U.S. flag

An official website of the United States government

Release Notes For GenBank Release 134

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2003

              NCBI-GenBank Flat File Release 134.00

                    Distribution Release Notes

 23035823 loci, 29358082791 bases, from 23035823 reported sequences

  This document describes the format and content of the flat files that
comprise releases of the GenBank database. If you have any questions or
comments about GenBank or this document, please contact NCBI via email
at [email protected] or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 134.0
1.2 Cutoff Date
1.3 Important Changes in Release 134.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.2 Directory Files
     3.2.1 Short Directory File
3.3 Index Files
     3.3.1 Accession Number Index File
     3.3.2 Keyword Phrase Index File
     3.3.3 Author Name Index File
     3.3.4 Journal Citation Index File
     3.3.5 Gene Name Index
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 134.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  [email protected]

Updates and changes to existing GenBank records:

       E-MAIL:  [email protected]

URL for the new GenBank submission tool - BankIt - on the World Wide Web:

       http://www.ncbi.nlm.nih.gov/

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 134.0 is a release of sequence data by NCBI in the GenBank
flatfile format.  GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan.  The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan.  Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices.  The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions.  The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server: ftp.ncbi.nih.gov .

1.2 Cutoff Date

  This full release, 134.0, incorporates data available to the collaborating
databases as of February 10, 2003.  For more recent data, users are advised to:

  o Download the GenBank Update files by anonymous FTP to 'ftp.ncbi.nih.gov':

	ftp://ftp.ncbi.nih.gov/ncbi-asn1 (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank   (flatfile format)

    Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
    Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

    Some users who experience slow FTP transfers of large files (entire releases,
    the GenBank Cumulative Update, etc) might realize an improvement in transfer
    rates from these alternate sites when traffic at the NCBI is high.

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 134.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 10 with this release:

  - the EST division is now comprised of 240 files (+5)
  - the GSS division is now comprised of 66 files  (+3)
  - the HTC division is now comprised of 4 files   (+1)
  - the HTG division is now comprised of 58 files  (+1)

1.3.2 * * Cumulative GenBank Update Products Discontinued * *

  As of GenBank Release 134.0, the cumulative GenBank Update (GBCU)
products have been discontinued:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily/gbcu.aso.gz
	ftp://ftp.ncbi.nih.gov/genbank/daily/gbcu.flat.gz
	ftp://ftp.ncbi.nih.gov/genbank/daily/gbcu.fsa_nt.gz
	ftp://ftp.ncbi.nih.gov/genbank/daily/gbcu.gnp.gz
	ftp://ftp.ncbi.nih.gov/genbank/daily/gbcu.qscore.gz
	ftp://ftp.ncbi.nih.gov/genbank/daily/gpcu.fsa.gz

  In the eight weeks between typical GenBank Releases, it was not uncommon
for GBCU products to approach 20% of the total database size. The flatfile
version, for example, reached sizes in excess of 17 GB in late 2002.

  From a user perspective, repeatedly obtaining and processing such a
large update product makes inefficient use of both bandwidth and local
resources, compared to the much smaller incremental GbUpdate products.

  And in order to reliably generate the GBCU in the face of such explosive
growth, NCBI would have to invest significant resources to increase the 
performance of a large body of software.

  Given these factors, plus the questionable value of an "update" product,
generated daily, and approaching 20GB in size, NCBI has discontinued
support for the GBCU products.

  However, as an aid to those users who may not yet have completed 
transitioning to the use of incremental update products, GBCU files
will continue to be generated, on an _unsupported_ basis, for approximately
three more weeks. After that time, the GBCU files will be removed from
the NCBI FTP site.

1.3.3 Third-Party Annotation Data Collection

  Pursuant to agreements made at their 2002 Collaborative Meeting,
DDBJ/EMBL/GenBank have undertaken the collection of a new class of
sequence data : Third-Party Annotation (TPA).

  The TPA data-collection complements the existing DDBJ/EMBL/GenBank
comprehensive database of primary nucleotide sequences, which typically
result from direct sequencing of cDNAs, ESTs, genomic DNAs, etc.

  'Primary data' are defined to be data for which the submitting group has
done the sequencing and annotation, and hence, as owner of the data,
has privileges to update/correct the associated sequence records. In
contrast, non-primary (TPA) sequences are defined as sequences which:

  a) consist exclusively of sequence data from one, or several,
     previously-existing primary entries owned by other groups, or

  b) consist of a mixture of previously-existing primary entries,
     some owned by the TPA submittor and the rest by one or more other
     groups

  Complete details regarding TPA sequence submission can be found
at the NCBI website:

     http://www.ncbi.nlm.nih.gov/Genbank/tpa.html
  
TPA categories and requirements  
-------------------------------

  Users can submit new annotation of single sequences or assemblies
of sequences that are owned by other groups to the TPA data
collection.

  The primary sequences must be available in the DDBJ/EMBL/GenBank
databases, and submitters to the TPA database must provide the
accession numbers of the primary sequences in their TPA submission.

  TPA sequences based on primary data available only in proprietary
databases are not accepted.

  Some examples of data submissions accepted for TPA include:

     1. analysis and re-annotation of DDBJ/EMBL/GenBank sequences
        owned by other groups
     2. gap-filling, in which a TPA submittor might utilize HTG or
        EST data to complete an otherwise incomplete sequence
     3. TPA sequences based on NCBI/Ensembl trace archive data
     4. TPA sequences based on Whole Genome Shotgun (WGS) sequences

  Sequences based on primary data from multiple organisms are not
accepted.

  Sequences will not be accepted for TPA in lieu of an update to
primary records. A submittor who owns a primary record is expected
to update that record as new sequence is determined, or sequencing
ambiguities/errors are resolved.

  Any newly-determined sequence data that is to be part of a TPA
record must first be submitted as a new primary sequence to
DDBJ/EMBL/GenBank.
  
  The TPA dataset is intended to present sequence data and annotation
in support of actual biological discoveries that are published in
the scientific literature, without requiring that the sequence be
determined by the authors/submitters.
  
  In order to assure that the sequence annotation is of high quality, 
it is required that TPA records be associated with a study published
in a peer-reviewed journal before the data is released to the public.

  TPA records include a mandatory 'PRIMARY' block, which documents the
relationships between spans of the TPA sequence and the primary
(non-TPA) sequences that contributed to it. The elements of the
PRIMARY block are:
     
  a) TPA-SPAN             base span on TPA sequence  
  b) PRIMARY_IDENTIFIER   acc.version of contributing sequence(s) 
  c) PRIMARY_SPAN         base span on contributing primary sequence
  d) COMP                 'c' is used to indicate that contributing 
                          sequence is originating from complementary 
                          strand in primary sequence entry
  Example:

  TPA_SPAN       PRIMARY_IDENTIFIER     PRIMARY_SPAN     COMP
  1-426          AC004528.1             18665-19090         
  427-526        AC001234.2             1-100            c


TPA data products
-----------------

  TPA update products became available at the NCBI FTP site on Friday,
January 31, 2003. Daily, incremental update files for all new/updated
TPA records are located in:

        ftp://ftp.ncbi.nih.gov/tpa/updates

TPA updates have filename prefixes of:

        tpa_upd.YYYY.MMDD.

Filename suffixes for these updates are:

	.bbs     : binary Bioseq-set (ASN.1)
	.gbff    : GenBank flatfile
	.gnp     : GenPept flatfile
	.fsa_nt  : Nucleotide FASTA
	.fsa_aa  : Protein FASTA

  We do not expect to generate complete releases (similar to GenBank
releases) for TPA until the volume of TPA records has substantially
increased. Until that time, a set of cumulative TPA update files
containing all TPA records is available in:

        ftp://ftp.ncbi.nih.gov/tpa/release

Cumulative TPA update files have filename prefixes of:

        tpa_cu.

and utilize the same filename suffixes that are listed above. Note
that the cumulative TPA products will be *discontinued* once TPA
releases are being built.


1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in one of two different systems,
depending on their origin. One recent change to release processing involves
the parallelization of the dumps from those systems. Because the second dump
(for example) has no prior knowledge of exactly how many GSS files will be
dumped from the first, it doesn't know how to number it's own output files.

  There is thus a discrepancy between the filenames and file headers of nine
GSS flatfiles in Release 134.0. Consider the gbgss56.seq file:

GBGSS1.SEQ           Genetic Sequence Data Bank
                          February 15 2003

                NCBI-GenBank Flat File Release 134.0

                           GSS Sequences (Part 1)

   88066 loci,    66600405 bases, from    88066 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "56" based on the files dumped from the other system.

  We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.


1.4 Upcoming Changes

1.4.1 New /mol_type qualifier

  As of the April 2003 GenBank Release (134.0), a new source feature
  qualifier called /mol_type will begin to be used for source features.

  This qualifier will be used to indicate the in-vivo biological state
  of the sequence presented in a database record.

  The preliminary definition for /segment is :
        Qualifier       /mol_type=
        Definition      in vivo molecule type  
        Value format    "text"
        Example         /mol_type="genomic DNA", 

        Comment         text limited to "genomic DNA", "genomic RNA", "mRNA" (incl EST), 
                        "tRNA", "rRNA", "snoRNA", "snRNA", "scRNA", "pre-mRNA",        
                        "other RNA" (incl. synthetic), "other DNA" (incl. synthetic),
                        "unassigned DNA" (incl. unknown),"unassigned RNA" (incl. unknown)

  In-vivo molecule type information is already presented on the LOCUS
  line of the GenBank flatfile format. However, introducing /mol_type
  in the Feature Table will make the exchange of this information among
  DDBJ, EMBL, and GenBank more complete and accurate.

  NOTE: /mol_type will eventually be a mandatory qualifier for the source
  feature, probably by June 2003.

1.4.2 New /segment qualifier

  As of the April 2003 GenBank Release (134.0), a new source feature
  qualifier called /segment will begin to be used for source features.

  In the absence of a more suitable way to annotate viral segments, this 
  information had either not been included in database entries, or had been 
  annotated incorrectly (e.g. using /chromosome, /map etc). This new
  qualifier addresses that lack.

  The preliminary definition for /segment is :

        Qualifier       /segment=    
        Definition      name of viral or phage segment sequenced
        Value format    "text"
        Example         /segment="6"

1.4.3 New /locus_tag qualifier

  As of the April 2003 GenBank Release (134.0), a new source feature
  qualifier called /locus_tag will begin to be used.

  Many complete-genome sequencing projects use solely computational
  methods to predict coding regions and genes. The /locus_tag qualifier
  provides a method for identifying and tracking the results of such
  computations, without utilizing existing qualifiers such as /gene .

  These 'locus tags' are systematically assigned, and do not necessarily
  reflect gene name/symbol conventions in experimental literature. Hence
  the introduction of this new qualifier.

  The preliminary definition for /locus_tag is :

        Qualifier:      /locus_tag
        Definition:     feature tag assigned for tracking purposes 
        Value Format:   "text" (single token)
        Example:        /locus_tag="RSc0382"
                        /locus_tag="YPO0002"
        Comment:        /locus_tag can be used with any feature where /gene 
                        is valid;

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : [email protected]

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://www.ncbi.nlm.nih.gov/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.

1.6 Organization of This Document

  The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.

2.2 Files

  This GenBank flat file release consists of 464 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

1.  gbrel.txt	- Release notes (this document).
2.  gbsdr.txt 	- Short directory of the data bank.
3.  gbacc.idx 	- Index of the entries according to accession number.
4.  gbkey.idx 	- Index of the entries according to keyword phrase.
5.  gbaut1.idx 	- Index of the entries according to author, part 1.
6.  gbaut2.idx 	- Index of the entries according to author, part 2.
7.  gbaut3.idx 	- Index of the entries according to author, part 3.
8.  gbaut4.idx 	- Index of the entries according to author, part 4.
9.  gbaut5.idx 	- Index of the entries according to author, part 5.
10. gbaut6.idx 	- Index of the entries according to author, part 6.
11. gbaut7.idx 	- Index of the entries according to author, part 7.
12. gbaut8.idx 	- Index of the entries according to author, part 8.
13. gbaut9.idx 	- Index of the entries according to author, part 9.
14. gbaut10.idx - Index of the entries according to author, part 10.
15. gbaut11.idx - Index of the entries according to author, part 11.
16. gbaut12.idx - Index of the entries according to author, part 12.
17. gbaut13.idx - Index of the entries according to author, part 13.
18. gbaut14.idx - Index of the entries according to author, part 14.
19. gbaut15.idx - Index of the entries according to author, part 15.
20. gbaut16.idx - Index of the entries according to author, part 16.
21. gbaut17.idx - Index of the entries according to author, part 17.
22. gbaut18.idx - Index of the entries according to author, part 18.
23. gbaut19.idx - Index of the entries according to author, part 19.
24. gbjou.idx 	- Index of the entries according to journal citation.
25. gbgen.idx 	- Index of the entries according to gene names.
26. gbsec.idx	- Index of the entries according to secondary accession number.
27. gbpri1.seq 	- Primate sequence entries, part 1.
28. gbpri2.seq 	- Primate sequence entries, part 2.
29. gbpri3.seq 	- Primate sequence entries, part 3.
30. gbpri4.seq 	- Primate sequence entries, part 4.
31. gbpri5.seq 	- Primate sequence entries, part 5.
32. gbpri6.seq 	- Primate sequence entries, part 6.
33. gbpri7.seq 	- Primate sequence entries, part 7.
34. gbpri8.seq 	- Primate sequence entries, part 8.
35. gbpri9.seq 	- Primate sequence entries, part 9.
36. gbpri10.seq	- Primate sequence entries, part 10.
37. gbpri11.seq	- Primate sequence entries, part 11.
38. gbpri12.seq	- Primate sequence entries, part 12.
39. gbpri13.seq	- Primate sequence entries, part 13.
40. gbpri14.seq	- Primate sequence entries, part 14.
41. gbpri15.seq	- Primate sequence entries, part 15.
42. gbpri16.seq	- Primate sequence entries, part 16.
43. gbpri17.seq	- Primate sequence entries, part 17.
44. gbpri18.seq	- Primate sequence entries, part 18.
45. gbpri19.seq	- Primate sequence entries, part 19.
46. gbpri20.seq	- Primate sequence entries, part 20.
47. gbpri21.seq	- Primate sequence entries, part 21.
48. gbpri22.seq	- Primate sequence entries, part 22.
49. gbpri23.seq	- Primate sequence entries, part 23.
50. gbpri24.seq	- Primate sequence entries, part 24.
51. gbrod1.seq 	- Rodent sequence entries, part 1.
52. gbrod2.seq 	- Rodent sequence entries, part 2.
53. gbrod3.seq 	- Rodent sequence entries, part 3.
54. gbrod4.seq 	- Rodent sequence entries, part 4.
55. gbrod5.seq 	- Rodent sequence entries, part 5.
56. gbrod6.seq 	- Rodent sequence entries, part 6.
57. gbmam.seq 	- Other mammalian sequence entries.
58. gbvrt1.seq 	- Other vertebrate sequence entries, part 1.
59. gbvrt2.seq 	- Other vertebrate sequence entries, part 2.
60. gbinv1.seq 	- Invertebrate sequence entries, part 1.
61. gbinv2.seq 	- Invertebrate sequence entries, part 2.
62. gbinv3.seq 	- Invertebrate sequence entries, part 3.
63. gbinv4.seq 	- Invertebrate sequence entries, part 4.
64. gbinv5.seq 	- Invertebrate sequence entries, part 5.
65. gbpln1.seq 	- Plant sequence entries (including fungi and algae), part 1.
66. gbpln2.seq 	- Plant sequence entries (including fungi and algae), part 2.
67. gbpln3.seq 	- Plant sequence entries (including fungi and algae), part 3.
68. gbpln4.seq 	- Plant sequence entries (including fungi and algae), part 4.
69. gbpln5.seq 	- Plant sequence entries (including fungi and algae), part 5.
70. gbpln6.seq 	- Plant sequence entries (including fungi and algae), part 6.
71. gbpln7.seq 	- Plant sequence entries (including fungi and algae), part 7.
72. gbbct1.seq 	- Bacterial sequence entries, part 1.
73. gbbct2.seq 	- Bacterial sequence entries, part 2.
74. gbbct3.seq 	- Bacterial sequence entries, part 3.
75. gbbct4.seq 	- Bacterial sequence entries, part 4.
76. gbbct5.seq 	- Bacterial sequence entries, part 5.
77. gbbct6.seq 	- Bacterial sequence entries, part 6.
78. gbvrl1.seq 	- Viral sequence entries, part 1.
79. gbvrl2.seq 	- Viral sequence entries, part 2.
80. gbvrl3.seq 	- Viral sequence entries, part 3.
81. gbphg.seq 	- Phage sequence entries.
82. gbsyn.seq 	- Synthetic and chimeric sequence entries.
83. gbuna.seq 	- Unannotated sequence entries.
84. gbest1.seq  - EST (expressed sequence tag) sequence entries, part 1.
85. gbest2.seq  - EST (expressed sequence tag) sequence entries, part 2.
86. gbest3.seq  - EST (expressed sequence tag) sequence entries, part 3.
87. gbest4.seq  - EST (expressed sequence tag) sequence entries, part 4.
88. gbest5.seq  - EST (expressed sequence tag) sequence entries, part 5.
89. gbest6.seq  - EST (expressed sequence tag) sequence entries, part 6.
90. gbest7.seq  - EST (expressed sequence tag) sequence entries, part 7.
91. gbest8.seq  - EST (expressed sequence tag) sequence entries, part 8.
92. gbest9.seq  - EST (expressed sequence tag) sequence entries, part 9.
93. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
94. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
95. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
96. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
97. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
98. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
99. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
100. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
101. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
102. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
103. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
104. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
105. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
106. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
107. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
108. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
109. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
110. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
111. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
112. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
113. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
114. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
115. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
116. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
117. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
118. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
119. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
120. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
121. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
122. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
123. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
124. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
125. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
126. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
127. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
128. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
129. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
130. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
131. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
132. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
133. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
134. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
135. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
136. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
137. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
138. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
139. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
140. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
141. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
142. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
143. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
144. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
145. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
146. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
147. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
148. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
149. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
150. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
151. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
152. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
153. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
154. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
155. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
156. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
157. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
158. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
159. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
160. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
161. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
162. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
163. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
164. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
165. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
166. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
167. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
168. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
169. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
170. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
171. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
172. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89
173. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
174. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
175. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
176. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
177. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
178. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
179. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
180. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
181. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
182. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
183. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
184. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
185. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
186. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
187. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
188. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
189. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
190. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
191. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
192. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
193. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
194. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
195. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
196. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
197. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
198. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
199. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
200. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
201. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
202. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
203. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
204. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
205. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
206. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
207. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
208. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
209. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
210. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
211. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
212. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
213. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
214. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
215. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
216. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
217. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
218. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
219. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
220. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
221. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
222. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
223. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
224. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
225. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
226. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
227. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
228. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
229. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
230. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
231. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
232. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
233. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
234. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
235. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
236. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
237. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
238. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
239. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
240. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
241. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
242. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
243. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
244. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
245. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
246. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
247. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
248. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
249. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
250. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
251. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
252. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
253. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
254. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
255. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
256. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
257. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
258. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
259. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
260. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
261. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
262. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
263. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
264. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
265. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
266. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
267. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
268. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
269. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
270. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
271. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
272. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
273. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
274. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
275. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
276. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
277. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
278. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
279. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
280. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
281. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
282. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
283. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
284. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
285. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
286. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
287. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
288. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
289. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
290. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
291. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
292. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
293. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
294. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
295. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
296. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
297. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
298. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
299. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
300. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
301. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
302. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
303. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
304. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
305. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
306. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
307. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
308. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
309. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
310. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
311. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
312. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
313. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
314. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
315. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
316. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
317. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
318. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
319. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
320. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
321. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
322. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
323. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
324. gbpat1.seq  - Patent sequence entries, part 1.
325. gbpat2.seq  - Patent sequence entries, part 2.
326. gbpat3.seq  - Patent sequence entries, part 3.
327. gbpat4.seq  - Patent sequence entries, part 4.
328. gbpat5.seq  - Patent sequence entries, part 5.
329. gbpat6.seq  - Patent sequence entries, part 6.
330. gbpat7.seq  - Patent sequence entries, part 7.
331. gbsts1.seq  - STS (sequence tagged site) sequence entries, part 1.
332. gbsts2.seq  - STS (sequence tagged site) sequence entries, part 2.
333. gbgss1.seq  - GSS (genome survey sequence) sequence entries, part 1.
334. gbgss2.seq  - GSS (genome survey sequence) sequence entries, part 2.
335. gbgss3.seq  - GSS (genome survey sequence) sequence entries, part 3.
336. gbgss4.seq  - GSS (genome survey sequence) sequence entries, part 4.
337. gbgss5.seq  - GSS (genome survey sequence) sequence entries, part 5.
338. gbgss6.seq  - GSS (genome survey sequence) sequence entries, part 6.
339. gbgss7.seq  - GSS (genome survey sequence) sequence entries, part 7.
340. gbgss8.seq  - GSS (genome survey sequence) sequence entries, part 8.
341. gbgss9.seq  - GSS (genome survey sequence) sequence entries, part 9.
342. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
343. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
344. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
345. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
346. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
347. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
348. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
349. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
350. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
351. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
352. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
353. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
354. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
355. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
356. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
357. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
358. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
359. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
360. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
361. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
362. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
363. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
364. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
365. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
366. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
367. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
368. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
369. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
370. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
371. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
372. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
373. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
374. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
375. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
376. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
377. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
378. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
379. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
380. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
381. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
382. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
383. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
384. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
385. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
386. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
387. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
388. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
389. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
390. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
391. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
392. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
393. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
394. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
395. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
396. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
397. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
398. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
399. gbhtg1.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 1.
400. gbhtg2.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 2.
401. gbhtg3.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 3.
402. gbhtg4.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 4.
403. gbhtg5.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 5.
404. gbhtg6.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 6.
405. gbhtg7.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 7.
406. gbhtg8.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 8.
407. gbhtg9.seq  - HTGS (high throughput genomic sequencing) sequence entries, part 9.
408. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
409. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
410. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
411. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
412. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
413. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
414. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
415. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
416. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
417. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
418. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
419. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
420. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
421. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
422. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
423. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
424. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
425. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
426. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
427. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
428. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
429. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
430. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
431. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
432. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
433. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
434. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
435. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
436. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
437. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
438. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
439. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
440. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
441. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
442. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
443. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
444. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
445. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
446. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
447. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
448. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
449. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
450. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
451. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
452. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
453. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
454. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
455. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
456. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
457. gbhtc1.seq	 - HTC (high throughput cDNA sequencing) entries, part 1.
458. gbhtc2.seq	 - HTC (high throughput cDNA sequencing) entries, part 2.
459. gbhtc3.seq	 - HTC (high throughput cDNA sequencing) entries, part 3.
460. gbhtc4.seq	 - HTC (high throughput cDNA sequencing) entries, part 4.
461. gbcon.seq	 - CON division entries (see description below for details)
462. gbchg.txt   - Accession numbers of entries updated since the previous release.
463. gbdel.txt   - Accession numbers of entries deleted since the previous release.
464. gbnew.txt   - Accession numbers of entries new since the previous release.

  The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The GenBank README
describes the CON division of GenBank in more detail:

	ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 134.0 flatfiles require roughly 96.94 GB (sequence
files only) or 109.9 GB (including the 'short directory' and 'index' files).
The following table contains the approximate sizes of the individual files in
this release.  Since minor changes to some of the files might have occurred
after these release notes were written, these sizes should not be used to
determine file integrity; they are provided as an aid to planning only.

File Size      File Name

 752778260     gbacc.idx
 511319704     gbaut1.idx
 502206726     gbaut10.idx
 510248187     gbaut11.idx
 501835240     gbaut12.idx
 539669774     gbaut13.idx
 500740540     gbaut14.idx
 500200864     gbaut15.idx
 500000039     gbaut16.idx
 500796320     gbaut17.idx
 503158225     gbaut18.idx
 109750504     gbaut19.idx
 501032975     gbaut2.idx
 500547672     gbaut3.idx
 509831367     gbaut4.idx
 504871464     gbaut5.idx
 513257418     gbaut6.idx
 501968039     gbaut7.idx
 504489136     gbaut8.idx
 502431857     gbaut9.idx
 250016378     gbbct1.seq
 250544418     gbbct2.seq
 250001019     gbbct3.seq
 250044533     gbbct4.seq
 250003289     gbbct5.seq
 172441091     gbbct6.seq
    963470     gbchg.txt
  15835720     gbcon.seq
      1295     gbdel.txt
 230687980     gbest1.seq
 230689155     gbest10.seq
 230687721     gbest100.seq
 230689819     gbest101.seq
 230688449     gbest102.seq
 230690349     gbest103.seq
 230688558     gbest104.seq
 230687889     gbest105.seq
 230689745     gbest106.seq
 230688633     gbest107.seq
 230690076     gbest108.seq
 230689840     gbest109.seq
 230687882     gbest11.seq
 230688485     gbest110.seq
 230688454     gbest111.seq
 230689471     gbest112.seq
 230690089     gbest113.seq
 230690256     gbest114.seq
 230690843     gbest115.seq
 230689893     gbest116.seq
 230690897     gbest117.seq
 230689334     gbest118.seq
 230688844     gbest119.seq
 230689763     gbest12.seq
 230690064     gbest120.seq
 230689939     gbest121.seq
 230687728     gbest122.seq
 230687876     gbest123.seq
 230689795     gbest124.seq
 230689991     gbest125.seq
 230690019     gbest126.seq
 230689886     gbest127.seq
 230688141     gbest128.seq
 230690114     gbest129.seq
 230687861     gbest13.seq
 230690316     gbest130.seq
 230687813     gbest131.seq
 230688072     gbest132.seq
 230687831     gbest133.seq
 230690599     gbest134.seq
 230689121     gbest135.seq
 230688954     gbest136.seq
 230689572     gbest137.seq
 230690193     gbest138.seq
 230689459     gbest139.seq
 230687494     gbest14.seq
 230689104     gbest140.seq
 230687639     gbest141.seq
 230690212     gbest142.seq
 230690497     gbest143.seq
 230690190     gbest144.seq
 230690128     gbest145.seq
 230692458     gbest146.seq
 230688249     gbest147.seq
 230695599     gbest148.seq
 230689488     gbest149.seq
 230690031     gbest15.seq
 230687752     gbest150.seq
 230689038     gbest151.seq
 230688956     gbest152.seq
 230687519     gbest153.seq
 230688469     gbest154.seq
 230688567     gbest155.seq
 230689842     gbest156.seq
 230687967     gbest157.seq
 230689917     gbest158.seq
 230688865     gbest159.seq
 230687497     gbest16.seq
 230690698     gbest160.seq
 230688660     gbest161.seq
 230688383     gbest162.seq
 230689185     gbest163.seq
 230689153     gbest164.seq
 230690271     gbest165.seq
 230690390     gbest166.seq
 230687497     gbest167.seq
 230689892     gbest168.seq
 230689826     gbest169.seq
 230687810     gbest17.seq
 230687923     gbest170.seq
 230689160     gbest171.seq
 230687610     gbest172.seq
 230689915     gbest173.seq
 230690148     gbest174.seq
 230688997     gbest175.seq
 230687679     gbest176.seq
 230688656     gbest177.seq
 230687848     gbest178.seq
 230690115     gbest179.seq
 230689465     gbest18.seq
 230688417     gbest180.seq
 230687574     gbest181.seq
 230691269     gbest182.seq
 230689517     gbest183.seq
 230689147     gbest184.seq
 230688849     gbest185.seq
 230688949     gbest186.seq
 230688181     gbest187.seq
 230688457     gbest188.seq
 230687555     gbest189.seq
 230687586     gbest19.seq
 164781018     gbest190.seq
 163613105     gbest191.seq
 170107774     gbest192.seq
 171141431     gbest193.seq
 171673663     gbest194.seq
 168051469     gbest195.seq
 166767927     gbest196.seq
 166792690     gbest197.seq
 168614758     gbest198.seq
 168071701     gbest199.seq
 230690391     gbest2.seq
 230688400     gbest20.seq
 167506849     gbest200.seq
 174472980     gbest201.seq
 164556570     gbest202.seq
 173058019     gbest203.seq
 164246785     gbest204.seq
 166554093     gbest205.seq
 171247032     gbest206.seq
 172497208     gbest207.seq
 169263846     gbest208.seq
 167118136     gbest209.seq
 230690082     gbest21.seq
 167523261     gbest210.seq
 168936991     gbest211.seq
 168369810     gbest212.seq
 167840298     gbest213.seq
 167200902     gbest214.seq
 179558169     gbest215.seq
 182448467     gbest216.seq
 176388678     gbest217.seq
 206922937     gbest218.seq
 230687849     gbest219.seq
 230687787     gbest22.seq
 230687901     gbest220.seq
 230687816     gbest221.seq
 230690273     gbest222.seq
 230690682     gbest223.seq
 230687881     gbest224.seq
 230688567     gbest225.seq
 230688843     gbest226.seq
 230687513     gbest227.seq
 230689255     gbest228.seq
 230689136     gbest229.seq
 230689003     gbest23.seq
 230690346     gbest230.seq
 230689039     gbest231.seq
 230688608     gbest232.seq
 230687879     gbest233.seq
 230690182     gbest234.seq
 230690601     gbest235.seq
 230688451     gbest236.seq
 230688943     gbest237.seq
 230688185     gbest238.seq
 230689196     gbest239.seq
 230689742     gbest24.seq
  63838045     gbest240.seq
 230689744     gbest25.seq
 230689223     gbest26.seq
 230689439     gbest27.seq
 230689937     gbest28.seq
 230688421     gbest29.seq
 230688556     gbest3.seq
 230687475     gbest30.seq
 230688436     gbest31.seq
 230689587     gbest32.seq
 230688990     gbest33.seq
 230689257     gbest34.seq
 230688862     gbest35.seq
 211918835     gbest36.seq
 210096283     gbest37.seq
 210229122     gbest38.seq
 218219361     gbest39.seq
 230689876     gbest4.seq
 216563192     gbest40.seq
 216303129     gbest41.seq
 217288708     gbest42.seq
 230687774     gbest43.seq
 230689557     gbest44.seq
 222885965     gbest45.seq
 230689600     gbest46.seq
 230687926     gbest47.seq
 230687556     gbest48.seq
 230690151     gbest49.seq
 165267638     gbest5.seq
 230688419     gbest50.seq
 230687804     gbest51.seq
 230688898     gbest52.seq
 230689765     gbest53.seq
 230689305     gbest54.seq
 230691429     gbest55.seq
 230688469     gbest56.seq
 230689628     gbest57.seq
 230690059     gbest58.seq
 230689012     gbest59.seq
 180014575     gbest6.seq
 230690076     gbest60.seq
 230690646     gbest61.seq
 209803127     gbest62.seq
 209415333     gbest63.seq
 208947707     gbest64.seq
 209157310     gbest65.seq
 210507566     gbest66.seq
 209989846     gbest67.seq
 208816674     gbest68.seq
 209406174     gbest69.seq
 230687546     gbest7.seq
 210709936     gbest70.seq
 206665409     gbest71.seq
 206710780     gbest72.seq
 208314262     gbest73.seq
 208775985     gbest74.seq
 215237400     gbest75.seq
 230688893     gbest76.seq
 230692583     gbest77.seq
 230687964     gbest78.seq
 227811960     gbest79.seq
 230689635     gbest8.seq
 217571732     gbest80.seq
 218884614     gbest81.seq
 230687862     gbest82.seq
 230689025     gbest83.seq
 230688697     gbest84.seq
 230689314     gbest85.seq
 230687442     gbest86.seq
 230687590     gbest87.seq
 230689547     gbest88.seq
 230688182     gbest89.seq
 230687830     gbest9.seq
 230688079     gbest90.seq
 230690471     gbest91.seq
 230687806     gbest92.seq
 230687550     gbest93.seq
 230688625     gbest94.seq
 230689637     gbest95.seq
 230690255     gbest96.seq
 230688988     gbest97.seq
 230687907     gbest98.seq
 230687908     gbest99.seq
  28682388     gbgen.idx
 209716254     gbgss1.seq
 209717589     gbgss10.seq
 209718595     gbgss11.seq
 209719710     gbgss12.seq
 209715944     gbgss13.seq
 209717038     gbgss14.seq
 209718117     gbgss15.seq
 209716851     gbgss16.seq
 209717045     gbgss17.seq
 209717604     gbgss18.seq
 209719433     gbgss19.seq
 209717078     gbgss2.seq
 209719917     gbgss20.seq
 209716862     gbgss21.seq
 209718463     gbgss22.seq
 209718439     gbgss23.seq
 209717920     gbgss24.seq
 209717859     gbgss25.seq
 209717202     gbgss26.seq
 209716127     gbgss27.seq
 209717394     gbgss28.seq
 209716474     gbgss29.seq
 209716137     gbgss3.seq
 209719025     gbgss30.seq
 209718092     gbgss31.seq
 209716521     gbgss32.seq
 209717432     gbgss33.seq
 209719210     gbgss34.seq
 209715925     gbgss35.seq
 209716526     gbgss36.seq
 209717810     gbgss37.seq
 209717857     gbgss38.seq
 209716182     gbgss39.seq
 209717320     gbgss4.seq
 209717521     gbgss40.seq
 209716461     gbgss41.seq
 209716670     gbgss42.seq
 209716470     gbgss43.seq
 209716240     gbgss44.seq
 209716257     gbgss45.seq
 209718718     gbgss46.seq
 209718733     gbgss47.seq
 209718931     gbgss48.seq
 209716269     gbgss49.seq
 209718666     gbgss5.seq
 209717902     gbgss50.seq
 209717454     gbgss51.seq
 209718302     gbgss52.seq
 209717500     gbgss53.seq
 209716951     gbgss54.seq
  26626545     gbgss55.seq
 250002169     gbgss56.seq
 250001674     gbgss57.seq
 250000313     gbgss58.seq
 250000916     gbgss59.seq
 209717526     gbgss6.seq
 250002584     gbgss60.seq
 250000696     gbgss61.seq
 250003210     gbgss62.seq
 250003827     gbgss63.seq
 250001562     gbgss64.seq
 250000355     gbgss65.seq
  28151696     gbgss66.seq
 209718159     gbgss7.seq
 209717588     gbgss8.seq
 209717682     gbgss9.seq
 250001113     gbhtc1.seq
 250009741     gbhtc2.seq
 250001826     gbhtc3.seq
  62469810     gbhtc4.seq
 250166277     gbhtg1.seq
 250040218     gbhtg10.seq
 250059638     gbhtg11.seq
 250065699     gbhtg12.seq
 250311384     gbhtg13.seq
 250265867     gbhtg14.seq
 250017983     gbhtg15.seq
 250157096     gbhtg16.seq
 250179996     gbhtg17.seq
 250220124     gbhtg18.seq
 250211360     gbhtg19.seq
 250020817     gbhtg2.seq
 250136167     gbhtg20.seq
 250003080     gbhtg21.seq
 250089285     gbhtg22.seq
 250137084     gbhtg23.seq
 250116184     gbhtg24.seq
 250159644     gbhtg25.seq
 250198659     gbhtg26.seq
 250064034     gbhtg27.seq
 250118742     gbhtg28.seq
 250003306     gbhtg29.seq
 250023801     gbhtg3.seq
 250015429     gbhtg30.seq
 250204810     gbhtg31.seq
 250152084     gbhtg32.seq
 250121490     gbhtg33.seq
 250211359     gbhtg34.seq
 250080977     gbhtg35.seq
 250128302     gbhtg36.seq
 250031737     gbhtg37.seq
 250157633     gbhtg38.seq
 250051952     gbhtg39.seq
 250071851     gbhtg4.seq
 250186700     gbhtg40.seq
 250108856     gbhtg41.seq
 250146703     gbhtg42.seq
 250020209     gbhtg43.seq
 250151566     gbhtg44.seq
 250033624     gbhtg45.seq
 250001237     gbhtg46.seq
 250195881     gbhtg47.seq
 250061916     gbhtg48.seq
 250193247     gbhtg49.seq
 250051812     gbhtg5.seq
 250087020     gbhtg50.seq
 250134935     gbhtg51.seq
 250301662     gbhtg52.seq
 250120329     gbhtg53.seq
 250133960     gbhtg54.seq
 250001087     gbhtg55.seq
 250203578     gbhtg56.seq
 250026792     gbhtg57.seq
 105485966     gbhtg58.seq
 250140012     gbhtg6.seq
 250145316     gbhtg7.seq
 250224008     gbhtg8.seq
 250089154     gbhtg9.seq
 250203058     gbinv1.seq
 250258702     gbinv2.seq
 250002585     gbinv3.seq
 250001510     gbinv4.seq
 236608334     gbinv5.seq
 574068517     gbjou.idx
 518672747     gbkey.idx
 156293247     gbmam.seq
  10934659     gbnew.txt
 250000176     gbpat1.seq
 250000357     gbpat2.seq
 250003952     gbpat3.seq
 250001434     gbpat4.seq
 250001403     gbpat5.seq
 250001068     gbpat6.seq
 117579348     gbpat7.seq
  19752438     gbphg.seq
 250119611     gbpln1.seq
 250001777     gbpln2.seq
 250111708     gbpln3.seq
 250000524     gbpln4.seq
 250006521     gbpln5.seq
 250004819     gbpln6.seq
 105739472     gbpln7.seq
 250158230     gbpri1.seq
 250211773     gbpri10.seq
 250021017     gbpri11.seq
 250065672     gbpri12.seq
 250131590     gbpri13.seq
 250055442     gbpri14.seq
 250108617     gbpri15.seq
 250004454     gbpri16.seq
 250198702     gbpri17.seq
 250091522     gbpri18.seq
 250008945     gbpri19.seq
 250272932     gbpri2.seq
 250006628     gbpri20.seq
 250077504     gbpri21.seq
 250001677     gbpri22.seq
 250003623     gbpri23.seq
 216554044     gbpri24.seq
 250073925     gbpri3.seq
 250040487     gbpri4.seq
 250097062     gbpri5.seq
 250206824     gbpri6.seq
 250147743     gbpri7.seq
 250253208     gbpri8.seq
 250127455     gbpri9.seq
    147019     gbrel.txt
 250232095     gbrod1.seq
 250282691     gbrod2.seq
 250010883     gbrod3.seq
 250138500     gbrod4.seq
 250000599     gbrod5.seq
 212706412     gbrod6.seq
1842894815     gbsdr.txt
   1464542     gbsec.idx
 250002792     gbsts1.seq
 178489112     gbsts2.seq
  34957380     gbsyn.seq
   1415158     gbuna.seq
 250001150     gbvrl1.seq
 250000242     gbvrl2.seq
  99169886     gbvrl3.seq
 250000457     gbvrt1.seq
 167073400     gbvrt2.seq

2.2.6 Per-Division Statistics 

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each sequence
data file:

Division     Entries    Bases

BCT1         21596      102382590
BCT2         7637       107498513
BCT3         62327      89871050
BCT4         11766      108452239
BCT5         45195      92850148
BCT6         28088      63145689
EST1         68333      26365039
EST10        76745      29941526
EST100       72091      33383881
EST101       70046      29552935
EST102       66749      37956190
EST103       69054      36788216
EST104       68321      43630907
EST105       73315      33973380
EST106       75525      34886994
EST107       74805      27322217
EST108       73926      35813057
EST109       74256      35289236
EST11        75365      28764290
EST110       69091      42159211
EST111       80755      44425121
EST112       77294      45980900
EST113       69518      44319636
EST114       67239      42405939
EST115       74641      50169030
EST116       69941      42589101
EST117       75925      44389642
EST118       73376      46257369
EST119       71976      47752614
EST12        77514      30859409
EST120       73715      50885304
EST121       79158      40284160
EST122       76141      30926872
EST123       79104      39779856
EST124       77834      43170893
EST125       76990      47231058
EST126       61053      28213275
EST127       75012      41644508
EST128       68132      37651074
EST129       67978      38441910
EST13        77206      29188394
EST130       71206      42693674
EST131       73716      47895854
EST132       66695      38302641
EST133       73504      41889065
EST134       68879      39984693
EST135       61359      37999883
EST136       87052      47272289
EST137       93662      52993914
EST138       72211      38139587
EST139       72896      38526533
EST14        78694      31971652
EST140       94790      50686280
EST141       104189     56553052
EST142       94295      54243712
EST143       69942      40515459
EST144       66450      32342609
EST145       62677      29468947
EST146       57857      30279713
EST147       62896      31166732
EST148       54315      27366151
EST149       79905      53557138
EST15        73849      31229292
EST150       69056      37446461
EST151       72567      52843161
EST152       72021      40944718
EST153       61117      30604490
EST154       64718      39698762
EST155       68125      31299642
EST156       63958      46388103
EST157       67714      39062050
EST158       72456      40775101
EST159       68487      43325892
EST16        75558      33227263
EST160       63893      36771203
EST161       64843      42431665
EST162       68202      30922910
EST163       76230      31533585
EST164       70984      44722079
EST165       79310      39589408
EST166       63374      32891005
EST167       69682      49738763
EST168       69780      46803835
EST169       68110      36039891
EST17        83275      34240426
EST170       69516      44810075
EST171       69297      53342332
EST172       69804      35627348
EST173       70350      42572831
EST174       70724      61206192
EST175       64790      47188787
EST176       63898      46695358
EST177       63492      47023620
EST178       65512      45433821
EST179       66212      49918442
EST18        80511      32258104
EST180       62652      42390975
EST181       65878      39763283
EST182       60172      33661393
EST183       70167      36048163
EST184       85333      55661323
EST185       70103      42964356
EST186       99830      62077654
EST187       106706     65773194
EST188       108425     63552711
EST189       69279      39506530
EST19        78864      32347888
EST190       27688      10426656
EST191       27783      10421097
EST192       26692      9794392
EST193       26516      9509862
EST194       26472      9058418
EST195       26920      9917349
EST196       27068      9643815
EST197       26974      9801870
EST198       26671      10906971
EST199       26673      11549987
EST2         75036      28805559
EST20        74340      30151689
EST200       26807      10792216
EST201       25790      9213063
EST202       27547      9139114
EST203       26198      9475977
EST204       27637      11102666
EST205       27303      10851705
EST206       26486      11162627
EST207       25981      11725501
EST208       26608      11012523
EST209       26961      10839441
EST21        73739      34280583
EST210       26795      11612294
EST211       26675      11333740
EST212       26710      10750091
EST213       26778      10654718
EST214       26988      10411701
EST215       24864      9929026
EST216       24292      17026213
EST217       25261      16816001
EST218       66997      27771375
EST219       88744      40110585
EST22        75845      30425552
EST220       71628      42281502
EST221       77480      44957830
EST222       64694      48034759
EST223       64981      34165960
EST224       76344      38854440
EST225       101483     46623660
EST226       75181      42852392
EST227       63797      32783663
EST228       69522      33559149
EST229       69398      45390115
EST23        77247      32327528
EST230       74013      34232012
EST231       70547      37559160
EST232       92282      46780543
EST233       81455      26846102
EST234       71787      25592065
EST235       73647      27272289
EST236       72862      26519614
EST237       79946      27011984
EST238       73020      27196776
EST239       68402      29214016
EST24        75422      33725400
EST240       25466      8016006
EST25        72329      30722559
EST26        76170      31657442
EST27        76250      33173322
EST28        103680     49681700
EST29        70673      45967463
EST3         73894      29981502
EST30        82233      56312778
EST31        91496      50535789
EST32        97347      50088408
EST33        93534      43876718
EST34        94430      48994090
EST35        100729     45229106
EST36        60920      18153612
EST37        59611      15726287
EST38        59301      15883678
EST39        61114      18734645
EST4         74402      28251763
EST40        43551      11917409
EST41        43169      11871537
EST42        43063      11394655
EST43        82290      34167381
EST44        95405      43437722
EST45        90300      46964577
EST46        84816      39937416
EST47        106902     56271519
EST48        94185      45730195
EST49        76130      32718551
EST5         48500      15380287
EST50        68317      29978139
EST51        71648      31147562
EST52        71565      30118836
EST53        83444      33525785
EST54        74057      29370327
EST55        65720      28099618
EST56        70407      31151888
EST57        76839      36591042
EST58        73322      32098325
EST59        75267      27424427
EST6         55669      17851521
EST60        79405      30098220
EST61        74839      33439059
EST62        40227      11416519
EST63        40191      11258966
EST64        40319      12688158
EST65        40626      12283415
EST66        40604      12464144
EST67        40505      12929203
EST68        40520      12563868
EST69        40367      12126458
EST7         74567      29348606
EST70        40331      12317611
EST71        41163      12341935
EST72        41325      12273556
EST73        41216      13124332
EST74        41022      13053286
EST75        43542      12505456
EST76        43634      19772789
EST77        40480      24759217
EST78        42787      18619549
EST79        44493      18386759
EST8         76202      30681145
EST80        49531      21425585
EST81        48971      21001837
EST82        69260      31626982
EST83        72405      27420367
EST84        74792      29457197
EST85        75198      41099137
EST86        78248      41014424
EST87        77082      44137921
EST88        76818      35286142
EST89        74838      43327515
EST9         77738      29969805
EST90        71785      36653552
EST91        74132      37694314
EST92        73459      39466397
EST93        75062      41180069
EST94        70521      40619301
EST95        69163      36296812
EST96        73439      36228415
EST97        72925      46685730
EST98        72602      44775379
EST99        71109      42399662
GSS1         83277      35678570
GSS10        66627      34169864
GSS11        68874      40613310
GSS12        62893      31916167
GSS13        65571      34558357
GSS14        69182      36063181
GSS15        65564      29704457
GSS16        64460      29761099
GSS17        71537      41723025
GSS18        65569      33908077
GSS19        60267      27422241
GSS2         83479      35629718
GSS20        52122      27247000
GSS21        52559      26105819
GSS22        53719      23106465
GSS23        57863      33348274
GSS24        58834      30408244
GSS25        52941      25074060
GSS26        60530      39572406
GSS27        64379      27386881
GSS28        54061      22151504
GSS29        55469      27563344
GSS3         81440      38312461
GSS30        66678      31551318
GSS31        55432      31939649
GSS32        85551      38109588
GSS33        69653      36857703
GSS34        67999      38917765
GSS35        64905      41679289
GSS36        73292      35912844
GSS37        70018      37054191
GSS38        71518      37988347
GSS39        85904      56293897
GSS4         74354      38120527
GSS40        85999      57119377
GSS41        80919      41988671
GSS42        84543      50795470
GSS43        79147      35163980
GSS44        76355      28872698
GSS45        74344      48261969
GSS46        74153      52331049
GSS47        69190      48236998
GSS48        66240      43918343
GSS49        66370      43660144
GSS5         71183      38065917
GSS50        72632      40119666
GSS51        72987      37282206
GSS52        82155      58968866
GSS53        79057      65449459
GSS54        81128      42064522
GSS55        11467      6637717
GSS56        88066      66600405
GSS57        84358      63376716
GSS58        95585      37385508
GSS59        107660     68662815
GSS6         70635      35406886
GSS60        89142      67468980
GSS61        72987      60702708
GSS62        69797      58861587
GSS63        67185      63891159
GSS64        73290      54303215
GSS65        109275     52299560
GSS66        10980      4826244
GSS7         70944      35613122
GSS8         71353      36474681
GSS9         68975      34298875
HTC1         27633      44429991
HTC2         25937      58768399
HTC3         68998      74245658
HTC4         27793      19656473
HTG1         1329       190717330
HTG10        1200       189698968
HTG11        1507       186574501
HTG12        1003       192124798
HTG13        720        192731548
HTG14        740        192717246
HTG15        724        192428665
HTG16        799        192527990
HTG17        738        192651498
HTG18        770        192705317
HTG19        2119       178479622
HTG2         2239       188311891
HTG20        1153       188158512
HTG21        1097       189410175
HTG22        1018       190184475
HTG23        755        192449665
HTG24        943        190776185
HTG25        950        190872047
HTG26        926        191128210
HTG27        839        191546058
HTG28        774        192395396
HTG29        959        190721219
HTG3         2620       187786744
HTG30        874        191414878
HTG31        972        190868393
HTG32        1077       189405112
HTG33        1028       190051061
HTG34        1000       190698444
HTG35        1064       189718916
HTG36        968        190707407
HTG37        929        192293110
HTG38        1077       190346287
HTG39        980        191512320
HTG4         2704       189971284
HTG40        913        191865370
HTG41        872        192399574
HTG42        839        192028035
HTG43        901        191667960
HTG44        977        191092458
HTG45        968        191402643
HTG46        932        192037142
HTG47        1049       190713435
HTG48        1084       190580657
HTG49        1213       189643456
HTG5         1292       188380727
HTG50        1125       190370249
HTG51        1523       188441264
HTG52        1263       190360112
HTG53        1047       193686190
HTG54        1028       194141110
HTG55        1300       191028344
HTG56        1218       194453010
HTG57        1145       193497698
HTG58        467        77559044
HTG6         1295       187780865
HTG7         1249       188336389
HTG8         1258       188261569
HTG9         1234       189002604
INV1         9113       174900882
INV2         1886       165889064
INV3         63142      87722789
INV4         45533      99519883
INV5         36919      103826683
MAM          46170      53195994
PAT1         222820     70209374
PAT2         165449     90181131
PAT3         146501     88567863
PAT4         115891     113659130
PAT5         133175     63219683
PAT6         104113     63511092
PAT7         94177      28685881
PHG          2285       7507502
PLN1         19523      140326561
PLN2         69366      91012321
PLN3         49338      108579623
PLN4         29546      122097380
PLN5         58596      73270629
PLN6         47807      108998458
PLN7         17751      43296091
PRI1         13782      155383696
PRI10        1355       173256797
PRI11        1282       175137046
PRI12        1533       176880153
PRI13        1675       177512103
PRI14        36676      129564937
PRI15        30205      128655916
PRI16        1597       178943536
PRI17        1687       181243420
PRI18        2043       183956468
PRI19        1824       186951052
PRI2         1426       173925402
PRI20        26010      136319482
PRI21        17642      159689390
PRI22        30530      135979695
PRI23        36936      127431012
PRI24        52467      83806655
PRI3         1257       182406861
PRI4         1272       177319431
PRI5         1141       173960155
PRI6         1232       180452855
PRI7         1194       175682057
PRI8         1316       168306679
PRI9         1258       178258634
ROD1         6817       179730503
ROD2         14770      171567007
ROD3         9732       179505778
ROD4         1195       194116640
ROD5         13779      168310418
ROD6         51202      76540923
STS1         90167      35759094
STS2         68025      31306797
SYN          7886       14140118
UNA          616        329869
VRL1         73945      63915414
VRL2         77206      62782524
VRL3         25888      31224257
VRT1         57593      100563517
VRT2         39479      66856880


2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 134.0 (chloroplast and mitochon-
drial sequences not included):

Entries      Bases   Species

6505879 9571083260   Homo sapiens
4809688 5485813183   Mus musculus
659541  5402127949   Rattus norvegicus
346582   692395973   Drosophila melanogaster
464804   618698048   Danio rerio
170783   584093798   Oryza sativa (japonica cultivar-group)
567860   386351030   Brassica oleracea
466368   380958842   Arabidopsis thaliana
404230   301845630   Gallus gallus
499186   294088818   Ciona intestinalis
516762   262846445   Zea mays
199202   221942726   Caenorhabditis elegans
418033   207360111   Triticum aestivum
161076   171073629   Pan troglodytes
189153   170383328   Tetraodon nigroviridis
263124   157037944   Xenopus laevis
282042   156157876   Hordeum vulgare subsp. vulgare
320222   149834937   Glycine max
262206   148265441   Bos taurus
227300   145710747   Anopheles gambiae

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of index files and the lists of new, changed, and
deleted records, each of the 464 files of a GenBank release begins with
the same header, except for the first line, which contains the file name,
and the sixth line, which contains the title of the file. The first line
of the file contains the file name in character positions 1 to 9 and the
full database name (Genetic Sequence Data Bank, 'GenBank') starting in
column 22. The brief names of the files in this release are listed in
section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ           Genetic Sequence Data Bank
                          15 April 2003

                NCBI-GenBank Flat File Release 134.0

                        Bacterial Sequences (Part 1)

   37811 loci,    97585608 bases, from    37811 reported sequences

---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header


3.2 Directory Files

3.2.1 Short Directory File

  The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE.  The second record is blank.

  Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3   B.rerio wnt-1 gene (exon 3) for wnt-1 protein.                266bp
ZEFWNT1G4   B.rerio wnt-1 gene (exon 4) for wnt-1 protein.                647bp
ZEFZF54     Zebrafish homeotic gene ZF-54.                                246bp
ZEFZFEN     Zebrafish engrailed-like homeobox sequence.                   327bp
ZZZZZZZZZZ
 
                    INVERTEBRATE

AAHAV33A    Acanthocheilonema viteae pepsin-inhibitor-like-protein       1048bp
ACAAC01     Acanthamoeba castelani gene encoding actin I.                1571bp
ACAACTPH    Acanthamoeba castellanii actophorin mRNA, complete cds.       671bp
ACAMHCA     A.castellanii non-muscle myosin heavy chain gene, partial    5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79
Example 2. Short Directory File


3.3 Index Files

There are six files containing indices to the entries in this release:

  Accession number index file (Accession and Version)
  Secondary accession number index file
  Keyword phrase index file
  Author name index file
  Journal citation index file
  Gene name index file

  The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:

 1. PRI - primate sequences
 2. ROD - rodent sequences
 3. MAM - other mammalian sequences
 4. VRT - other vertebrate sequences
 5. INV - invertebrate sequences
 6. PLN - plant, fungal, and algal sequences
 7. BCT - bacterial sequences
 8. VRL - viral sequences
 9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags) 
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites) 
15. GSS - GSS sequences (genome survey sequences) 
16. HTG - HTGS sequences (high throughput genomic sequences) 
17. HTC - HTC sequences (high throughput cDNA sequences) 

  A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx,  gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:

Indexed-Term 
        LOCUS-name1 Div-code1 Accession1 
        LOCUS-name2 Div-code2 Accession2 
        LOCUS-name3 Div-code3 Accession3 
        .... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

(H+,K+)-ATPASE BETA-SUBUNIT$ 
^IRATHKATPB^IROD^IM55655$ 
^IMUSATP4B1^IROD^IM64685$ 
^IMUSATP4B2^IROD^IM64686$ 
^IMUSATP4B3^IROD^IM64687$ 
^IMUSATP4B4^IROD^IM64688$ 
^IDOGATPASEB^IMAM^IM76486$ 

When viewed by a file browser such as 'less' or 'more' : 

(H+,K+)-ATPASE BETA-SUBUNIT 
        RATHKATPB ROD M55655 
        MUSATP4B1 ROD M64685 
        MUSATP4B2 ROD M64686 
        MUSATP4B3 ROD M64687 
        MUSATP4B4 ROD M64688 
        DOGATPASEB MAM M76486 

  Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION 
by the fact that they do not start with a TAB character. So one can 
extract just the terms via simple text-processing: 

        perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey

  The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) presented on
the same line as the LOCUS/Division/Accession triplet:

Accession1.Version1 Locus-name1 Div-code1 Accession1 
Accession2.Version2 Locus-name2 Div-code2 Accession2 
.... 

  Here is an example of the format, in which TAB characters are displayed 
as ^I, and carriage-returns/newlines as $ : 

AC000102.1^IAC000102^IPRI^IAC000102$ 
AC000103.1^IAC000103^IPLN^IAC000103$ 
AC000104.1^IF19P19^IPLN^IAC000104$ 
AC000105.40^IAC000105^IPRI^IAC000105$ 
AC000106.1^IF7G19^IPLN^IAC000106$ 
AC000107.1^IAC000107^IPLN^IAC000107$ 
AC000108.1^IAC000108^IBCT^IAC000108$ 
AC000109.1^IHSAC000109^IPRI^IAC000109$ 
AC000110.1^IHSAC000110^IPRI^IAC000110$ 

When viewed by a file browser such as 'less' or 'more' : 

AC000102.1 AC000102 PRI AC000102 
AC000103.1 AC000103 PLN AC000103 
AC000104.1 F19P19 PLN AC000104 
AC000105.40 AC000105 PRI AC000105 
AC000106.1 F7G19 PLN AC000106 
AC000107.1 AC000107 PLN AC000107 
AC000108.1 AC000108 BCT AC000108 
AC000109.1 HSAC000109 PRI AC000109 
AC000110.1 HSAC000110 PRI AC000110 

3.3.1 Accession Number Index File - gbacc.idx

  Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits.  Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.

  GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.

3.3.2 Keyword Phrase Index File - gbkey.idx

  Keyword phrases consist of names for gene products and other
characteristics of sequence entries.

3.3.3 Author Name Index File - gbaut*.idx

The author name index files list all of the author names that appear
in the references within sequence records.

3.3.4 Journal Citation Index File - gbjou.idx

  The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.

3.3.5 Gene Name Index - gbgen.idx

  The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         15 December 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
           snoRNA. Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code (see Section 3.3)
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.

3.4.7 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:

	  http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.ncbi.nlm.nih.gov/collab/FT/index.html

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.ncbi.nlm.nih.gov/collab/FT/index.html

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://www.ncbi.nlm.nih.gov/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              [email protected]

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              [email protected]

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  [email protected]  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

    Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A., 
    Wheeler D.L.  GenBank. Nucl. Acids Res. 28(1):15-18 (2000)

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:

	ftp://genbank.sdsc.edu/pub
	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  [email protected].  Please be certain to
indicate the GenBank release number (e.g., Release 134.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
        Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark, Irene Fang,
	Michael Fetchko, Anjanette Johnston, Pierre Ledoux, Richard McVeigh,
	Leonie Misquitta, Ilene Mizrachi, DeAnne Olsen Cravaritis,  
        Chris O'Sullivan, David Rasko, Leigh Riley, Gert Roosen, Susan 
        Schafer, Suh-suh Wang, Jane Weisemann, Steven Wilhite, and 
        Linda Yankie

Data Management and Preparation
	Vladimir Alekseyev, Serge Bazhin, Anton Butanaev, Mark Cavanaugh,
	Hsiu-Chuan Chen, Jonathan Kans, Michael Kimelman, Jim Ostell,
	Joel Plotkin, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusov, Carolyn Tolstoshev, Jane Weisemann,
	Eugene Yaschenko

Database Administration
	Helen Epting, Slava Khotomliansky, Tony Stearman

User Support
        Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
        Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris,
        Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, David Wheeler

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center