Re-query CCDS DB by Nucleotide ID:ENST00000615889Re-query CCDS DB by Protein ID:ENSP00000481592
Original member Current member NCBI NM_001253791.1 NP_001240720.1 Accepted alive Link to Nucleotide Sequence:NM_001253791.1Link to Protein Sequence:NP_001240720.1Re-query CCDS DB by Nucleotide ID:NM_001253791Re-query CCDS DB by Protein ID:NP_001240720Link to BLAST:NP_001240720.1
Original member Current member NCBI NM_001253794.2 NP_001240723.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001253794.2Link to Protein Sequence:NP_001240723.1Re-query CCDS DB by Nucleotide ID:NM_001253794Re-query CCDS DB by Protein ID:NP_001240723Link to BLAST:NP_001240723.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001240720.1 88 K7EJ46-2 88 100% 0 0
NP_001240723.1 88 K7EJ46-2 88 100% 0 0

Chromosomal Locations for CCDS 59259.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 4795735 4795858 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 4795948 4796048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 4796190 4796231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (267 nt):
ATGGCTGTGTCCACAGAGGAGCTGGAGGCCACGGTTCAGGAAGTCCTGGGGAGACTGAAGAGCCACCAGT
TTTTCCAGTCCACATGGGACACTGTTGCCTTCATTGTTTTCCTCACCTTCATGGGCACCGTGCTGCTCCT
GCTGCTGCTGGTCGTCGCCCACTGCTGCTGCTGCAGCTCCCCCGGGCCCCGCAGGGAAAGCCCCAGGAAG
GTGAGCCCCTGGAAGGAAAGACCCAAGGGAGTGGATAACTTGGCCCTGGAACCCTGA

Translation (88 aa):
MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRK
VSPWKERPKGVDNLALEP


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH