NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|61742831|ref|NP_997085|]
View 

coiled-coil domain-containing protein 120 [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CUPID super family cl13287
Cytohesin Ubiquitin Protein Inducing Domain; C1ORF106 also known as INAVA (Innate Immune ...
2-82 6.08e-29

Cytohesin Ubiquitin Protein Inducing Domain; C1ORF106 also known as INAVA (Innate Immune Activator), is identified as a risk factor for the chronic inflammatory bowel diseases (IBD). Mice lacking the protein show defects in intestinal barrier integrity at steady state and greater susceptibility to mucosal infection. INAVA carries CUPID (Cytohesin Ubiquitin Protein Inducing Domain). Three other human proteins contain CUPID: FRMD4A, FRMD4B, and CCDC120- proteins implicated in neurite outgrowth, and in human cancer, Alzheimer's, celiac, and heart disease. All appear to bind the ARF-GEF (guanine nucleotide-exchange factors) cytohesin family members, such as proteins (ARF 1-4), which regulate cell membrane and F-actin dynamics. INAVA-CUPID binds cytohesin 2 (also known as ARNO), targets the molecule to lateral membranes of epithelial monolayers, and enables ARNO to affect F-actin assembly that underlies cell-cell junctions and barrier function. In the case of inflammatory signalling, ARNO can coordinate CUPID function by binding and inhibiting CUPID activity of acting as an enhancer of TRAF6 dependent polyubiquitination. In other words, ARNO acts as a negative-regulator of inflammatory responses. In summary, INAVA-CUPID exhibits dual functions, coordinated directly by ARNO, that bridge epithelial barrier function with extracellular signals and inflammation.


The actual alignment was detected with superfamily member pfam11819:

Pssm-ID: 463360  Cd Length: 136  Bit Score: 112.02  E-value: 6.08e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61742831     2 EVKGQLISSPTFTAPAALFGEAAPLVK--SDRLRGLLDRQRALQEALSVKLQELRKVCLQEAELTGQLPPECPLEPGERP 79
Cdd:pfam11819   1 ESKGEIISSSSGSLLSSGSDSSTSSEKqkKEKTAALKKKQQALQERLELKLEELKKLCLREAELTGKLPKEYPLEPGEKP 80

                  ...
gi 61742831    80 QLV 82
Cdd:pfam11819  81 PQV 83
 
Name Accession Description Interval E-value
CUPID pfam11819
Cytohesin Ubiquitin Protein Inducing Domain; C1ORF106 also known as INAVA (Innate Immune ...
2-82 6.08e-29

Cytohesin Ubiquitin Protein Inducing Domain; C1ORF106 also known as INAVA (Innate Immune Activator), is identified as a risk factor for the chronic inflammatory bowel diseases (IBD). Mice lacking the protein show defects in intestinal barrier integrity at steady state and greater susceptibility to mucosal infection. INAVA carries CUPID (Cytohesin Ubiquitin Protein Inducing Domain). Three other human proteins contain CUPID: FRMD4A, FRMD4B, and CCDC120- proteins implicated in neurite outgrowth, and in human cancer, Alzheimer's, celiac, and heart disease. All appear to bind the ARF-GEF (guanine nucleotide-exchange factors) cytohesin family members, such as proteins (ARF 1-4), which regulate cell membrane and F-actin dynamics. INAVA-CUPID binds cytohesin 2 (also known as ARNO), targets the molecule to lateral membranes of epithelial monolayers, and enables ARNO to affect F-actin assembly that underlies cell-cell junctions and barrier function. In the case of inflammatory signalling, ARNO can coordinate CUPID function by binding and inhibiting CUPID activity of acting as an enhancer of TRAF6 dependent polyubiquitination. In other words, ARNO acts as a negative-regulator of inflammatory responses. In summary, INAVA-CUPID exhibits dual functions, coordinated directly by ARNO, that bridge epithelial barrier function with extracellular signals and inflammation.


Pssm-ID: 463360  Cd Length: 136  Bit Score: 112.02  E-value: 6.08e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61742831     2 EVKGQLISSPTFTAPAALFGEAAPLVK--SDRLRGLLDRQRALQEALSVKLQELRKVCLQEAELTGQLPPECPLEPGERP 79
Cdd:pfam11819   1 ESKGEIISSSSGSLLSSGSDSSTSSEKqkKEKTAALKKKQQALQERLELKLEELKKLCLREAELTGKLPKEYPLEPGEKP 80

                  ...
gi 61742831    80 QLV 82
Cdd:pfam11819  81 PQV 83
 
Name Accession Description Interval E-value
CUPID pfam11819
Cytohesin Ubiquitin Protein Inducing Domain; C1ORF106 also known as INAVA (Innate Immune ...
2-82 6.08e-29

Cytohesin Ubiquitin Protein Inducing Domain; C1ORF106 also known as INAVA (Innate Immune Activator), is identified as a risk factor for the chronic inflammatory bowel diseases (IBD). Mice lacking the protein show defects in intestinal barrier integrity at steady state and greater susceptibility to mucosal infection. INAVA carries CUPID (Cytohesin Ubiquitin Protein Inducing Domain). Three other human proteins contain CUPID: FRMD4A, FRMD4B, and CCDC120- proteins implicated in neurite outgrowth, and in human cancer, Alzheimer's, celiac, and heart disease. All appear to bind the ARF-GEF (guanine nucleotide-exchange factors) cytohesin family members, such as proteins (ARF 1-4), which regulate cell membrane and F-actin dynamics. INAVA-CUPID binds cytohesin 2 (also known as ARNO), targets the molecule to lateral membranes of epithelial monolayers, and enables ARNO to affect F-actin assembly that underlies cell-cell junctions and barrier function. In the case of inflammatory signalling, ARNO can coordinate CUPID function by binding and inhibiting CUPID activity of acting as an enhancer of TRAF6 dependent polyubiquitination. In other words, ARNO acts as a negative-regulator of inflammatory responses. In summary, INAVA-CUPID exhibits dual functions, coordinated directly by ARNO, that bridge epithelial barrier function with extracellular signals and inflammation.


Pssm-ID: 463360  Cd Length: 136  Bit Score: 112.02  E-value: 6.08e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 61742831     2 EVKGQLISSPTFTAPAALFGEAAPLVK--SDRLRGLLDRQRALQEALSVKLQELRKVCLQEAELTGQLPPECPLEPGERP 79
Cdd:pfam11819   1 ESKGEIISSSSGSLLSSGSDSSTSSEKqkKEKTAALKKKQQALQERLELKLEELKKLCLREAELTGKLPKEYPLEPGEKP 80

                  ...
gi 61742831    80 QLV 82
Cdd:pfam11819  81 PQV 83
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH