Release Notes For GenBank Release 144
GBREL.TXT Genetic Sequence Data Bank
October 15 2004
NCBI-GenBank Flat File Release 144.0
Distribution Release Notes
38941263 loci, 43194602655 bases, from 38941263 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 144.0
1.2 Cutoff Date
1.3 Important Changes in Release 144.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 144.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 144.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server: ftp.ncbi.nih.gov .
1.2 Cutoff Date
This full release, 144.0, incorporates data available to the collaborating
databases as of October 12, 2004 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
Mirrors of the GenBank FTP site at the NCBI are available from the San Diego
Supercomputer Center and the University of Indiana:
ftp://genbank.sdsc.edu/pub
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from these alternate sites when traffic at
the NCBI is high.
*** NOTE *** The SDSC GenBank mirror site is not expected to
be updated with GenBank 144.0 data for several weeks. Do not
use that mirror if you intend to obtain the release shortly
after it becomes available at NCBI.
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 144.0
1.3.1 Organizational changes
The total number of sequence data files increased by 24 with this release:
- the EST division is now comprised of 349 files (+14)
- the GSS division is now comprised of 120 files (+4)
- the HTG division is now comprised of 62 files (+1)
- the INV division is now comprised of 7 files (+1)
- the PAT division is now comprised of 16 files (+1)
- the PLN division is now comprised of 13 files (+1)
- the ROD division is now comprised of 14 files (+1)
In addition, the MAM division has been newly split into two files,
gbmam1.seq and gbmam2.seq (+1).
1.3.2 New qualifier : /old_locus_tag
The /locus_tag qualifier was introduced in April 2003 to provide
a method for systematically identifying genes, coding regions and
other features which typically result from computational analysis.
This qualifier is often used instead of /gene .
Sometimes the /locus_tag identifier series supplied by a submitter
of sequence data undergoes a change. Because the original /locus_tag
identifiers might be referenced in journal articles, or in databases,
a means of presenting the original identifiers is needed.
So a new qualifier, /old_locus_tag , has been introduced as of this
October 2004 release :
Qualifier /old_locus_tag
Definition feature tag assigned for tracking purposes
Value Format "text" (single token)
Example /old_locus_tag="RSc0382"
/locus_tag="YPO0002"
Comment /old_locus_tag can be used with any feature where /gene is valid and
where a /locus_tag qualifier is present.
Identical /old_locus_tag values may be used within an entry/record,
but only if the identical /old_locus_tag values are associated
with the same gene; in all other circumstances the /old_locus_tag
value must be unique within that entry/record.
Multiple/old_locus_tag qualifiers with distinct values are
allowed within a single feature; /old_locus_tag and /locus_tag
values must not be identical within a single feature.
1.3.3 New type of gap() operator
CON-division records utilize a CONTIG line with a join() statement,
which specifies how sequences can be combined to form a much larger
object. For example:
LOCUS AE016959 23508449 bp DNA linear CON 12-JUN-2003
DEFINITION Oryza sativa (japonica cultivar-group) chromosome 10, complete
sequence.
ACCESSION AE016959
[....]
CONTIG join(AE017047.1:1..300029,AE017048.1:61..300029,
AE017049.1:61..304564,AE017050.1:61..302504,AE017051.1:61..300029,
AE017052.1:61..300029,AE017053.1:61..303511,AE017054.1:61..302085,
AE017055.1:61..300029,AE017056.1:61..300029,AE017057.1:61..300029,
AE017058.1:61..300029,AE017059.1:61..300029,AE017060.1:61..95932,
gap(30001),AE017061.1:1..300028,AE017062.1:61..306096,
[....]
A gap operator is legal in these join statements:
gap() : indicates a gap of unknown length
gap(N) : where 'N' is a positive integer, indicates a gap with a
physically-estimated length of 'N' bases.
In some sequencing projects, a convention is agreed upon by which gaps
of unknown length are all represented by a uniform value, such as 100.
To reflect this convention, a new type of gap operator is legal as of
October 2004 : 'gap(unkN)', where 'N' is a positive integer. For a gap of
length 100, utilized by convention rather than reflective of the gap's
actual size, the operator would be:
gap(unk100)
This new gap operator will make clear the distinction between a
gap with a physically-estimated length, and a gap with a length that
has no actual physical basis.
1.3.3 New /compare qualifier
Five different features exist which can be used to annotate regions
of sequence that are either uncertain or that differ in comparison
to some other sequence:
variation
conflict
misc_difference
old_sequence
unsure
A /citation qualifier is used to refer to a publication that details
the nature of the uncertain or differing bases. However, a publication
may not always be available (unpublished references), and simply
referring to a publication is quite indirect.
The new /compare qualifer provides a method for directly
referencing a particular sequence that exhibits a sequence
difference:
/compare="Accession.Version"
For example:
/compare="M10101.1"
This new qualifier is legal as of this October 2004 GenBank Release.
The complete description of /compare is as follows:
Qualifier /compare=
Definition Reference details of an existing public INSD entry
to which a comparison is made
Value format [accession-number.sequence-version]
Example /compare=AJ634337.1
Comment This qualifier may be used on the following features:
misc_difference, conflict, unsure, old_sequence
and variation. The features "old_sequence" and "conflict" must
have either a /citation or a /compare qualifier. Multiple /compare
qualifiers with different contents are allowed within a
single feature.
This qualifier is not intended for large-scale annotation
of variations, such as SNPs.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in one of two different systems,
depending on their origin. One recent change to release processing involves
the parallelization of the dumps from those systems. Because the second dump
(for example) has no prior knowledge of exactly how many GSS files will be
dumped from the first, it doesn't know how to number it's own output files.
There is thus a discrepancy between the filenames and file headers for
eighteen GSS flatfiles in Release 144.0. Consider the gbgss100.seq file:
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2004
NCBI-GenBank Flat File Release 144.0
GSS Sequences (Part 1)
88260 loci, 65614942 bases, from 88260 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "100" based on the files dumped from the other system.
We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New gap feature
A new feature key for sequence gaps will become legal as of the
December 2004 GenBank release:
Feature key gap
Definition gap in the sequence
Mandatory qualifiers /estimated_length=unknown or <integer>
Optional qualifiers /map="text"
/note="text"
Comment the location span of the gap feature for an unknown
gap is 100 bp, with the 100 bp indicated as 100 "n"s in
the sequence. Where estimated length is indicated by
an integer, this is indicated by the same number of
"n"s in the sequence.
No upper or lower limit is set on the size of the gap.
1.4.2 Continuous ranges of secondary accessions
With the removal of sequence length limits, some genomes (typically
bacterial) that had been split into many pieces are gradually being
replaced by a single sequence record. U00096 is a good example.
When this happens, the accessions of the former small pieces become
secondary accessions for the single large sequence record. When each
secondary is separately listed, the ACCESSION line becomes excessively
lengthy.
As of GenBank Release 146.0 in February 2005, it will be legal to
represent continuous ranges of secondary accessions by a start accession,
a dash character, and an end accession. In the case of U00096, the
ACCESSION line would thus look like:
ACCESSION U00096 AE000111-AE000510
Further details about the conventions for secondary accession ranges
will be provided via these release notes and the GenBank newsgroup.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 683 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut3.idx - Index of the entries according to accession number, part 3.
22. gbaut4.idx - Index of the entries according to accession number, part 4.
23. gbaut5.idx - Index of the entries according to accession number, part 5.
24. gbaut6.idx - Index of the entries according to accession number, part 6.
25. gbaut7.idx - Index of the entries according to accession number, part 7.
26. gbaut8.idx - Index of the entries according to accession number, part 8.
27. gbaut9.idx - Index of the entries according to accession number, part 9.
28. gbbct1.seq - Bacterial sequence entries, part 1.
29. gbbct10.seq - Bacterial sequence entries, part 10.
30. gbbct2.seq - Bacterial sequence entries, part 2.
31. gbbct3.seq - Bacterial sequence entries, part 3.
32. gbbct4.seq - Bacterial sequence entries, part 4.
33. gbbct5.seq - Bacterial sequence entries, part 5.
34. gbbct6.seq - Bacterial sequence entries, part 6.
35. gbbct7.seq - Bacterial sequence entries, part 7.
36. gbbct8.seq - Bacterial sequence entries, part 8.
37. gbbct9.seq - Bacterial sequence entries, part 9.
38. gbchg.txt - Accession numbers of entries updated since the previous release.
39. gbcon.seq - Constructed sequence entries.
40. gbdel.txt - Accession numbers of entries deleted since the previous release.
41. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
42. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
43. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
44. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
45. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
46. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
47. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
48. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
49. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
50. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
51. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
52. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
53. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
54. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
55. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
56. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
57. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
58. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
59. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
60. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
61. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
62. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
63. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
64. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
65. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
66. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
67. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
68. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
69. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
70. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
71. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
72. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
73. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
74. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
75. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
76. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
77. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
78. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
79. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
80. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
81. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
82. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
83. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
84. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
85. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
86. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
87. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
88. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
89. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
90. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
91. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
92. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
93. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
94. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
95. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
96. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
97. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
98. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
99. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
100. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
101. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
102. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
103. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
104. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
105. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
106. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
107. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
108. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
109. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
110. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
111. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
112. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
113. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
114. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
115. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
116. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
117. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
118. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
119. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
120. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
121. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
122. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
123. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
124. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
125. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
126. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
127. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
128. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
129. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
130. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
131. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
132. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
133. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
134. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
135. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
136. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
137. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
138. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
139. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
140. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
141. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
142. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
143. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
144. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
145. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
146. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
147. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
148. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
149. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
150. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
151. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
152. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
153. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
154. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
155. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
156. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
157. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
158. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
159. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
160. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
161. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
162. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
163. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
164. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
165. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
166. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
167. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
168. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
169. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
170. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
171. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
172. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
173. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
174. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
175. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
176. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
177. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
178. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
179. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
180. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
181. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
182. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
183. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
184. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
185. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
186. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
187. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
188. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
189. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
190. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
191. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
192. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
193. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
194. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
195. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
196. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
197. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
198. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
199. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
200. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
201. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
202. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
203. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
204. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
205. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
206. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
207. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
208. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
209. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
210. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
211. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
212. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
213. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
214. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
215. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
216. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
217. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
218. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
219. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
220. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
221. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
222. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
223. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
224. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
225. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
226. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
227. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
228. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
229. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
230. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
231. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
232. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
233. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
234. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
235. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
236. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
237. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
238. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
239. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
240. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
241. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
242. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
243. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
244. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
245. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
246. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
247. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
248. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
249. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
250. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
251. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
252. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
253. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
254. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
255. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
256. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
257. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
258. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
259. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
260. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
261. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
262. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
263. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
264. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
265. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
266. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
267. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
268. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
269. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
270. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
271. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
272. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
273. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
274. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
275. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
276. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
277. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
278. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
279. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
280. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
281. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
282. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
283. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
284. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
285. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
286. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
287. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
288. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
289. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
290. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
291. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
292. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
293. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
294. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
295. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
296. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
297. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
298. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
299. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
300. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
301. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
302. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
303. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
304. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
305. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
306. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
307. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
308. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
309. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
310. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
311. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
312. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
313. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
314. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
315. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
316. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
317. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
318. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
319. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
320. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
321. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
322. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
323. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
324. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
325. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
326. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
327. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
328. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
329. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
330. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
331. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
332. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
333. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
334. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
335. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
336. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
337. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
338. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
339. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
340. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
341. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
342. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
343. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
344. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
345. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
346. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
347. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
348. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
349. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
350. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
351. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
352. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
353. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
354. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
355. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
356. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
357. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
358. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
359. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
360. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
361. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
362. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
363. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
364. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
365. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
366. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
367. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
368. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
369. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
370. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
371. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
372. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
373. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
374. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
375. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
376. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
377. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
378. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
379. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
380. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
381. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
382. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
383. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
384. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
385. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
386. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
387. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
388. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
389. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
390. gbgen.idx - Index of the entries according to gene symbols.
391. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
392. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
393. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
394. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
395. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
396. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
397. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
398. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
399. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
400. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
401. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
402. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
403. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
404. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
405. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
406. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
407. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
408. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
409. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
410. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
411. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
412. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
413. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
414. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
415. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
416. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
417. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
418. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
419. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
420. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
421. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
422. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
423. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
424. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
425. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
426. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
427. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
428. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
429. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
430. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
431. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
432. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
433. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
434. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
435. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
436. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
437. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
438. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
439. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
440. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
441. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
442. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
443. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
444. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
445. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
446. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
447. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
448. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
449. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
450. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
451. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
452. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
453. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
454. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
455. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
456. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
457. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
458. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
459. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
460. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
461. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
462. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
463. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
464. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
465. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
466. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
467. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
468. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
469. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
470. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
471. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
472. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
473. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
474. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
475. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
476. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
477. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
478. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
479. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
480. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
481. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
482. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
483. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
484. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
485. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
486. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
487. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
488. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
489. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
490. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
491. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
492. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
493. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
494. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
495. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
496. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
497. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
498. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
499. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
500. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
501. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
502. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
503. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
504. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
505. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
506. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
507. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
508. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
509. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
510. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
511. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
512. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
513. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
514. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
515. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
516. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
517. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
518. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
519. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
520. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
521. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
522. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
523. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
524. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
525. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
526. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
527. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
528. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
529. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
530. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
531. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
532. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
533. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
534. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
535. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
536. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
537. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
538. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
539. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
540. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
541. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
542. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
543. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
544. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
545. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
546. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
547. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
548. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
549. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
550. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
551. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
552. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
553. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
554. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
555. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
556. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
557. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
558. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
559. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
560. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
561. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
562. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
563. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
564. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
565. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
566. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
567. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
568. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
569. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
570. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
571. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
572. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
573. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
574. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
575. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
576. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
577. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
578. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
579. gbinv1.seq - Invertebrate sequence entries, part 1.
580. gbinv2.seq - Invertebrate sequence entries, part 2.
581. gbinv3.seq - Invertebrate sequence entries, part 3.
582. gbinv4.seq - Invertebrate sequence entries, part 4.
583. gbinv5.seq - Invertebrate sequence entries, part 5.
584. gbinv6.seq - Invertebrate sequence entries, part 6.
585. gbinv7.seq - Invertebrate sequence entries, part 7.
586. gbjou.idx - Index of the entries according to journal citation.
587. gbkey.idx - Index of the entries according to keyword phrase.
588. gbmam1.seq - Other mammalian sequence entries, part 1.
589. gbmam2.seq - Other mammalian sequence entries, part 2.
590. gbnew.txt - Accession numbers of entries new since the previous release.
591. gbpat1.seq - Patent sequence entries, part 1.
592. gbpat10.seq - Patent sequence entries, part 10.
593. gbpat11.seq - Patent sequence entries, part 11.
594. gbpat12.seq - Patent sequence entries, part 12.
595. gbpat13.seq - Patent sequence entries, part 13.
596. gbpat14.seq - Patent sequence entries, part 14.
597. gbpat15.seq - Patent sequence entries, part 15.
598. gbpat16.seq - Patent sequence entries, part 16.
599. gbpat2.seq - Patent sequence entries, part 2.
600. gbpat3.seq - Patent sequence entries, part 3.
601. gbpat4.seq - Patent sequence entries, part 4.
602. gbpat5.seq - Patent sequence entries, part 5.
603. gbpat6.seq - Patent sequence entries, part 6.
604. gbpat7.seq - Patent sequence entries, part 7.
605. gbpat8.seq - Patent sequence entries, part 8.
606. gbpat9.seq - Patent sequence entries, part 9.
607. gbphg.seq - Phage sequence entries.
608. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
609. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
610. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
611. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
612. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
613. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
614. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
615. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
616. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
617. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
618. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
619. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
620. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
621. gbpri1.seq - Primate sequence entries, part 1.
622. gbpri10.seq - Primate sequence entries, part 10.
623. gbpri11.seq - Primate sequence entries, part 11.
624. gbpri12.seq - Primate sequence entries, part 12.
625. gbpri13.seq - Primate sequence entries, part 13.
626. gbpri14.seq - Primate sequence entries, part 14.
627. gbpri15.seq - Primate sequence entries, part 15.
628. gbpri16.seq - Primate sequence entries, part 16.
629. gbpri17.seq - Primate sequence entries, part 17.
630. gbpri18.seq - Primate sequence entries, part 18.
631. gbpri19.seq - Primate sequence entries, part 19.
632. gbpri2.seq - Primate sequence entries, part 2.
633. gbpri20.seq - Primate sequence entries, part 20.
634. gbpri21.seq - Primate sequence entries, part 21.
635. gbpri22.seq - Primate sequence entries, part 22.
636. gbpri23.seq - Primate sequence entries, part 23.
637. gbpri24.seq - Primate sequence entries, part 24.
638. gbpri25.seq - Primate sequence entries, part 25.
639. gbpri26.seq - Primate sequence entries, part 26.
640. gbpri27.seq - Primate sequence entries, part 27.
641. gbpri28.seq - Primate sequence entries, part 28.
642. gbpri3.seq - Primate sequence entries, part 3.
643. gbpri4.seq - Primate sequence entries, part 4.
644. gbpri5.seq - Primate sequence entries, part 5.
645. gbpri6.seq - Primate sequence entries, part 6.
646. gbpri7.seq - Primate sequence entries, part 7.
647. gbpri8.seq - Primate sequence entries, part 8.
648. gbpri9.seq - Primate sequence entries, part 9.
649. gbrel.txt - Release notes (this document).
650. gbrod1.seq - Rodent sequence entries, part 1.
651. gbrod10.seq - Rodent sequence entries, part 10.
652. gbrod11.seq - Rodent sequence entries, part 11.
653. gbrod12.seq - Rodent sequence entries, part 12.
654. gbrod13.seq - Rodent sequence entries, part 13.
655. gbrod14.seq - Rodent sequence entries, part 14.
656. gbrod2.seq - Rodent sequence entries, part 2.
657. gbrod3.seq - Rodent sequence entries, part 3.
658. gbrod4.seq - Rodent sequence entries, part 4.
659. gbrod5.seq - Rodent sequence entries, part 5.
660. gbrod6.seq - Rodent sequence entries, part 6.
661. gbrod7.seq - Rodent sequence entries, part 7.
662. gbrod8.seq - Rodent sequence entries, part 8.
663. gbrod9.seq - Rodent sequence entries, part 9.
664. gbsdr.txt - Short directory of the data bank.
665. gbsec.idx - Index of the entries according to secondary accession number.
666. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
667. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
668. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
669. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
670. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
671. gbsyn.seq - Synthetic and chimeric sequence entries.
672. gbuna.seq - Unannotated sequence entries.
673. gbvrl1.seq - Viral sequence entries, part 1.
674. gbvrl2.seq - Viral sequence entries, part 2.
675. gbvrl3.seq - Viral sequence entries, part 3.
676. gbvrl4.seq - Viral sequence entries, part 4.
677. gbvrt1.seq - Other vertebrate sequence entries, part 1.
678. gbvrt2.seq - Other vertebrate sequence entries, part 2.
679. gbvrt3.seq - Other vertebrate sequence entries, part 3.
680. gbvrt4.seq - Other vertebrate sequence entries, part 4.
681. gbvrt5.seq - Other vertebrate sequence entries, part 5.
682. gbvrt6.seq - Other vertebrate sequence entries, part 6.
683. gbvrt7.seq - Other vertebrate sequence entries, part 7.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 144.0 flatfiles require roughly 147 GB (sequence
files only) or 166 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1277694024 gbacc.idx
502971032 gbaut1.idx
504285946 gbaut10.idx
524972202 gbaut11.idx
503443279 gbaut12.idx
500706872 gbaut13.idx
529637418 gbaut14.idx
504843372 gbaut15.idx
515231562 gbaut16.idx
501784724 gbaut17.idx
510538163 gbaut18.idx
500428563 gbaut19.idx
500260565 gbaut2.idx
502104763 gbaut20.idx
503620238 gbaut21.idx
515475382 gbaut22.idx
500748984 gbaut23.idx
505499034 gbaut24.idx
500013973 gbaut25.idx
311097194 gbaut26.idx
500783403 gbaut3.idx
518281377 gbaut4.idx
507067934 gbaut5.idx
508614163 gbaut6.idx
500238128 gbaut7.idx
522071096 gbaut8.idx
500879172 gbaut9.idx
250023241 gbbct1.seq
200960824 gbbct10.seq
250056549 gbbct2.seq
256559885 gbbct3.seq
250002469 gbbct4.seq
250487852 gbbct5.seq
250002460 gbbct6.seq
250005371 gbbct7.seq
250004643 gbbct8.seq
250001248 gbbct9.seq
5264903 gbchg.txt
505523586 gbcon.seq
292866 gbdel.txt
230689132 gbest1.seq
230689848 gbest10.seq
230688717 gbest100.seq
230688744 gbest101.seq
230687623 gbest102.seq
230688395 gbest103.seq
230689926 gbest104.seq
230690293 gbest105.seq
230687453 gbest106.seq
230688314 gbest107.seq
230688475 gbest108.seq
230689246 gbest109.seq
230689848 gbest11.seq
230690428 gbest110.seq
230690335 gbest111.seq
230688853 gbest112.seq
230688933 gbest113.seq
230687849 gbest114.seq
230689832 gbest115.seq
230689077 gbest116.seq
230689594 gbest117.seq
230687811 gbest118.seq
230690442 gbest119.seq
230687932 gbest12.seq
230688145 gbest120.seq
230687626 gbest121.seq
230689161 gbest122.seq
230688674 gbest123.seq
227327132 gbest124.seq
230688128 gbest125.seq
230688007 gbest126.seq
230691401 gbest127.seq
230689378 gbest128.seq
230689388 gbest129.seq
230688512 gbest13.seq
230687637 gbest130.seq
230688809 gbest131.seq
230687546 gbest132.seq
230688146 gbest133.seq
230689034 gbest134.seq
230687671 gbest135.seq
230688286 gbest136.seq
230689906 gbest137.seq
230687610 gbest138.seq
230691208 gbest139.seq
230687875 gbest14.seq
230688734 gbest140.seq
230688058 gbest141.seq
230689481 gbest142.seq
230688515 gbest143.seq
230687900 gbest144.seq
230688619 gbest145.seq
230687449 gbest146.seq
230688749 gbest147.seq
230687816 gbest148.seq
230691831 gbest149.seq
230687508 gbest15.seq
230687489 gbest150.seq
230690667 gbest151.seq
230695336 gbest152.seq
230688569 gbest153.seq
230687813 gbest154.seq
230688466 gbest155.seq
230688254 gbest156.seq
230689460 gbest157.seq
230689565 gbest158.seq
230689152 gbest159.seq
230690390 gbest16.seq
230688000 gbest160.seq
230688784 gbest161.seq
230689895 gbest162.seq
230688168 gbest163.seq
230688755 gbest164.seq
230688062 gbest165.seq
230688465 gbest166.seq
230687834 gbest167.seq
230687834 gbest168.seq
230689160 gbest169.seq
230688636 gbest17.seq
230690339 gbest170.seq
230696107 gbest171.seq
230689586 gbest172.seq
230689748 gbest173.seq
230687942 gbest174.seq
230688141 gbest175.seq
230688656 gbest176.seq
230690550 gbest177.seq
230687751 gbest178.seq
230689261 gbest179.seq
230687983 gbest18.seq
230688464 gbest180.seq
230688040 gbest181.seq
230687899 gbest182.seq
230689790 gbest183.seq
230689697 gbest184.seq
230690612 gbest185.seq
230688593 gbest186.seq
230689192 gbest187.seq
230687518 gbest188.seq
230688152 gbest189.seq
230687500 gbest19.seq
230687684 gbest190.seq
230690293 gbest191.seq
230688602 gbest192.seq
230689022 gbest193.seq
230687611 gbest194.seq
230689359 gbest195.seq
230690416 gbest196.seq
230688021 gbest197.seq
230687894 gbest198.seq
230689260 gbest199.seq
230689481 gbest2.seq
230689203 gbest20.seq
230688806 gbest200.seq
230689327 gbest201.seq
230687944 gbest202.seq
230689303 gbest203.seq
230689782 gbest204.seq
230687556 gbest205.seq
230687693 gbest206.seq
230687824 gbest207.seq
230690398 gbest208.seq
230687467 gbest209.seq
230689353 gbest21.seq
230692266 gbest210.seq
163466753 gbest211.seq
161926566 gbest212.seq
167169876 gbest213.seq
168354598 gbest214.seq
169508335 gbest215.seq
164263003 gbest216.seq
164762877 gbest217.seq
164135581 gbest218.seq
164262663 gbest219.seq
230688725 gbest22.seq
164234931 gbest220.seq
164194670 gbest221.seq
163419802 gbest222.seq
164691174 gbest223.seq
166076720 gbest224.seq
161605260 gbest225.seq
164042440 gbest226.seq
168678561 gbest227.seq
166740955 gbest228.seq
165395295 gbest229.seq
230689294 gbest23.seq
165520697 gbest230.seq
165165001 gbest231.seq
164690847 gbest232.seq
163998558 gbest233.seq
164098449 gbest234.seq
165194855 gbest235.seq
169719609 gbest236.seq
178460892 gbest237.seq
171139400 gbest238.seq
217315748 gbest239.seq
230689206 gbest24.seq
230688088 gbest240.seq
230689484 gbest241.seq
230688316 gbest242.seq
230690062 gbest243.seq
230688351 gbest244.seq
230687531 gbest245.seq
230687744 gbest246.seq
230689287 gbest247.seq
230687508 gbest248.seq
230688993 gbest249.seq
230688006 gbest25.seq
230690860 gbest250.seq
230688162 gbest251.seq
230689803 gbest252.seq
230689286 gbest253.seq
230687685 gbest254.seq
230688410 gbest255.seq
230690423 gbest256.seq
230691069 gbest257.seq
230689911 gbest258.seq
230688990 gbest259.seq
230690587 gbest26.seq
230688415 gbest260.seq
230688235 gbest261.seq
230688827 gbest262.seq
230687715 gbest263.seq
230689015 gbest264.seq
230688256 gbest265.seq
230687760 gbest266.seq
227414674 gbest267.seq
207722075 gbest268.seq
230688166 gbest269.seq
230689686 gbest27.seq
230690761 gbest270.seq
230687588 gbest271.seq
230689374 gbest272.seq
230689881 gbest273.seq
230689392 gbest274.seq
230690416 gbest275.seq
230689914 gbest276.seq
230688214 gbest277.seq
230687487 gbest278.seq
230689579 gbest279.seq
230688074 gbest28.seq
230687852 gbest280.seq
230688785 gbest281.seq
230690473 gbest282.seq
230687478 gbest283.seq
230688287 gbest284.seq
230689771 gbest285.seq
230688841 gbest286.seq
230689382 gbest287.seq
230687883 gbest288.seq
230689367 gbest289.seq
230689363 gbest29.seq
230687894 gbest290.seq
230690906 gbest291.seq
230690416 gbest292.seq
230690987 gbest293.seq
230689628 gbest294.seq
230687693 gbest295.seq
230689569 gbest296.seq
230687596 gbest297.seq
230688979 gbest298.seq
149854029 gbest299.seq
230689555 gbest3.seq
230687764 gbest30.seq
212125944 gbest300.seq
230688330 gbest301.seq
230691294 gbest302.seq
230689154 gbest303.seq
230687965 gbest304.seq
230688787 gbest305.seq
230690110 gbest306.seq
230688254 gbest307.seq
230690294 gbest308.seq
230688409 gbest309.seq
230687646 gbest31.seq
230689556 gbest310.seq
230689093 gbest311.seq
230689235 gbest312.seq
230690035 gbest313.seq
230690302 gbest314.seq
230690001 gbest315.seq
230690401 gbest316.seq
230688432 gbest317.seq
230688237 gbest318.seq
230688214 gbest319.seq
230689599 gbest32.seq
230690626 gbest320.seq
230688369 gbest321.seq
230688088 gbest322.seq
230689436 gbest323.seq
230688651 gbest324.seq
230689391 gbest325.seq
230688135 gbest326.seq
230687501 gbest327.seq
230688151 gbest328.seq
230691277 gbest329.seq
230689547 gbest33.seq
230689371 gbest330.seq
230688859 gbest331.seq
230687837 gbest332.seq
230690296 gbest333.seq
230688657 gbest334.seq
230690896 gbest335.seq
230687534 gbest336.seq
230687484 gbest337.seq
230688734 gbest338.seq
222141213 gbest339.seq
230689052 gbest34.seq
230688949 gbest340.seq
230689382 gbest341.seq
230689564 gbest342.seq
230689119 gbest343.seq
230689699 gbest344.seq
230690296 gbest345.seq
225978280 gbest346.seq
230687607 gbest347.seq
230687533 gbest348.seq
40171651 gbest349.seq
230689067 gbest35.seq
230688665 gbest36.seq
230690060 gbest37.seq
201374565 gbest38.seq
190694213 gbest39.seq
230688630 gbest4.seq
201009016 gbest40.seq
213955380 gbest41.seq
215642609 gbest42.seq
215601452 gbest43.seq
216056971 gbest44.seq
230688610 gbest45.seq
230688211 gbest46.seq
221753592 gbest47.seq
230687752 gbest48.seq
230689356 gbest49.seq
163953101 gbest5.seq
230687921 gbest50.seq
230689216 gbest51.seq
230687862 gbest52.seq
230688509 gbest53.seq
230689198 gbest54.seq
230689085 gbest55.seq
230690184 gbest56.seq
230688362 gbest57.seq
230689454 gbest58.seq
230688382 gbest59.seq
180514745 gbest6.seq
230687815 gbest60.seq
230690598 gbest61.seq
230690041 gbest62.seq
227222223 gbest63.seq
209332848 gbest64.seq
208442154 gbest65.seq
208236397 gbest66.seq
208646293 gbest67.seq
209885900 gbest68.seq
209059430 gbest69.seq
230687546 gbest7.seq
207775368 gbest70.seq
209182322 gbest71.seq
209822637 gbest72.seq
205223317 gbest73.seq
206575252 gbest74.seq
207350749 gbest75.seq
207973762 gbest76.seq
216677788 gbest77.seq
230692853 gbest78.seq
230687664 gbest79.seq
230689300 gbest8.seq
230039731 gbest80.seq
214627198 gbest81.seq
213970801 gbest82.seq
217490707 gbest83.seq
230689158 gbest84.seq
230689373 gbest85.seq
230688389 gbest86.seq
230690066 gbest87.seq
230690428 gbest88.seq
230690374 gbest89.seq
230687556 gbest9.seq
230688009 gbest90.seq
230689338 gbest91.seq
230688720 gbest92.seq
230688428 gbest93.seq
230688894 gbest94.seq
230688664 gbest95.seq
230688586 gbest96.seq
230688363 gbest97.seq
230690210 gbest98.seq
230688581 gbest99.seq
40741455 gbgen.idx
230688071 gbgss1.seq
230689943 gbgss10.seq
250001187 gbgss100.seq
250001351 gbgss101.seq
250003164 gbgss102.seq
250002528 gbgss103.seq
250001987 gbgss104.seq
250002581 gbgss105.seq
250002400 gbgss106.seq
250003594 gbgss107.seq
250001284 gbgss108.seq
250000405 gbgss109.seq
230688159 gbgss11.seq
250000231 gbgss110.seq
250002685 gbgss111.seq
250002094 gbgss112.seq
250000156 gbgss113.seq
250001761 gbgss114.seq
250000818 gbgss115.seq
250001032 gbgss116.seq
250000584 gbgss117.seq
250001897 gbgss118.seq
250001727 gbgss119.seq
230689381 gbgss12.seq
196596485 gbgss120.seq
230689137 gbgss13.seq
230688731 gbgss14.seq
230689607 gbgss15.seq
230688923 gbgss16.seq
230687776 gbgss17.seq
230691289 gbgss18.seq
230688351 gbgss19.seq
230687537 gbgss2.seq
230690604 gbgss20.seq
230688885 gbgss21.seq
230687701 gbgss22.seq
230687875 gbgss23.seq
230688014 gbgss24.seq
230687725 gbgss25.seq
230687928 gbgss26.seq
230687980 gbgss27.seq
230688510 gbgss28.seq
230688777 gbgss29.seq
230689815 gbgss3.seq
230689497 gbgss30.seq
230687730 gbgss31.seq
230688777 gbgss32.seq
230688278 gbgss33.seq
230689885 gbgss34.seq
230688891 gbgss35.seq
230688568 gbgss36.seq
230688240 gbgss37.seq
230689140 gbgss38.seq
230690132 gbgss39.seq
230689575 gbgss4.seq
230688283 gbgss40.seq
230688746 gbgss41.seq
230688017 gbgss42.seq
230687831 gbgss43.seq
230688960 gbgss44.seq
230688493 gbgss45.seq
230690309 gbgss46.seq
230688663 gbgss47.seq
230688559 gbgss48.seq
230690245 gbgss49.seq
230688202 gbgss5.seq
230689359 gbgss50.seq
230688221 gbgss51.seq
230687721 gbgss52.seq
230689731 gbgss53.seq
230688744 gbgss54.seq
230689877 gbgss55.seq
230689712 gbgss56.seq
230690317 gbgss57.seq
230687733 gbgss58.seq
230688359 gbgss59.seq
230687561 gbgss6.seq
230687755 gbgss60.seq
230158954 gbgss61.seq
230689255 gbgss62.seq
230687616 gbgss63.seq
230689564 gbgss64.seq
230687553 gbgss65.seq
230688768 gbgss66.seq
230687510 gbgss67.seq
230687945 gbgss68.seq
230689353 gbgss69.seq
230688341 gbgss7.seq
230687613 gbgss70.seq
230689831 gbgss71.seq
230688083 gbgss72.seq
230688961 gbgss73.seq
230689933 gbgss74.seq
230689599 gbgss75.seq
230689624 gbgss76.seq
230688124 gbgss77.seq
230688602 gbgss78.seq
230688784 gbgss79.seq
230688355 gbgss8.seq
204042531 gbgss80.seq
192305633 gbgss81.seq
212852667 gbgss82.seq
230688706 gbgss83.seq
230687942 gbgss84.seq
230689547 gbgss85.seq
230688558 gbgss86.seq
230688735 gbgss87.seq
230687914 gbgss88.seq
230688369 gbgss89.seq
230689591 gbgss9.seq
230689761 gbgss90.seq
230687908 gbgss91.seq
230688220 gbgss92.seq
230689204 gbgss93.seq
230688503 gbgss94.seq
230688294 gbgss95.seq
230688324 gbgss96.seq
230688723 gbgss97.seq
230688828 gbgss98.seq
13733451 gbgss99.seq
250000274 gbhtc1.seq
250002209 gbhtc2.seq
250000953 gbhtc3.seq
250000424 gbhtc4.seq
250002178 gbhtc5.seq
39228490 gbhtc6.seq
250166522 gbhtg1.seq
250015520 gbhtg10.seq
250036407 gbhtg11.seq
250054607 gbhtg12.seq
250292376 gbhtg13.seq
250235834 gbhtg14.seq
250014474 gbhtg15.seq
250274329 gbhtg16.seq
250134022 gbhtg17.seq
250015301 gbhtg18.seq
250065040 gbhtg19.seq
250072889 gbhtg2.seq
250008490 gbhtg20.seq
250104030 gbhtg21.seq
250248980 gbhtg22.seq
250321512 gbhtg23.seq
250065789 gbhtg24.seq
250125428 gbhtg25.seq
250070575 gbhtg26.seq
250216083 gbhtg27.seq
250383569 gbhtg28.seq
250300899 gbhtg29.seq
250009204 gbhtg3.seq
250003873 gbhtg30.seq
250107066 gbhtg31.seq
250192096 gbhtg32.seq
250246492 gbhtg33.seq
250098229 gbhtg34.seq
250238082 gbhtg35.seq
250044059 gbhtg36.seq
250102431 gbhtg37.seq
250210477 gbhtg38.seq
250270956 gbhtg39.seq
250035247 gbhtg4.seq
250105103 gbhtg40.seq
250097191 gbhtg41.seq
250001705 gbhtg42.seq
250047032 gbhtg43.seq
250093579 gbhtg44.seq
250008586 gbhtg45.seq
250142553 gbhtg46.seq
250132836 gbhtg47.seq
250060325 gbhtg48.seq
250055312 gbhtg49.seq
250098695 gbhtg5.seq
250216253 gbhtg50.seq
250130827 gbhtg51.seq
250173947 gbhtg52.seq
250093668 gbhtg53.seq
250073241 gbhtg54.seq
250627721 gbhtg55.seq
250054384 gbhtg56.seq
250212427 gbhtg57.seq
250019019 gbhtg58.seq
250024802 gbhtg59.seq
250199168 gbhtg6.seq
250050950 gbhtg60.seq
251019384 gbhtg61.seq
16144706 gbhtg62.seq
250023405 gbhtg7.seq
250079161 gbhtg8.seq
250064981 gbhtg9.seq
250031849 gbinv1.seq
250211141 gbinv2.seq
250000778 gbinv3.seq
250000842 gbinv4.seq
250031776 gbinv5.seq
250011365 gbinv6.seq
28548500 gbinv7.seq
997701276 gbjou.idx
876183528 gbkey.idx
250003572 gbmam1.seq
4268332 gbmam2.seq
25188337 gbnew.txt
250000835 gbpat1.seq
250002886 gbpat10.seq
250001138 gbpat11.seq
250002815 gbpat12.seq
250007032 gbpat13.seq
250000956 gbpat14.seq
250001080 gbpat15.seq
142764005 gbpat16.seq
250000321 gbpat2.seq
250003304 gbpat3.seq
250000146 gbpat4.seq
250000052 gbpat5.seq
250084635 gbpat6.seq
250004880 gbpat7.seq
250000541 gbpat8.seq
250003987 gbpat9.seq
34072635 gbphg.seq
250008305 gbpln1.seq
250003080 gbpln10.seq
250001669 gbpln11.seq
250042832 gbpln12.seq
94024500 gbpln13.seq
250046326 gbpln2.seq
250000784 gbpln3.seq
250001869 gbpln4.seq
250003651 gbpln5.seq
250016776 gbpln6.seq
250026008 gbpln7.seq
250005989 gbpln8.seq
250002776 gbpln9.seq
250008337 gbpri1.seq
250137138 gbpri10.seq
250017717 gbpri11.seq
250159725 gbpri12.seq
250097724 gbpri13.seq
250061688 gbpri14.seq
250017590 gbpri15.seq
250006055 gbpri16.seq
250198919 gbpri17.seq
250113997 gbpri18.seq
250003275 gbpri19.seq
250009232 gbpri2.seq
250021258 gbpri20.seq
250043835 gbpri21.seq
250110169 gbpri22.seq
250117736 gbpri23.seq
250068237 gbpri24.seq
250001157 gbpri25.seq
250003073 gbpri26.seq
250001392 gbpri27.seq
71910254 gbpri28.seq
250261228 gbpri3.seq
250101226 gbpri4.seq
250091551 gbpri5.seq
250200614 gbpri6.seq
250123708 gbpri7.seq
250079426 gbpri8.seq
250179002 gbpri9.seq
176974 gbrel.txt
250007998 gbrod1.seq
250196711 gbrod10.seq
250198226 gbrod11.seq
250000929 gbrod12.seq
250045413 gbrod13.seq
222311863 gbrod14.seq
250103452 gbrod2.seq
250231204 gbrod3.seq
250007154 gbrod4.seq
250128885 gbrod5.seq
250079118 gbrod6.seq
250100125 gbrod7.seq
250144288 gbrod8.seq
250129754 gbrod9.seq
3115343368 gbsdr.txt
28659 gbsec.idx
250000177 gbsts1.seq
250003237 gbsts2.seq
250000831 gbsts3.seq
250001943 gbsts4.seq
79086945 gbsts5.seq
63221678 gbsyn.seq
3349914 gbuna.seq
250001643 gbvrl1.seq
250010848 gbvrl2.seq
250002396 gbvrl3.seq
111314827 gbvrl4.seq
250000981 gbvrt1.seq
250001152 gbvrt2.seq
250000111 gbvrt3.seq
250188103 gbvrt4.seq
250143351 gbvrt5.seq
250002411 gbvrt6.seq
88604886 gbvrt7.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 30456 98771544
BCT10 32459 72797405
BCT2 8620 106269677
BCT3 348 117347400
BCT4 41918 96970172
BCT5 36307 95630536
BCT6 24227 106905205
BCT7 74201 82405677
BCT8 1244 98184505
BCT9 27406 99637627
EST1 68591 26476165
EST10 76947 29967950
EST100 69401 44260415
EST101 74588 42775225
EST102 69292 29099886
EST103 70793 32697333
EST104 64521 33575256
EST105 68223 40518710
EST106 71988 47313362
EST107 76099 31678048
EST108 74558 32037660
EST109 76037 26508961
EST11 76413 28991899
EST110 73934 34893350
EST111 65843 35568774
EST112 77611 42123908
EST113 79619 44730092
EST114 73607 48543389
EST115 68562 41133896
EST116 72207 49480892
EST117 70181 44406366
EST118 72853 45937241
EST119 75725 42904247
EST12 77095 30818244
EST120 74465 48186632
EST121 74699 50111892
EST122 73018 46242294
EST123 79171 41511037
EST124 74977 24272584
EST125 83052 46585576
EST126 75431 44554221
EST127 70874 41671472
EST128 67404 33172360
EST129 68422 38586210
EST13 77733 29942859
EST130 67452 37020913
EST131 68580 41223669
EST132 72099 40941251
EST133 71188 45275234
EST134 69413 42017613
EST135 73118 39914185
EST136 68863 42973239
EST137 59221 34243212
EST138 93805 50813180
EST139 92461 52760239
EST14 80023 32136208
EST140 74353 38556416
EST141 107509 57256818
EST142 108879 59162813
EST143 98220 54288336
EST144 73727 44754328
EST145 100083 58415060
EST146 96299 57952327
EST147 70370 40923881
EST148 65963 31493935
EST149 62583 28405116
EST15 73067 30972056
EST150 56827 27105390
EST151 63545 31433892
EST152 55103 27752718
EST153 78559 51327204
EST154 68503 38758296
EST155 72897 52756693
EST156 73333 41808775
EST157 60961 30645868
EST158 65016 38771795
EST159 66819 32868260
EST16 75610 33245165
EST160 63824 46147352
EST161 65708 37841584
EST162 102296 44975839
EST163 90136 53648839
EST164 104627 60608168
EST165 99538 59037037
EST166 93816 44271205
EST167 92163 41883504
EST168 99728 49606910
EST169 66486 41407776
EST17 84021 34375998
EST170 68898 39578208
EST171 60800 35685150
EST172 69643 44540424
EST173 70487 29742318
EST174 76765 35115325
EST175 70535 43136808
EST176 77098 38102117
EST177 65788 34330314
EST178 70563 50049035
EST179 68402 46111136
EST18 80446 32529176
EST180 69008 35288313
EST181 69572 46480676
EST182 69737 52406289
EST183 69321 36458440
EST184 71629 43890308
EST185 71471 61231485
EST186 64451 47070634
EST187 64048 47022957
EST188 63995 46808979
EST189 65627 45895237
EST19 81022 33598368
EST190 67163 51501576
EST191 63287 39975839
EST192 62599 38158737
EST193 64482 36477179
EST194 66982 37260166
EST195 87092 50494289
EST196 77913 51920480
EST197 83190 49640619
EST198 106474 65912660
EST199 109277 65162578
EST2 75366 28937064
EST20 72745 29110104
EST200 108382 64528141
EST201 103120 66976956
EST202 117956 58431115
EST203 74803 41493572
EST204 70057 46887677
EST205 69170 59604861
EST206 76029 53386648
EST207 78236 39930740
EST208 79371 49383197
EST209 72107 51651755
EST21 73094 34141978
EST210 70728 44668537
EST211 27791 10433483
EST212 27938 10473295
EST213 27079 10000043
EST214 26881 9675263
EST215 26739 9140698
EST216 27500 10150358
EST217 27285 9692069
EST218 27330 9935100
EST219 27292 11292015
EST22 76956 30612059
EST220 27241 11730570
EST221 27298 10866141
EST222 27564 9690893
EST223 27413 8892782
EST224 27291 10633655
EST225 27985 11051404
EST226 27646 10981501
EST227 26756 11555527
EST228 26867 12150944
EST229 27212 10663553
EST23 77302 32161802
EST230 27085 11177084
EST231 27122 11981346
EST232 27301 11442650
EST233 27357 10769584
EST234 27334 10957133
EST235 27224 10351406
EST236 26394 14178030
EST237 24858 17001557
EST238 25971 17649933
EST239 86870 29937163
EST24 75825 34244564
EST240 90051 41846173
EST241 71336 45647434
EST242 69097 44894273
EST243 69081 44226137
EST244 66002 41145856
EST245 76615 43375586
EST246 65564 42107771
EST247 70790 46924610
EST248 57388 28427849
EST249 102253 48178243
EST25 72427 30832665
EST250 88449 44425952
EST251 72101 40041671
EST252 61582 29903228
EST253 72009 42639614
EST254 71649 34770047
EST255 71843 33885588
EST256 73912 45591468
EST257 65477 36183003
EST258 68391 39482466
EST259 76874 38459887
EST26 76638 31624043
EST260 83887 47170170
EST261 81425 53874003
EST262 78934 55836750
EST263 114123 49914764
EST264 82823 42650311
EST265 73405 46400692
EST266 73763 39237047
EST267 72669 38123902
EST268 69708 27349284
EST269 69352 41587956
EST27 78144 34202970
EST270 62736 35062286
EST271 64712 41493934
EST272 71013 40729832
EST273 64698 44665735
EST274 63803 32642811
EST275 81978 43359087
EST276 84472 44860021
EST277 83829 51372522
EST278 110936 53413138
EST279 114054 48490865
EST28 108097 51905300
EST280 73466 36144823
EST281 67752 36712398
EST282 71739 47449890
EST283 80918 38663280
EST284 70912 43085749
EST285 71401 40881321
EST286 60106 35745855
EST287 52851 30310784
EST288 70025 46034095
EST289 68093 42378388
EST29 103464 50014740
EST290 71229 44274473
EST291 67577 39345421
EST292 71971 43042299
EST293 75604 45710652
EST294 61992 55558908
EST295 66542 46958585
EST296 62556 38845301
EST297 66817 43059808
EST298 72344 46552788
EST299 52164 26255967
EST3 74213 30128080
EST30 82419 41347767
EST300 63110 33522018
EST301 66730 36405041
EST302 59658 29203537
EST303 63060 38503632
EST304 81313 45478643
EST305 72761 40597066
EST306 69395 41820633
EST307 71461 40890122
EST308 62413 42984197
EST309 87253 49727711
EST31 67696 60919422
EST310 86181 50912231
EST311 79264 42917587
EST312 62009 37074221
EST313 65854 34130312
EST314 71039 39580542
EST315 47739 24389942
EST316 65458 36218753
EST317 84053 46194759
EST318 96217 48110940
EST319 65516 46020692
EST32 79304 49880237
EST320 79853 53531624
EST321 69906 38852449
EST322 56349 33436859
EST323 94785 38998460
EST324 59749 38404804
EST325 62792 38006950
EST326 71908 46205370
EST327 103277 57462292
EST328 69383 35425759
EST329 60339 37212980
EST33 92232 44961755
EST330 47306 29109958
EST331 48479 28028471
EST332 84356 48717047
EST333 80895 45825823
EST334 75205 40459930
EST335 66490 39258790
EST336 61695 39854287
EST337 65967 37993035
EST338 61207 34409781
EST339 80458 25211265
EST34 84925 46364771
EST340 73278 34793923
EST341 95375 40259540
EST342 77464 25936081
EST343 72183 26010882
EST344 73987 27221003
EST345 73662 26613392
EST346 78751 26542566
EST347 73256 28758442
EST348 70209 28215606
EST349 16781 5102867
EST35 98401 45537038
EST36 97268 50324738
EST37 105573 47667145
EST38 74427 24645347
EST39 69427 18498452
EST4 74631 28188475
EST40 79229 22896642
EST41 43865 12272615
EST42 43547 11825181
EST43 43202 12080257
EST44 43234 11305569
EST45 95244 41994492
EST46 94255 43668576
EST47 91947 48057805
EST48 86402 39660906
EST49 106760 56719822
EST5 48531 15367560
EST50 92923 44646924
EST51 75068 31711177
EST52 68907 30624717
EST53 71343 30943230
EST54 73791 31087577
EST55 83036 32731541
EST56 71825 28088438
EST57 64451 28318857
EST58 73681 31900966
EST59 74258 35158833
EST6 56332 18258994
EST60 75084 32860321
EST61 75603 26886383
EST62 79725 31025851
EST63 70887 30769509
EST64 40156 11464049
EST65 40330 11547442
EST66 40468 12662565
EST67 40700 12296888
EST68 40660 12617885
EST69 40622 12873547
EST7 74707 29422353
EST70 40619 12330094
EST71 40356 12311479
EST72 40518 12435157
EST73 41353 12110009
EST74 41343 12730498
EST75 41297 13063386
EST76 41151 13062765
EST77 44289 12309678
EST78 42900 21750052
EST79 41492 23964624
EST8 76830 30879168
EST80 43624 17934411
EST81 50551 23092495
EST82 51381 21303687
EST83 51564 21473985
EST84 75262 32518136
EST85 73929 29201368
EST86 73169 31318294
EST87 77555 45417083
EST88 78020 41311693
EST89 76810 40412330
EST9 77951 30110222
EST90 78315 38662906
EST91 69712 40620515
EST92 74711 34196002
EST93 75208 38111196
EST94 70379 36880345
EST95 78093 51328688
EST96 66818 34514938
EST97 72776 36773587
EST98 72219 39830163
EST99 74074 44314479
GSS1 91491 39180905
GSS10 75817 44131417
GSS100 88260 65614942
GSS101 84798 63610357
GSS102 102048 47415973
GSS103 75788 65175379
GSS104 76352 64150480
GSS105 77011 63022514
GSS106 77392 62366624
GSS107 75588 35143610
GSS108 91456 69057584
GSS109 96114 53149359
GSS11 69172 35579268
GSS110 89146 53639891
GSS111 82230 64458659
GSS112 69753 58383252
GSS113 68407 61327909
GSS114 60910 57540026
GSS115 109186 67571499
GSS116 122710 75709854
GSS117 117556 75979309
GSS118 92447 50325096
GSS119 96990 53827120
GSS12 74399 38991365
GSS120 79353 36672333
GSS13 74980 37675541
GSS14 72504 32437469
GSS15 73586 37366049
GSS16 75297 43832061
GSS17 70274 32350000
GSS18 57513 29348359
GSS19 57689 28842774
GSS2 89911 39770217
GSS20 58964 25525692
GSS21 63576 38692539
GSS22 63506 30000253
GSS23 58830 29903353
GSS24 72195 43169852
GSS25 63150 24489580
GSS26 58277 27275425
GSS27 74979 35066896
GSS28 56768 31099709
GSS29 91011 43131410
GSS3 88259 42112549
GSS30 77949 40609029
GSS31 74176 43657341
GSS32 71239 43900763
GSS33 81481 39840298
GSS34 76556 40898086
GSS35 81724 47351293
GSS36 94348 62695442
GSS37 90044 51027562
GSS38 94334 58023028
GSS39 83458 37205379
GSS4 79835 41569605
GSS40 86816 36528335
GSS41 82247 49803303
GSS42 81094 57562630
GSS43 74934 51479717
GSS44 72784 48103351
GSS45 72936 47821294
GSS46 81016 39462120
GSS47 83753 52765310
GSS48 91989 64550669
GSS49 80757 60505133
GSS5 79679 41077181
GSS50 93342 56772972
GSS51 89077 58163905
GSS52 79355 48140123
GSS53 72687 37520684
GSS54 88385 52562476
GSS55 88117 55230054
GSS56 79989 62659685
GSS57 72111 79149948
GSS58 84105 70980286
GSS59 91782 63772652
GSS6 78380 39036312
GSS60 65136 44139742
GSS61 64845 44893480
GSS62 89564 66622969
GSS63 87130 61013044
GSS64 87227 53223991
GSS65 88572 57673367
GSS66 96615 59462144
GSS67 101124 54437580
GSS68 100877 54749876
GSS69 101684 53732896
GSS7 77254 39700611
GSS70 102838 52273328
GSS71 102730 52411611
GSS72 102855 52252578
GSS73 102511 52686966
GSS74 99976 55866837
GSS75 90305 69261869
GSS76 89847 70763891
GSS77 88503 69921158
GSS78 88105 69873926
GSS79 89673 63071009
GSS8 77182 38154196
GSS80 83634 30443346
GSS81 79072 24762955
GSS82 87241 35658279
GSS83 83235 48540739
GSS84 81467 48207866
GSS85 89587 64021810
GSS86 79944 61475818
GSS87 77586 79452355
GSS88 78466 59212884
GSS89 91621 54343566
GSS9 72967 37474434
GSS90 75688 40671989
GSS91 86331 51973904
GSS92 70865 60451169
GSS93 85977 52732490
GSS94 83392 61218159
GSS95 86434 57592259
GSS96 85053 54888925
GSS97 87133 60864541
GSS98 81541 65215934
GSS99 4892 2737001
HTC1 32052 55423415
HTC2 31834 67306459
HTC3 84295 76248893
HTC4 67718 87710921
HTC5 96597 94855833
HTC6 8885 17673379
HTG1 1330 190640842
HTG10 1270 188957371
HTG11 1437 187537183
HTG12 876 192233652
HTG13 752 192626252
HTG14 742 192577819
HTG15 777 192351391
HTG16 804 192371487
HTG17 768 192532820
HTG18 2006 179786324
HTG19 1056 190341791
HTG2 2590 188251427
HTG20 1202 188543500
HTG21 837 191938164
HTG22 789 192321895
HTG23 953 191352423
HTG24 901 191525904
HTG25 864 191675326
HTG26 776 192319525
HTG27 874 191912603
HTG28 842 192180537
HTG29 910 191709985
HTG3 2483 188004879
HTG30 973 191072698
HTG31 933 191293948
HTG32 962 191286563
HTG33 912 191623726
HTG34 895 191986660
HTG35 983 191042130
HTG36 913 191482615
HTG37 861 192043833
HTG38 828 192074672
HTG39 872 191844103
HTG4 2509 189778897
HTG40 934 191340238
HTG41 974 191673869
HTG42 948 191308648
HTG43 1024 190797771
HTG44 1171 189355125
HTG45 1141 190094000
HTG46 1291 189904716
HTG47 1132 191123523
HTG48 1136 189999342
HTG49 1140 191475617
HTG5 1295 188276161
HTG50 1273 191682721
HTG51 1187 192074259
HTG52 1264 192043146
HTG53 1176 191855548
HTG54 1228 191634281
HTG55 1113 193175562
HTG56 1207 190988150
HTG57 1028 192397734
HTG58 1015 193678940
HTG59 1113 193213886
HTG6 1287 188013373
HTG60 1059 193508102
HTG61 1060 191474378
HTG62 97 11281323
HTG7 1265 187987809
HTG8 1302 187649886
HTG9 1188 189602803
INV1 13776 167223738
INV2 1396 168362351
INV3 54199 95229406
INV4 71599 77079797
INV5 60394 92156951
INV6 42323 105654307
INV7 1399 14828703
MAM1 62936 100485010
MAM2 1313 1249961
PAT1 223007 70310076
PAT10 96436 61627551
PAT11 139458 54223802
PAT12 150196 60442426
PAT13 146642 91300519
PAT14 114802 115822407
PAT15 107918 114176850
PAT16 104975 35121750
PAT2 199673 89396508
PAT3 178646 100048878
PAT4 148139 85856756
PAT5 113118 114419904
PAT6 142481 93775501
PAT7 132054 98019583
PAT8 141535 86974456
PAT9 121521 50121286
PHG 2743 13301055
PLN1 29219 128780553
PLN10 68341 79196952
PLN11 28768 127440795
PLN12 40721 113328508
PLN13 16295 38149403
PLN2 1386 181244497
PLN3 47780 111930884
PLN4 76547 78668253
PLN5 39888 49656705
PLN6 13736 127199372
PLN7 1298 169241265
PLN8 40060 100226292
PLN9 68983 69085287
PRI1 17950 151200670
PRI10 1413 176256693
PRI11 1271 175515395
PRI12 1495 175314834
PRI13 1597 178635467
PRI14 1516 184505527
PRI15 25627 149374544
PRI16 41730 92955673
PRI17 12220 150941720
PRI18 1574 180188747
PRI19 1741 181334314
PRI2 1420 172996996
PRI20 2187 187091088
PRI21 1540 187034976
PRI22 37658 125540807
PRI23 34506 74618334
PRI24 5495 183035790
PRI25 20711 149581955
PRI26 53315 111383176
PRI27 40948 122719370
PRI28 19965 25143504
PRI3 1256 182556589
PRI4 1295 178060352
PRI5 1143 173731112
PRI6 1202 178978958
PRI7 1212 177409476
PRI8 1329 169467687
PRI9 1221 177592456
ROD1 8644 171061630
ROD10 1200 194456334
ROD11 1246 193317908
ROD12 21093 159459279
ROD13 23840 101624216
ROD14 45968 97066473
ROD2 896 174235248
ROD3 898 175014813
ROD4 953 176772018
ROD5 967 180279417
ROD6 991 181025195
ROD7 1017 183233853
ROD8 1015 183844983
ROD9 26711 148433001
STS1 89119 47962082
STS2 75265 31236035
STS3 95251 37984675
STS4 85791 35572399
STS5 33945 15122955
SYN 14435 22352243
UNA 1394 639768
VRL1 72952 65311279
VRL2 73279 65601063
VRL3 73854 66523546
VRL4 30131 33686045
VRT1 64611 95653239
VRT2 5771 172885749
VRT3 65857 67503828
VRT4 8288 165760242
VRT5 1291 193894638
VRT6 23572 159322501
VRT7 25522 29353188
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 144.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
8338229 10965381932 Homo sapiens
6071679 6774229516 Mus musculus
985869 5644398664 Rattus norvegicus
771409 1957414191 Danio rerio
2292596 1455760045 Zea mays
336051 779829843 Oryza sativa (japonica cultivar-group)
482102 754291835 Drosophila melanogaster
884892 650653065 Bos taurus
697037 605802046 Gallus gallus
845876 584114192 Arabidopsis thaliana
1015724 582919466 Canis familiaris
560218 464627420 Xenopus tropicalis
193505 439544237 Pan troglodytes
693084 418098823 Ciona intestinalis
595915 403897848 Brassica oleracea
55192 372152352 Macaca mulatta
348369 327501222 Medicago truncatula
570595 311942146 Triticum aestivum
455955 298427470 Xenopus laevis
309719 283634604 Caenorhabditis elegans
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002.
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2004
NCBI-GenBank Flat File Release 144.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:
ftp://genbank.sdsc.edu/pub
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 144.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark, Irene Fang,
Linda Frisse, Michael Fetchko, Anjanette Johnston, William Klimke,
Pierre Ledoux, Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis,
Chris O'Sullivan, Leigh Riley, Gert Roosen, MJ Rosovitz, Susan Schafer,
Suh-suh Wang, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Anton Butanaev, Mark Cavanaugh,
Hsiu-Chuan Chen, Olga Cherenkov, Jonathan Kans, Michael Kimelman,
Jim Ostell, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Carolyn Tolstoshev, Jane Weisemann,
Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
Monica Romiti, Eric Sayers, Tao Tao, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
