NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1877025719|ref|WP_180363758|]
View 

MULTISPECIES: KxYKxGKxW signal peptide domain-containing protein, partial [unclassified Streptococcus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Fibrinogen_BP super family cl26313
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 18-56 8.28e-20

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


The actual alignment was detected with superfamily member pfam08017:

Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 79.91  E-value: 8.28e-20
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1877025719  18 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAD 56
Cdd:pfam08017   1 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAE 39
 
Name Accession Description Interval E-value
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 18-56 8.28e-20

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 79.91  E-value: 8.28e-20
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1877025719  18 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAD 56
Cdd:pfam08017   1 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAE 39
 
Name Accession Description Interval E-value
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 18-56 8.28e-20

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 79.91  E-value: 8.28e-20
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1877025719  18 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAD 56
Cdd:pfam08017   1 YMGVLGSTIILGSSPVSAMDSVGNQSQGNVLERRQRDAE 39
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 39-56 8.62e-04

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.84  E-value: 8.62e-04
                          10
                  ....*....|....*...
gi 1877025719  39 VGNQSQGNVLERRQRDAD 56
Cdd:pfam08017 166 AENRSQGNVLERRQRDAE 183
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.50e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.50e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 184 NKSQGNVLERRQRDAE 199
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.65e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.65e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 136 NRSQGNVLERRQRDAE 151
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.65e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.65e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 200 NRSQGNVLERRQRDAE 215
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.65e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.65e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 216 NRSQGNVLERRQRDAE 231
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.65e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.65e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 232 NRSQGNVLERRQRDAE 247
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.65e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.65e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 248 NKSQGNVLERRQRDAE 263
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.65e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.65e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 264 NRSQGNVLERRQRDAE 279
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 1.65e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 34.07  E-value: 1.65e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 280 NRSQGNVLERRQRDAE 295
Fibrinogen_BP pfam08017
Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family ...
 41-56 6.59e-03

Fibrinogen binding protein; Proteins in this family bind to fibrinogen. Members of this family includes the fibrinogen receptor, FbsA, which mediates platelet aggregation.


Pssm-ID: 311808 [Multi-domain]  Cd Length: 393  Bit Score: 32.53  E-value: 6.59e-03
                          10
                  ....*....|....*.
gi 1877025719  41 NQSQGNVLERRQRDAD 56
Cdd:pfam08017 152 NRSQGNVLERRQRDAE 167
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH