NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|767971646|ref|XP_011518855|]
View 

BLOC-1-related complex subunit 5 isoform X2 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
BORCS5-like cd22789
BLOC-1-related complex subunit 5, and related proteins; This model includes BLOC-1-related ...
 30-120 6.48e-47

BLOC-1-related complex subunit 5, and related proteins; This model includes BLOC-1-related complex subunit 5 (BORCS5), which is also called loss of heterozygosity 12 chromosomal region 1 (LOH12CR1), myristoylated lysosomal protein, or myrlysin. BORCS5 is a component of BLOC-1 related complex (BORC), a multisubunit complex that also contains Lyspersin/C17orf59, Diaskedin/C10orf32, KxDL1, MEF2BNB, BLOS1, BLOS2, and Snapin subunits. BLOC-1 is important for the biogenesis of lysosome-related organelles, and BORC is important for the positioning of the lysosome in the cytoplasm. The BORC complex associates with the lysosomal membrane where it recruits the small GTPase Arl8, which leads in turn to the kinesin-dependent movement of lysosomes toward the plus ends of microtubules in the peripheral cytoplasm. LOH12CR1 may function as a tumor suppressor by inhibiting tumor growth through deregulation of the G1/S checkpoint in human colorectal carcinoma. It has been shown to bind to LKB1, a well-known tumor suppressor gene in colorectal cancer; its expression level could be used as a promising biomarker in patients. This domain has also been found in many hypothetical proteins involved in loss of heterozygosity and thus tumor suppression.


:

Pssm-ID: 439361  Cd Length: 157  Bit Score: 148.21  E-value: 6.48e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 767971646  30 KMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAF 109
Cdd:cd22789    1 KMDDIVVVNEGTQSSRNVSNDPDLIKLQEIPTFLPLLKGSLNLPGSPDPEVLEKLDPRPLLKLCLRYQDHLRQCAEAVAF 80

                         90
                 ....*....|.
gi 767971646 110 DQNALVKRIKE 120
Cdd:cd22789   81 DQNALVKRIKE 91
 
Name Accession Description Interval E-value
BORCS5-like cd22789
BLOC-1-related complex subunit 5, and related proteins; This model includes BLOC-1-related ...
 30-120 6.48e-47

BLOC-1-related complex subunit 5, and related proteins; This model includes BLOC-1-related complex subunit 5 (BORCS5), which is also called loss of heterozygosity 12 chromosomal region 1 (LOH12CR1), myristoylated lysosomal protein, or myrlysin. BORCS5 is a component of BLOC-1 related complex (BORC), a multisubunit complex that also contains Lyspersin/C17orf59, Diaskedin/C10orf32, KxDL1, MEF2BNB, BLOS1, BLOS2, and Snapin subunits. BLOC-1 is important for the biogenesis of lysosome-related organelles, and BORC is important for the positioning of the lysosome in the cytoplasm. The BORC complex associates with the lysosomal membrane where it recruits the small GTPase Arl8, which leads in turn to the kinesin-dependent movement of lysosomes toward the plus ends of microtubules in the peripheral cytoplasm. LOH12CR1 may function as a tumor suppressor by inhibiting tumor growth through deregulation of the G1/S checkpoint in human colorectal carcinoma. It has been shown to bind to LKB1, a well-known tumor suppressor gene in colorectal cancer; its expression level could be used as a promising biomarker in patients. This domain has also been found in many hypothetical proteins involved in loss of heterozygosity and thus tumor suppression.


Pssm-ID: 439361  Cd Length: 157  Bit Score: 148.21  E-value: 6.48e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 767971646  30 KMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAF 109
Cdd:cd22789    1 KMDDIVVVNEGTQSSRNVSNDPDLIKLQEIPTFLPLLKGSLNLPGSPDPEVLEKLDPRPLLKLCLRYQDHLRQCAEAVAF 80

                         90
                 ....*....|.
gi 767971646 110 DQNALVKRIKE 120
Cdd:cd22789   81 DQNALVKRIKE 91
LOH1CR12 pfam10158
Tumour suppressor protein; This is a region of 130 amino acids that is the most conserved ...
 61-120 2.45e-27

Tumour suppressor protein; This is a region of 130 amino acids that is the most conserved region of hypothetical proteins involved in loss of heterozygosity and thus tumour suppression. The exact function of family members is not known. This region is also found in subunit 5 of the BLOC-1-related complex, which is also found in the BORC complex. BLOC-1 is important for the biogenesis of lysosome-related organelles, and BORC is important for the positioning of the lysosome in the cytoplasm. The BORC complex associates with the lysosomal membrane where it recruits the small GTPase Arl8, which leads in turn to the kinesin-dependent movement of lysosomes toward the plus ends of microtubules in the peripheral cytoplasm.


Pssm-ID: 287167  Cd Length: 131  Bit Score: 97.58  E-value: 2.45e-27
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 767971646   61 TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE 120
Cdd:pfam10158   1 RFLPVLRGVISKRTNRTNETLEKLSSQHFINLCTRLQEHFNVCAKAVASDQNKIVARIKE 60
 
Name Accession Description Interval E-value
BORCS5-like cd22789
BLOC-1-related complex subunit 5, and related proteins; This model includes BLOC-1-related ...
 30-120 6.48e-47

BLOC-1-related complex subunit 5, and related proteins; This model includes BLOC-1-related complex subunit 5 (BORCS5), which is also called loss of heterozygosity 12 chromosomal region 1 (LOH12CR1), myristoylated lysosomal protein, or myrlysin. BORCS5 is a component of BLOC-1 related complex (BORC), a multisubunit complex that also contains Lyspersin/C17orf59, Diaskedin/C10orf32, KxDL1, MEF2BNB, BLOS1, BLOS2, and Snapin subunits. BLOC-1 is important for the biogenesis of lysosome-related organelles, and BORC is important for the positioning of the lysosome in the cytoplasm. The BORC complex associates with the lysosomal membrane where it recruits the small GTPase Arl8, which leads in turn to the kinesin-dependent movement of lysosomes toward the plus ends of microtubules in the peripheral cytoplasm. LOH12CR1 may function as a tumor suppressor by inhibiting tumor growth through deregulation of the G1/S checkpoint in human colorectal carcinoma. It has been shown to bind to LKB1, a well-known tumor suppressor gene in colorectal cancer; its expression level could be used as a promising biomarker in patients. This domain has also been found in many hypothetical proteins involved in loss of heterozygosity and thus tumor suppression.


Pssm-ID: 439361  Cd Length: 157  Bit Score: 148.21  E-value: 6.48e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 767971646  30 KMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAF 109
Cdd:cd22789    1 KMDDIVVVNEGTQSSRNVSNDPDLIKLQEIPTFLPLLKGSLNLPGSPDPEVLEKLDPRPLLKLCLRYQDHLRQCAEAVAF 80

                         90
                 ....*....|.
gi 767971646 110 DQNALVKRIKE 120
Cdd:cd22789   81 DQNALVKRIKE 91
LOH1CR12 pfam10158
Tumour suppressor protein; This is a region of 130 amino acids that is the most conserved ...
 61-120 2.45e-27

Tumour suppressor protein; This is a region of 130 amino acids that is the most conserved region of hypothetical proteins involved in loss of heterozygosity and thus tumour suppression. The exact function of family members is not known. This region is also found in subunit 5 of the BLOC-1-related complex, which is also found in the BORC complex. BLOC-1 is important for the biogenesis of lysosome-related organelles, and BORC is important for the positioning of the lysosome in the cytoplasm. The BORC complex associates with the lysosomal membrane where it recruits the small GTPase Arl8, which leads in turn to the kinesin-dependent movement of lysosomes toward the plus ends of microtubules in the peripheral cytoplasm.


Pssm-ID: 287167  Cd Length: 131  Bit Score: 97.58  E-value: 2.45e-27
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 767971646   61 TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE 120
Cdd:pfam10158   1 RFLPVLRGVISKRTNRTNETLEKLSSQHFINLCTRLQEHFNVCAKAVASDQNKIVARIKE 60
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH