NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1186128523|ref|NP_001337781|]
View 

ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 15 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Peptidase_C12 cd02255
Cysteine peptidase C12 contains ubiquitin carboxyl-terminal hydrolase (UCH) families L1, L3, ...
 1-99 2.68e-62

Cysteine peptidase C12 contains ubiquitin carboxyl-terminal hydrolase (UCH) families L1, L3, L5 and BAP1; The ubiquitin C-terminal hydrolase (UCH; ubiquitinyl hydrolase; ubiquitin thiolesterase) family of deubiquitinating enzymes (DUBs) consists of four members to date: UCH-L1, UCH-L3, UCH-L5 (UCH37) and BRCA1-associated protein-1 (BAP1), all containing a conserved catalytic domain with cysteine peptidase activity. UCH-L1 hydrolyzes carboxyl terminal esters and amides of ubiquitin (Ub). Dysfunction of this hydrolase activity can lead to an accumulation of alpha-synuclein, which is linked to Parkinson's disease (PD) and neurofibrillary tangles, linked to Alzheimer's disease (AD). UCH-L1, in its dimeric form, has additional enzymatic activity as a ubiquitin ligase. UCH-L3 hydrolyzes isopeptide bonds at the C-terminal glycine of either Ub or Nedd8, a ubiquitin-like protein. UCH-L3 can also interact with Lys48-linked Ub dimers to protect it from degradation while inhibiting its hydrolase activity at the same time. UCH-L1 and UCH-L3 are the most closely related of the UCH members. UCH-L5 (UCH37) is involved in the deubiquitinating activity in the 19S proteasome regulatory complex. It is also associated with the human Ino80 chromatin-remodeling complex (hINO80) in the nucleus. BAP1 binds to the wild-type BRCA1 RING finger domain, localized in the nucleus. It consists of the N-terminal UCH domain and two predicted nuclear localization signals (NLSs), only one of which is functional. The full-length human BRCA1 is a ubiquitin ligase. However, BAP1 does not appear to function in the deubiquitination of autoubiquitinated BRCA1. There is growing evidence that UCH enzymes and human malignancies are closely correlated. Studies show that UCH enzymes play a crucial role in some signaling pathways and in cell-cycle regulation.


:

Pssm-ID: 187736  Cd Length: 222  Bit Score: 192.69  E-value: 2.68e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1186128523   1 MKGLALSNSDVIRQVHNSFARQQMFEFDtktSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVI 80
Cdd:cd02255   128 ERARYLENYDAIRVTHETSAHEGQTEAP---SIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVC 204

                          90
                  ....*....|....*....
gi 1186128523  81 EKRIQKYSeGEIRFNLMAI 99
Cdd:cd02255   205 KKFMERDP-DELRFNAIAL 222
UCH_C pfam18031
Ubiquitin carboxyl-terminal hydrolases; This is the C-terminal domain found in eukaryotic ...
 139-184 2.27e-18

Ubiquitin carboxyl-terminal hydrolases; This is the C-terminal domain found in eukaryotic UCH37 proteins (also known as Ubiquitin carboxyl-terminal hydrolase isozyme L5, UCHL5). UCH37 is a subunit of two complexes: INO80, which performs ATP-dependent sliding of nucleosomes for transcriptional regulation and DNA repair, and the 26S proteasome, which performs ATP-dependent proteolysis of polyubiquitylated proteins in the cytosol and nucleus. Recruitment to the proteasome is mediated by the C-terminal domain of RPN13 (also known as ADRM1). Recruitment to INO80 is mediated by the N-terminal domain of NFRKB. Structural and biochemical analysis reveal that RPN13 and NFRKB make similar interactions with the UCH37 C-terminal domain but have very different interactions with the catalytic UCH domain that are activating in the case of RPN13 and highly inhibitory in the case of NFRKB.


:

Pssm-ID: 465622  Cd Length: 46  Bit Score: 74.54  E-value: 2.27e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 1186128523 139 VAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQL 184
Cdd:pfam18031   1 IAELQALLEEEEEKRERWKTENIRRRHNYLPFILELLKALAEEGKL 46
 
Name Accession Description Interval E-value
Peptidase_C12 cd02255
Cysteine peptidase C12 contains ubiquitin carboxyl-terminal hydrolase (UCH) families L1, L3, ...
 1-99 2.68e-62

Cysteine peptidase C12 contains ubiquitin carboxyl-terminal hydrolase (UCH) families L1, L3, L5 and BAP1; The ubiquitin C-terminal hydrolase (UCH; ubiquitinyl hydrolase; ubiquitin thiolesterase) family of deubiquitinating enzymes (DUBs) consists of four members to date: UCH-L1, UCH-L3, UCH-L5 (UCH37) and BRCA1-associated protein-1 (BAP1), all containing a conserved catalytic domain with cysteine peptidase activity. UCH-L1 hydrolyzes carboxyl terminal esters and amides of ubiquitin (Ub). Dysfunction of this hydrolase activity can lead to an accumulation of alpha-synuclein, which is linked to Parkinson's disease (PD) and neurofibrillary tangles, linked to Alzheimer's disease (AD). UCH-L1, in its dimeric form, has additional enzymatic activity as a ubiquitin ligase. UCH-L3 hydrolyzes isopeptide bonds at the C-terminal glycine of either Ub or Nedd8, a ubiquitin-like protein. UCH-L3 can also interact with Lys48-linked Ub dimers to protect it from degradation while inhibiting its hydrolase activity at the same time. UCH-L1 and UCH-L3 are the most closely related of the UCH members. UCH-L5 (UCH37) is involved in the deubiquitinating activity in the 19S proteasome regulatory complex. It is also associated with the human Ino80 chromatin-remodeling complex (hINO80) in the nucleus. BAP1 binds to the wild-type BRCA1 RING finger domain, localized in the nucleus. It consists of the N-terminal UCH domain and two predicted nuclear localization signals (NLSs), only one of which is functional. The full-length human BRCA1 is a ubiquitin ligase. However, BAP1 does not appear to function in the deubiquitination of autoubiquitinated BRCA1. There is growing evidence that UCH enzymes and human malignancies are closely correlated. Studies show that UCH enzymes play a crucial role in some signaling pathways and in cell-cycle regulation.


Pssm-ID: 187736  Cd Length: 222  Bit Score: 192.69  E-value: 2.68e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1186128523   1 MKGLALSNSDVIRQVHNSFARQQMFEFDtktSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVI 80
Cdd:cd02255   128 ERARYLENYDAIRVTHETSAHEGQTEAP---SIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVC 204

                          90
                  ....*....|....*....
gi 1186128523  81 EKRIQKYSeGEIRFNLMAI 99
Cdd:cd02255   205 KKFMERDP-DELRFNAIAL 222
Peptidase_C12 pfam01088
Ubiquitin carboxyl-terminal hydrolase, family 1;
1-85 8.41e-38

Ubiquitin carboxyl-terminal hydrolase, family 1;


Pssm-ID: 460057  Cd Length: 205  Bit Score: 129.18  E-value: 8.41e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1186128523   1 MKGLALSNSDVIRQVHNSFARQQMFEFDtktSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWI-SAVRPV 79
Cdd:pfam01088 123 ERGEALENSEELREAHNSFARQGQTEAP---SDDDDVDFHFIAFVPVDGHLYELDGLKPGPIDHGPCSDEDWLlDAVRKV 199


                  ....*.
gi 1186128523  80 IEKRIQ 85
Cdd:pfam01088 200 IQERIE 205
UCH_C pfam18031
Ubiquitin carboxyl-terminal hydrolases; This is the C-terminal domain found in eukaryotic ...
 139-184 2.27e-18

Ubiquitin carboxyl-terminal hydrolases; This is the C-terminal domain found in eukaryotic UCH37 proteins (also known as Ubiquitin carboxyl-terminal hydrolase isozyme L5, UCHL5). UCH37 is a subunit of two complexes: INO80, which performs ATP-dependent sliding of nucleosomes for transcriptional regulation and DNA repair, and the 26S proteasome, which performs ATP-dependent proteolysis of polyubiquitylated proteins in the cytosol and nucleus. Recruitment to the proteasome is mediated by the C-terminal domain of RPN13 (also known as ADRM1). Recruitment to INO80 is mediated by the N-terminal domain of NFRKB. Structural and biochemical analysis reveal that RPN13 and NFRKB make similar interactions with the UCH37 C-terminal domain but have very different interactions with the catalytic UCH domain that are activating in the case of RPN13 and highly inhibitory in the case of NFRKB.


Pssm-ID: 465622  Cd Length: 46  Bit Score: 74.54  E-value: 2.27e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 1186128523 139 VAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQL 184
Cdd:pfam18031   1 IAELQALLEEEEEKRERWKTENIRRRHNYLPFILELLKALAEEGKL 46
 
Name Accession Description Interval E-value
Peptidase_C12 cd02255
Cysteine peptidase C12 contains ubiquitin carboxyl-terminal hydrolase (UCH) families L1, L3, ...
 1-99 2.68e-62

Cysteine peptidase C12 contains ubiquitin carboxyl-terminal hydrolase (UCH) families L1, L3, L5 and BAP1; The ubiquitin C-terminal hydrolase (UCH; ubiquitinyl hydrolase; ubiquitin thiolesterase) family of deubiquitinating enzymes (DUBs) consists of four members to date: UCH-L1, UCH-L3, UCH-L5 (UCH37) and BRCA1-associated protein-1 (BAP1), all containing a conserved catalytic domain with cysteine peptidase activity. UCH-L1 hydrolyzes carboxyl terminal esters and amides of ubiquitin (Ub). Dysfunction of this hydrolase activity can lead to an accumulation of alpha-synuclein, which is linked to Parkinson's disease (PD) and neurofibrillary tangles, linked to Alzheimer's disease (AD). UCH-L1, in its dimeric form, has additional enzymatic activity as a ubiquitin ligase. UCH-L3 hydrolyzes isopeptide bonds at the C-terminal glycine of either Ub or Nedd8, a ubiquitin-like protein. UCH-L3 can also interact with Lys48-linked Ub dimers to protect it from degradation while inhibiting its hydrolase activity at the same time. UCH-L1 and UCH-L3 are the most closely related of the UCH members. UCH-L5 (UCH37) is involved in the deubiquitinating activity in the 19S proteasome regulatory complex. It is also associated with the human Ino80 chromatin-remodeling complex (hINO80) in the nucleus. BAP1 binds to the wild-type BRCA1 RING finger domain, localized in the nucleus. It consists of the N-terminal UCH domain and two predicted nuclear localization signals (NLSs), only one of which is functional. The full-length human BRCA1 is a ubiquitin ligase. However, BAP1 does not appear to function in the deubiquitination of autoubiquitinated BRCA1. There is growing evidence that UCH enzymes and human malignancies are closely correlated. Studies show that UCH enzymes play a crucial role in some signaling pathways and in cell-cycle regulation.


Pssm-ID: 187736  Cd Length: 222  Bit Score: 192.69  E-value: 2.68e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1186128523   1 MKGLALSNSDVIRQVHNSFARQQMFEFDtktSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVI 80
Cdd:cd02255   128 ERARYLENYDAIRVTHETSAHEGQTEAP---SIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVC 204

                          90
                  ....*....|....*....
gi 1186128523  81 EKRIQKYSeGEIRFNLMAI 99
Cdd:cd02255   205 KKFMERDP-DELRFNAIAL 222
Peptidase_C12_UCH37_BAP1 cd09617
Cysteine peptidase C12 containing ubiquitin carboxyl-terminal hydrolase (UCH) families UCH37 ...
 1-99 2.96e-58

Cysteine peptidase C12 containing ubiquitin carboxyl-terminal hydrolase (UCH) families UCH37 (UCH-L5) and BAP1; This ubiquitin C-terminal hydrolase (UCH) family includes UCH37 (also known as UCH-L5) and BRCA1-associated protein-1 (BAP1). They contain a UCH catalytic domain as well as an additional C-terminal extension which plays a role in protein-protein interactions. UCH37 is responsible for ubiquitin (Ub) isopeptidase activity in the 19S proteasome regulatory complex; it disassembles Lys48-linked poly-ubiquitin from the distal end of the chain. It is also associated with the human Ino80 chromatin-remodeling complex (hINO80) in the nucleus and can be activated through transient association of hINO80 with hRpn13 that is bound to the 19S regulatory particle or the proteasome. UCH37 possibly plays a role in oncogenesis; it competes with Smad ubiquitination regulatory factor 2 (Smurf2, ubiquitin ligase) in binding concurrently to Smad7 in order to deubiquitinate the activated type I transforming growth factor beta (TGF-beta) receptor, thus rescuing it from proteasomal degradation. BAP1 binds to the wild-type BRCA1 RING finger domain, localized in the nucleus. In addition to the UCH catalytic domain, BAP1 contains a UCH37-like domain (ULD), binding domains for BRCA1 and BARD1, which form a tumor suppressor heterodimeric complex, and a binding domain for HCFC1, which interacts with histone-modifying complexes during cell division. The full-length human BRCA1 is a ubiquitin ligase. However, BAP1 does not appear to function in the deubiquitination of autoubiquitinated BRCA1. BAP1 exhibits tumor suppressor activity in cancer cells, and gene mutations have been reported in a small number of breast and lung cancer samples. In metastasis of uveal melanoma, the most common primary cancer of the eye, inactivating somatic mutations have been identified in the gene encoding BAP1 on chromosome 3p21.1. These mutations include several that cause premature protein termination as well as affect its UCH domain, thus implicating loss of BAP1 and suggesting that the BAP1 pathway may be a valuable therapeutic target.


Pssm-ID: 187738  Cd Length: 219  Bit Score: 182.05  E-value: 2.96e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1186128523   1 MKGLALSNSDVIRQVHNSFARQQMFEFDTK---TSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACN-QDDWISAV 76
Cdd:cd09617   117 MKGEAIGNSEEIRKVHNSFARPEPFLLDEKlnkKATKEEDAFHFISYVPIGGRLYELDGLKEGPIDHGPCSeGEDWLEKA 196

                          90       100
                  ....*....|....*....|...
gi 1186128523  77 RPVIEKRIQKYSEGEIRFNLMAI 99
Cdd:cd09617   197 RPVIQARIARYSEGEIRFNLMAV 219
Peptidase_C12 pfam01088
Ubiquitin carboxyl-terminal hydrolase, family 1;
1-85 8.41e-38

Ubiquitin carboxyl-terminal hydrolase, family 1;


Pssm-ID: 460057  Cd Length: 205  Bit Score: 129.18  E-value: 8.41e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1186128523   1 MKGLALSNSDVIRQVHNSFARQQMFEFDtktSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWI-SAVRPV 79
Cdd:pfam01088 123 ERGEALENSEELREAHNSFARQGQTEAP---SDDDDVDFHFIAFVPVDGHLYELDGLKPGPIDHGPCSDEDWLlDAVRKV 199


                  ....*.
gi 1186128523  80 IEKRIQ 85
Cdd:pfam01088 200 IQERIE 205
Peptidase_C12_UCH_L1_L3 cd09616
Cysteine peptidase C12 containing ubiquitin carboxyl-terminal hydrolase (UCH) families L1 and ...
 6-99 1.09e-18

Cysteine peptidase C12 containing ubiquitin carboxyl-terminal hydrolase (UCH) families L1 and L3; This ubiquitin C-terminal hydrolase (UCH) family includes UCH-L1 and UCH-L3, the two members sharing around 53% sequence identity as well as conserved catalytic residues. Both enzymes hydrolyze carboxyl terminal esters and amides of ubiquitin (Ub). UCH-L1, in dimeric form, has additional enzymatic activity as a ubiquitin ligase. It is highly abundant in the brain, constituting up to 2% of total protein, and is expressed exclusively in neurons and testes. Abnormal expression of UCH-L1 has been shown to correlate with several forms of cancer, including several primary lung tumors, lung tumor cell lines, and colorectal cancers. Mutations in the UCH-L1 gene have been linked to susceptibility to and protection from Parkinson's disease (PD); dysfunction of the hydrolase activity can lead to an accumulation of alpha-synuclein, which is linked to Parkinson's disease (PD), while accumulation of neurofibrillary tangles is linked to Alzheimer's disease (AD). UCH-L3 hydrolyzes isopeptide bonds at the C-terminal glycine of either Ub or Nedd8, a ubiquitin-like protein. It can also interact with Lys48-linked Ub dimers to protect them from degradation while inhibiting its hydrolase activity at the same time. Unlike UCH-L1, neither dimerization nor ligase activity have been observed for UCH-L3. It has been shown that levels of Nedd8 and the apoptotic protein p53 and Bax are elevated in UCH-L3 knockout mice upon cryptorchid injury, possibly contributing to profound germ cell loss via apoptosis.


Pssm-ID: 187737  Cd Length: 222  Bit Score: 79.99  E-value: 1.09e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1186128523   6 LSNSDVIRQVHNSFARqqmfEFDTKT-SAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRI 84
Cdd:cd09616   133 LEKSEALEKAHAAAAT----EGQTEApSADEKVNLHFIAFVKKDGHLYELDGRKPGPINHGPTSEETLLKDAAKVCRKFI 208

                          90
                  ....*....|....*
gi 1186128523  85 QKySEGEIRFNLMAI 99
Cdd:cd09616   209 ER-EPDEIRFSAIAL 222
UCH_C pfam18031
Ubiquitin carboxyl-terminal hydrolases; This is the C-terminal domain found in eukaryotic ...
 139-184 2.27e-18

Ubiquitin carboxyl-terminal hydrolases; This is the C-terminal domain found in eukaryotic UCH37 proteins (also known as Ubiquitin carboxyl-terminal hydrolase isozyme L5, UCHL5). UCH37 is a subunit of two complexes: INO80, which performs ATP-dependent sliding of nucleosomes for transcriptional regulation and DNA repair, and the 26S proteasome, which performs ATP-dependent proteolysis of polyubiquitylated proteins in the cytosol and nucleus. Recruitment to the proteasome is mediated by the C-terminal domain of RPN13 (also known as ADRM1). Recruitment to INO80 is mediated by the N-terminal domain of NFRKB. Structural and biochemical analysis reveal that RPN13 and NFRKB make similar interactions with the UCH37 C-terminal domain but have very different interactions with the catalytic UCH domain that are activating in the case of RPN13 and highly inhibitory in the case of NFRKB.


Pssm-ID: 465622  Cd Length: 46  Bit Score: 74.54  E-value: 2.27e-18
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 1186128523 139 VAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQL 184
Cdd:pfam18031   1 IAELQALLEEEEEKRERWKTENIRRRHNYLPFILELLKALAEEGKL 46
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH