Release Notes For GenBank Release 147
GBREL.TXT Genetic Sequence Data Bank
April 15 2005
NCBI-GenBank Flat File Release 147.0
Distribution Release Notes
44202133 loci, 48235738567 bases, from 44202133 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 147.0
1.2 Cutoff Date
1.3 Important Changes in Release 147.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 147.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 147.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 147.0, incorporates data available to the collaborating
databases as of April 20, 2005 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 147.0
1.3.1 ENV Division introduced with April 2005 release
A new division for sequences obtained via environmental sampling methods
has been introduced with GenBank Release 147.0 . This new division segregates
128,571 sequences for which the source organism is unknown, or can only be
inferred by sequence comparison. The new sequence files are:
gbenv1.seq
gbenv2.seq
Records in the ENV division have these characteristics:
1. ENV division code on the LOCUS line
2. /environmental_sample qualifier for the source feature
And, as of Release 148.0 in June, these records will also have an ENV keyword.
Note that sequences from WGS projects that involve environmental sampling
will *not* be distributed via this new division. All WGS projects continue
to be distributed using project-specific data files at the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
1.3.2 Removal of MEDLINE linetype as of April 2005 release
The PUBMED linetype was introduced in December of 1997, as a means of
linking references in sequence records to the PubMed biomedical literature
database, based on a PubMed ID (PMID) .
Since then, we have been displaying both the PMID and its predecessor
(Medline Unique ID / MUID) for all references. For example :
LOCUS ECOGUABA 3531 bp DNA linear BCT
09-FEB-2005
DEFINITION Escherichia coli guaBA operon operon, complete sequence.
ACCESSION M10101 M10102
VERSION M10101.1 GI:146274
....
REFERENCE 1 (bases 1768 to 3531)
AUTHORS Tiedeman,A.A., Smith,J.M. and Zalkin,H.
TITLE Nucleotide sequence of the guaA gene encoding GMP synthetase of
Escherichia coli K12
JOURNAL J. Biol. Chem. 260 (15), 8676-8679 (1985)
MEDLINE 85261223
PUBMED 3894345
Subsequent to 1997, PMID article identifiers subsumed MUIDs. Some background
information about that evolution can be found at:
http://www.nlm.nih.gov/pubs/techbull/mj01/mj01_medline_ui.html
Starting with GenBank Release 147.0, the older MEDLINE linetype is displayed
in GenBank sequence records only for very rare articles that lack a PMID
identifier.
For the vast majority of articles, this means that only the PUBMED identifier
is now presented.
1.3.3 Problems generating accession number and keyword indexes
Software problems during Release 147.0 prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.
A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .
The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 147.0 .
Our apologies for any inconvenience that this may cause.
1.3.4 Organizational changes
The total number of sequence data files increased by 25 with this release:
- the ENV division is now comprised of 2 files (+2)
- the EST division is now comprised of 388 files (+11)
- the GSS division is now comprised of 142 files (+4)
- the PLN division is now comprised of 16 files (+1)
- the ROD division is now comprised of 18 files (+2)
- the STS division is now comprised of 14 files (+5)
1.3.5 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
twenty-five GSS flatfiles in Release 147.0. Consider gbgss117.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
April 15 2005
NCBI-GenBank Flat File Release 147.0
GSS Sequences (Part 1)
87197 loci, 64745577 bases, from 87197 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "117" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
No substantive changes are anticipated for GenBank Release 148.0 .
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 769 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut4.idx - Index of the entries according to accession number, part 4.
26. gbaut5.idx - Index of the entries according to accession number, part 5.
27. gbaut6.idx - Index of the entries according to accession number, part 6.
28. gbaut7.idx - Index of the entries according to accession number, part 7.
29. gbaut8.idx - Index of the entries according to accession number, part 8.
30. gbaut9.idx - Index of the entries according to accession number, part 9.
31. gbbct1.seq - Bacterial sequence entries, part 1.
32. gbbct10.seq - Bacterial sequence entries, part 10.
33. gbbct11.seq - Bacterial sequence entries, part 11.
34. gbbct2.seq - Bacterial sequence entries, part 2.
35. gbbct3.seq - Bacterial sequence entries, part 3.
36. gbbct4.seq - Bacterial sequence entries, part 4.
37. gbbct5.seq - Bacterial sequence entries, part 5.
38. gbbct6.seq - Bacterial sequence entries, part 6.
39. gbbct7.seq - Bacterial sequence entries, part 7.
40. gbbct8.seq - Bacterial sequence entries, part 8.
41. gbbct9.seq - Bacterial sequence entries, part 9.
42. gbchg.txt - Accession numbers of entries updated since the previous release.
43. gbcon.seq - Constructed sequence entries.
44. gbdel.txt - Accession numbers of entries deleted since the previous release.
45. gbenv1.seq - Environmental sampling sequence entries, part 1.
46. gbenv2.seq - Environmental sampling sequence entries, part 2.
47. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
48. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
49. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
50. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
51. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
52. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
53. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
54. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
55. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
56. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
57. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
58. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
59. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
60. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
61. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
62. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
63. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
64. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
65. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
66. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
67. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
68. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
69. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
70. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
71. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
72. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
73. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
74. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
75. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
76. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
77. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
78. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
79. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
80. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
81. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
82. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
83. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
84. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
85. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
86. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
87. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
88. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
89. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
90. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
91. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
92. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
93. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
94. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
95. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
96. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
97. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
98. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
99. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
100. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
101. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
102. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
103. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
104. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
105. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
106. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
107. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
108. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
109. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
110. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
111. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
112. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
113. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
114. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
115. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
116. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
117. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
118. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
119. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
120. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
121. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
122. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
123. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
124. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
125. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
126. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
127. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
128. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
129. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
130. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
131. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
132. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
133. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
134. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
135. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
136. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
137. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
138. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
139. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
140. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
141. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
142. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
143. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
144. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
145. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
146. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
147. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
148. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
149. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
150. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
151. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
152. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
153. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
154. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
155. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
156. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
157. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
158. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
159. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
160. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
161. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
162. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
163. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
164. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
165. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
166. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
167. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
168. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
169. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
170. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
171. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
172. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
173. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
174. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
175. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
176. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
177. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
178. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
179. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
180. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
181. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
182. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
183. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
184. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
185. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
186. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
187. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
188. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
189. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
190. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
191. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
192. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
193. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
194. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
195. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
196. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
197. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
198. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
199. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
200. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
201. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
202. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
203. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
204. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
205. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
206. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
207. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
208. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
209. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
210. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
211. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
212. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
213. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
214. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
215. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
216. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
217. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
218. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
219. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
220. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
221. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
222. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
223. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
224. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
225. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
226. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
227. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
228. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
229. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
230. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
231. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
232. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
233. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
234. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
235. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
236. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
237. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
238. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
239. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
240. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
241. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
242. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
243. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
244. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
245. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
246. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
247. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
248. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
249. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
250. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
251. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
252. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
253. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
254. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
255. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
256. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
257. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
258. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
259. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
260. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
261. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
262. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
263. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
264. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
265. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
266. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
267. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
268. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
269. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
270. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
271. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
272. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
273. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
274. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
275. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
276. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
277. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
278. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
279. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
280. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
281. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
282. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
283. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
284. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
285. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
286. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
287. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
288. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
289. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
290. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
291. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
292. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
293. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
294. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
295. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
296. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
297. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
298. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
299. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
300. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
301. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
302. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
303. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
304. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
305. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
306. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
307. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
308. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
309. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
310. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
311. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
312. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
313. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
314. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
315. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
316. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
317. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
318. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
319. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
320. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
321. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
322. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
323. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
324. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
325. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
326. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
327. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
328. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
329. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
330. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
331. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
332. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
333. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
334. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
335. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
336. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
337. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
338. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
339. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
340. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
341. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
342. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
343. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
344. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
345. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
346. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
347. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
348. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
349. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
350. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
351. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
352. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
353. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
354. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
355. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
356. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
357. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
358. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
359. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
360. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
361. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
362. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
363. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
364. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
365. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
366. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
367. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
368. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
369. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
370. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
371. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
372. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
373. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
374. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
375. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
376. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
377. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
378. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
379. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
380. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
381. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
382. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
383. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
384. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
385. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
386. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
387. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
388. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
389. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
390. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
391. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
392. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
393. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
394. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
395. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
396. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
397. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
398. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
399. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
400. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
401. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
402. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
403. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
404. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
405. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
406. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
407. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
408. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
409. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
410. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
411. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
412. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
413. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
414. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
415. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
416. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
417. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
418. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
419. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
420. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
421. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
422. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
423. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
424. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
425. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
426. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
427. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
428. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
429. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
430. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
431. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
432. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
433. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
434. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
435. gbgen.idx - Index of the entries according to gene symbols.
436. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
437. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
438. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
439. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
440. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
441. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
442. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
443. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
444. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
445. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
446. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
447. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
448. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
449. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
450. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
451. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
452. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
453. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
454. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
455. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
456. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
457. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
458. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
459. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
460. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
461. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
462. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
463. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
464. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
465. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
466. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
467. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
468. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
469. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
470. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
471. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
472. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
473. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
474. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
475. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
476. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
477. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
478. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
479. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
480. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
481. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
482. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
483. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
484. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
485. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
486. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
487. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
488. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
489. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
490. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
491. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
492. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
493. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
494. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
495. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
496. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
497. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
498. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
499. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
500. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
501. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
502. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
503. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
504. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
505. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
506. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
507. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
508. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
509. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
510. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
511. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
512. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
513. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
514. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
515. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
516. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
517. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
518. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
519. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
520. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
521. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
522. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
523. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
524. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
525. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
526. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
527. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
528. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
529. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
530. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
531. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
532. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
533. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
534. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
535. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
536. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
537. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
538. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
539. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
540. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
541. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
542. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
543. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
544. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
545. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
546. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
547. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
548. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
549. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
550. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
551. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
552. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
553. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
554. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
555. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
556. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
557. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
558. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
559. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
560. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
561. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
562. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
563. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
564. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
565. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
566. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
567. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
568. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
569. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
570. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
571. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
572. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
573. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
574. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
575. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
576. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
577. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
578. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
579. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
580. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
581. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
582. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
583. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
584. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
585. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
586. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
587. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
588. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
589. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
590. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
591. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
592. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
593. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
594. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
595. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
596. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
597. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
598. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
599. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
600. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
601. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
602. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
603. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
604. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
605. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
606. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
607. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
608. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
609. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
610. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
611. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
612. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
613. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
614. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
615. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
616. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
617. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
618. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
619. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
620. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
621. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
622. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
623. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
624. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
625. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
626. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
627. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
628. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
629. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
630. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
631. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
632. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
633. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
634. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
635. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
636. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
637. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
638. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
639. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
640. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
641. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
642. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
643. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
644. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
645. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
646. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
647. gbinv1.seq - Invertebrate sequence entries, part 1.
648. gbinv2.seq - Invertebrate sequence entries, part 2.
649. gbinv3.seq - Invertebrate sequence entries, part 3.
650. gbinv4.seq - Invertebrate sequence entries, part 4.
651. gbinv5.seq - Invertebrate sequence entries, part 5.
652. gbinv6.seq - Invertebrate sequence entries, part 6.
653. gbinv7.seq - Invertebrate sequence entries, part 7.
654. gbjou.idx - Index of the entries according to journal citation.
655. gbkey.idx - Index of the entries according to keyword phrase.
656. gbmam1.seq - Other mammalian sequence entries, part 1.
657. gbmam2.seq - Other mammalian sequence entries, part 2.
658. gbnew.txt - Accession numbers of entries new since the previous release.
659. gbpat1.seq - Patent sequence entries, part 1.
660. gbpat10.seq - Patent sequence entries, part 10.
661. gbpat11.seq - Patent sequence entries, part 11.
662. gbpat12.seq - Patent sequence entries, part 12.
663. gbpat13.seq - Patent sequence entries, part 13.
664. gbpat14.seq - Patent sequence entries, part 14.
665. gbpat15.seq - Patent sequence entries, part 15.
666. gbpat16.seq - Patent sequence entries, part 16.
667. gbpat17.seq - Patent sequence entries, part 17.
668. gbpat2.seq - Patent sequence entries, part 2.
669. gbpat3.seq - Patent sequence entries, part 3.
670. gbpat4.seq - Patent sequence entries, part 4.
671. gbpat5.seq - Patent sequence entries, part 5.
672. gbpat6.seq - Patent sequence entries, part 6.
673. gbpat7.seq - Patent sequence entries, part 7.
674. gbpat8.seq - Patent sequence entries, part 8.
675. gbpat9.seq - Patent sequence entries, part 9.
676. gbphg.seq - Phage sequence entries.
677. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
678. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
679. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
680. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
681. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
682. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
683. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
684. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
685. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
686. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
687. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
688. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
689. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
690. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
691. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
692. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
693. gbpri1.seq - Primate sequence entries, part 1.
694. gbpri10.seq - Primate sequence entries, part 10.
695. gbpri11.seq - Primate sequence entries, part 11.
696. gbpri12.seq - Primate sequence entries, part 12.
697. gbpri13.seq - Primate sequence entries, part 13.
698. gbpri14.seq - Primate sequence entries, part 14.
699. gbpri15.seq - Primate sequence entries, part 15.
700. gbpri16.seq - Primate sequence entries, part 16.
701. gbpri17.seq - Primate sequence entries, part 17.
702. gbpri18.seq - Primate sequence entries, part 18.
703. gbpri19.seq - Primate sequence entries, part 19.
704. gbpri2.seq - Primate sequence entries, part 2.
705. gbpri20.seq - Primate sequence entries, part 20.
706. gbpri21.seq - Primate sequence entries, part 21.
707. gbpri22.seq - Primate sequence entries, part 22.
708. gbpri23.seq - Primate sequence entries, part 23.
709. gbpri24.seq - Primate sequence entries, part 24.
710. gbpri25.seq - Primate sequence entries, part 25.
711. gbpri26.seq - Primate sequence entries, part 26.
712. gbpri27.seq - Primate sequence entries, part 27.
713. gbpri28.seq - Primate sequence entries, part 28.
714. gbpri3.seq - Primate sequence entries, part 3.
715. gbpri4.seq - Primate sequence entries, part 4.
716. gbpri5.seq - Primate sequence entries, part 5.
717. gbpri6.seq - Primate sequence entries, part 6.
718. gbpri7.seq - Primate sequence entries, part 7.
719. gbpri8.seq - Primate sequence entries, part 8.
720. gbpri9.seq - Primate sequence entries, part 9.
721. gbrel.txt - Release notes (this document).
722. gbrod1.seq - Rodent sequence entries, part 1.
723. gbrod10.seq - Rodent sequence entries, part 10.
724. gbrod11.seq - Rodent sequence entries, part 11.
725. gbrod12.seq - Rodent sequence entries, part 12.
726. gbrod13.seq - Rodent sequence entries, part 13.
727. gbrod14.seq - Rodent sequence entries, part 14.
728. gbrod15.seq - Rodent sequence entries, part 15.
729. gbrod16.seq - Rodent sequence entries, part 16.
730. gbrod17.seq - Rodent sequence entries, part 17.
731. gbrod18.seq - Rodent sequence entries, part 18.
732. gbrod2.seq - Rodent sequence entries, part 2.
733. gbrod3.seq - Rodent sequence entries, part 3.
734. gbrod4.seq - Rodent sequence entries, part 4.
735. gbrod5.seq - Rodent sequence entries, part 5.
736. gbrod6.seq - Rodent sequence entries, part 6.
737. gbrod7.seq - Rodent sequence entries, part 7.
738. gbrod8.seq - Rodent sequence entries, part 8.
739. gbrod9.seq - Rodent sequence entries, part 9.
740. gbsdr.txt - Short directory of the data bank.
741. gbsec.idx - Index of the entries according to secondary accession number.
742. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
743. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
744. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
745. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
746. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
747. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
748. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
749. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
750. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
751. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
752. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
753. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
754. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
755. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
756. gbsyn.seq - Synthetic and chimeric sequence entries.
757. gbuna.seq - Unannotated sequence entries.
758. gbvrl1.seq - Viral sequence entries, part 1.
759. gbvrl2.seq - Viral sequence entries, part 2.
760. gbvrl3.seq - Viral sequence entries, part 3.
761. gbvrl4.seq - Viral sequence entries, part 4.
762. gbvrt1.seq - Other vertebrate sequence entries, part 1.
763. gbvrt2.seq - Other vertebrate sequence entries, part 2.
764. gbvrt3.seq - Other vertebrate sequence entries, part 3.
765. gbvrt4.seq - Other vertebrate sequence entries, part 4.
766. gbvrt5.seq - Other vertebrate sequence entries, part 5.
767. gbvrt6.seq - Other vertebrate sequence entries, part 6.
768. gbvrt7.seq - Other vertebrate sequence entries, part 7.
769. gbvrt8.seq - Other vertebrate sequence entries, part 8.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 147.0 flatfiles require roughly 168 GB (sequence
files only) or 185 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1362872885 gbacc.idx
500044306 gbaut1.idx
513151904 gbaut10.idx
500322600 gbaut11.idx
513852887 gbaut12.idx
502192746 gbaut13.idx
553555654 gbaut14.idx
500023012 gbaut15.idx
500712798 gbaut16.idx
508035734 gbaut17.idx
514639658 gbaut18.idx
500013929 gbaut19.idx
534374721 gbaut2.idx
516192826 gbaut20.idx
509958965 gbaut21.idx
500007767 gbaut22.idx
509145333 gbaut23.idx
502211769 gbaut24.idx
507543431 gbaut25.idx
515458640 gbaut26.idx
503178597 gbaut27.idx
527807875 gbaut28.idx
123865396 gbaut29.idx
518070976 gbaut3.idx
500204324 gbaut4.idx
504306810 gbaut5.idx
517577836 gbaut6.idx
500185182 gbaut7.idx
542178019 gbaut8.idx
500103716 gbaut9.idx
250026957 gbbct1.seq
250008592 gbbct10.seq
31449371 gbbct11.seq
250016610 gbbct2.seq
250564828 gbbct3.seq
250063358 gbbct4.seq
250002482 gbbct5.seq
253394169 gbbct6.seq
250511671 gbbct7.seq
250403005 gbbct8.seq
250001885 gbbct9.seq
5040894 gbchg.txt
1145341037 gbcon.seq
458429 gbdel.txt
250000178 gbenv1.seq
77385237 gbenv2.seq
230690163 gbest1.seq
230687592 gbest10.seq
230687971 gbest100.seq
230690080 gbest101.seq
230690419 gbest102.seq
230688096 gbest103.seq
230689730 gbest104.seq
230690163 gbest105.seq
230689201 gbest106.seq
230688835 gbest107.seq
230688702 gbest108.seq
230688703 gbest109.seq
230689908 gbest11.seq
230027643 gbest110.seq
230688195 gbest111.seq
230689669 gbest112.seq
230688768 gbest113.seq
230689995 gbest114.seq
230689983 gbest115.seq
230690210 gbest116.seq
230688896 gbest117.seq
230688759 gbest118.seq
230689437 gbest119.seq
230689779 gbest12.seq
230688370 gbest120.seq
230689725 gbest121.seq
230687813 gbest122.seq
230689851 gbest123.seq
230688586 gbest124.seq
227219750 gbest125.seq
230687891 gbest126.seq
230688689 gbest127.seq
230688641 gbest128.seq
230689583 gbest129.seq
230688912 gbest13.seq
230689716 gbest130.seq
230691514 gbest131.seq
230687613 gbest132.seq
230689807 gbest133.seq
230690477 gbest134.seq
230688554 gbest135.seq
230688440 gbest136.seq
230687905 gbest137.seq
230689653 gbest138.seq
230687893 gbest139.seq
230688707 gbest14.seq
230691411 gbest140.seq
230688150 gbest141.seq
230688875 gbest142.seq
230689007 gbest143.seq
230688214 gbest144.seq
230688604 gbest145.seq
230689573 gbest146.seq
230690980 gbest147.seq
230688979 gbest148.seq
230688500 gbest149.seq
230689239 gbest15.seq
230689854 gbest150.seq
230689784 gbest151.seq
230691183 gbest152.seq
230695843 gbest153.seq
230688461 gbest154.seq
230691432 gbest155.seq
230689320 gbest156.seq
230690750 gbest157.seq
230688412 gbest158.seq
230689529 gbest159.seq
230688783 gbest16.seq
230688126 gbest160.seq
230687455 gbest161.seq
230688163 gbest162.seq
230689685 gbest163.seq
230687943 gbest164.seq
230688618 gbest165.seq
230687969 gbest166.seq
230687866 gbest167.seq
221926185 gbest168.seq
230688430 gbest169.seq
230688955 gbest17.seq
230689381 gbest170.seq
230687984 gbest171.seq
230689358 gbest172.seq
230690498 gbest173.seq
230690441 gbest174.seq
230689441 gbest175.seq
230690422 gbest176.seq
230689238 gbest177.seq
230688539 gbest178.seq
230687711 gbest179.seq
230689897 gbest18.seq
230689657 gbest180.seq
230688320 gbest181.seq
230689103 gbest182.seq
230690958 gbest183.seq
230689053 gbest184.seq
230689431 gbest185.seq
230691274 gbest186.seq
230689614 gbest187.seq
230688589 gbest188.seq
230689300 gbest189.seq
230688246 gbest19.seq
230688915 gbest190.seq
230689220 gbest191.seq
230688622 gbest192.seq
230688946 gbest193.seq
230691231 gbest194.seq
230688703 gbest195.seq
230690231 gbest196.seq
230689846 gbest197.seq
230688285 gbest198.seq
230689831 gbest199.seq
230689286 gbest2.seq
230689324 gbest20.seq
230689636 gbest200.seq
230687804 gbest201.seq
230688736 gbest202.seq
230688013 gbest203.seq
230687727 gbest204.seq
230688397 gbest205.seq
230688250 gbest206.seq
230690336 gbest207.seq
230689210 gbest208.seq
230688184 gbest209.seq
230689766 gbest21.seq
230688533 gbest210.seq
230689698 gbest211.seq
230691065 gbest212.seq
230688458 gbest213.seq
175456413 gbest214.seq
162537606 gbest215.seq
164571082 gbest216.seq
171041292 gbest217.seq
169647373 gbest218.seq
163464979 gbest219.seq
230689982 gbest22.seq
165054110 gbest220.seq
164614711 gbest221.seq
164085117 gbest222.seq
164559459 gbest223.seq
164075358 gbest224.seq
164136304 gbest225.seq
162914144 gbest226.seq
168237046 gbest227.seq
162311408 gbest228.seq
163243874 gbest229.seq
230688539 gbest23.seq
167508714 gbest230.seq
167534411 gbest231.seq
165828352 gbest232.seq
165684028 gbest233.seq
165324256 gbest234.seq
165136373 gbest235.seq
164238411 gbest236.seq
164197212 gbest237.seq
165145130 gbest238.seq
165401007 gbest239.seq
230689923 gbest24.seq
180728509 gbest240.seq
171884761 gbest241.seq
190084819 gbest242.seq
230690272 gbest243.seq
230690295 gbest244.seq
230689673 gbest245.seq
230689943 gbest246.seq
230688791 gbest247.seq
230689893 gbest248.seq
230688151 gbest249.seq
230690161 gbest25.seq
230687952 gbest250.seq
230688395 gbest251.seq
230689511 gbest252.seq
230690052 gbest253.seq
230690210 gbest254.seq
230689628 gbest255.seq
230689095 gbest256.seq
230689028 gbest257.seq
230687480 gbest258.seq
230689552 gbest259.seq
230689887 gbest26.seq
230690801 gbest260.seq
230688503 gbest261.seq
230687726 gbest262.seq
230689931 gbest263.seq
230688615 gbest264.seq
230688689 gbest265.seq
230688604 gbest266.seq
230689129 gbest267.seq
230687580 gbest268.seq
230689104 gbest269.seq
230690603 gbest27.seq
230689535 gbest270.seq
215745897 gbest271.seq
208541692 gbest272.seq
230689996 gbest273.seq
230689397 gbest274.seq
230688036 gbest275.seq
230689077 gbest276.seq
230690674 gbest277.seq
230688401 gbest278.seq
230688128 gbest279.seq
230687535 gbest28.seq
230690022 gbest280.seq
230688961 gbest281.seq
230687811 gbest282.seq
230689461 gbest283.seq
230691498 gbest284.seq
230687601 gbest285.seq
230687672 gbest286.seq
230690208 gbest287.seq
230687593 gbest288.seq
230690463 gbest289.seq
230688274 gbest29.seq
230688684 gbest290.seq
230689156 gbest291.seq
230689175 gbest292.seq
230688664 gbest293.seq
230689660 gbest294.seq
230688647 gbest295.seq
228674381 gbest296.seq
230689670 gbest297.seq
193989631 gbest298.seq
230688086 gbest299.seq
230689139 gbest3.seq
230689598 gbest30.seq
230687788 gbest300.seq
230689350 gbest301.seq
230690960 gbest302.seq
230690797 gbest303.seq
209756930 gbest304.seq
142757801 gbest305.seq
229390461 gbest306.seq
230688830 gbest307.seq
230687452 gbest308.seq
230688890 gbest309.seq
230688320 gbest31.seq
230689753 gbest310.seq
230688898 gbest311.seq
230687673 gbest312.seq
230690194 gbest313.seq
230689232 gbest314.seq
230688652 gbest315.seq
230689353 gbest316.seq
230687690 gbest317.seq
230687506 gbest318.seq
230687702 gbest319.seq
230689032 gbest32.seq
230694528 gbest320.seq
230687676 gbest321.seq
230688302 gbest322.seq
230689581 gbest323.seq
230687931 gbest324.seq
230688157 gbest325.seq
230688629 gbest326.seq
230688180 gbest327.seq
230687618 gbest328.seq
230689491 gbest329.seq
230689944 gbest33.seq
230691153 gbest330.seq
230688995 gbest331.seq
230690908 gbest332.seq
230687918 gbest333.seq
230688503 gbest334.seq
230688674 gbest335.seq
230688673 gbest336.seq
230690275 gbest337.seq
230687636 gbest338.seq
230689472 gbest339.seq
230688298 gbest34.seq
230688537 gbest340.seq
230689087 gbest341.seq
230690847 gbest342.seq
230688751 gbest343.seq
230690666 gbest344.seq
230689337 gbest345.seq
230687780 gbest346.seq
230690817 gbest347.seq
230688236 gbest348.seq
230692937 gbest349.seq
230688951 gbest35.seq
230689739 gbest350.seq
230690220 gbest351.seq
230687790 gbest352.seq
216856515 gbest353.seq
230689976 gbest354.seq
230687527 gbest355.seq
230690385 gbest356.seq
230687979 gbest357.seq
230688759 gbest358.seq
230689566 gbest359.seq
230688585 gbest36.seq
230688130 gbest360.seq
230688967 gbest361.seq
230693762 gbest362.seq
230689679 gbest363.seq
230688799 gbest364.seq
230688673 gbest365.seq
230691052 gbest366.seq
230690272 gbest367.seq
230689180 gbest368.seq
230688018 gbest369.seq
230687996 gbest37.seq
230691827 gbest370.seq
230688970 gbest371.seq
230688854 gbest372.seq
230688505 gbest373.seq
230688348 gbest374.seq
230689898 gbest375.seq
230689048 gbest376.seq
230696607 gbest377.seq
230688408 gbest378.seq
230690283 gbest379.seq
230687806 gbest38.seq
230688840 gbest380.seq
230688121 gbest381.seq
230688489 gbest382.seq
230689057 gbest383.seq
230687860 gbest384.seq
230688626 gbest385.seq
216010821 gbest386.seq
230688415 gbest387.seq
156438857 gbest388.seq
192409693 gbest39.seq
230689160 gbest4.seq
191419751 gbest40.seq
209950313 gbest41.seq
216311216 gbest42.seq
215999021 gbest43.seq
216805005 gbest44.seq
230687723 gbest45.seq
230688470 gbest46.seq
230690021 gbest47.seq
226847066 gbest48.seq
230687774 gbest49.seq
164511675 gbest5.seq
230687513 gbest50.seq
230688291 gbest51.seq
230688338 gbest52.seq
230690176 gbest53.seq
230689217 gbest54.seq
230687991 gbest55.seq
230688348 gbest56.seq
230689962 gbest57.seq
230689857 gbest58.seq
230688048 gbest59.seq
177384218 gbest6.seq
230688913 gbest60.seq
230690522 gbest61.seq
230687756 gbest62.seq
230688379 gbest63.seq
215828463 gbest64.seq
209384182 gbest65.seq
209003614 gbest66.seq
209026803 gbest67.seq
209374876 gbest68.seq
210774505 gbest69.seq
230690394 gbest7.seq
209185827 gbest70.seq
208802124 gbest71.seq
210082180 gbest72.seq
209886356 gbest73.seq
205203129 gbest74.seq
207661509 gbest75.seq
207102910 gbest76.seq
209468078 gbest77.seq
220705645 gbest78.seq
230689281 gbest79.seq
230688585 gbest8.seq
230692317 gbest80.seq
225613357 gbest81.seq
216508064 gbest82.seq
213726819 gbest83.seq
224497404 gbest84.seq
230689317 gbest85.seq
230688900 gbest86.seq
230687895 gbest87.seq
230690858 gbest88.seq
230688547 gbest89.seq
230688014 gbest9.seq
230690490 gbest90.seq
230689568 gbest91.seq
230690081 gbest92.seq
230688253 gbest93.seq
230687512 gbest94.seq
230690421 gbest95.seq
230688675 gbest96.seq
230690266 gbest97.seq
230690008 gbest98.seq
230688511 gbest99.seq
45499850 gbgen.idx
230689728 gbgss1.seq
230687880 gbgss10.seq
226503119 gbgss100.seq
227941089 gbgss101.seq
227870908 gbgss102.seq
227819020 gbgss103.seq
226941648 gbgss104.seq
226665562 gbgss105.seq
230689051 gbgss106.seq
230688978 gbgss107.seq
230689110 gbgss108.seq
230688688 gbgss109.seq
230691125 gbgss11.seq
230689148 gbgss110.seq
230689035 gbgss111.seq
230687932 gbgss112.seq
230687800 gbgss113.seq
230688811 gbgss114.seq
230688098 gbgss115.seq
195934043 gbgss116.seq
250001387 gbgss117.seq
250001740 gbgss118.seq
250002164 gbgss119.seq
230687833 gbgss12.seq
250002893 gbgss120.seq
250000204 gbgss121.seq
250000361 gbgss122.seq
250000134 gbgss123.seq
250000074 gbgss124.seq
250002748 gbgss125.seq
250001147 gbgss126.seq
250002167 gbgss127.seq
250000795 gbgss128.seq
250001109 gbgss129.seq
230689555 gbgss13.seq
250002652 gbgss130.seq
250003644 gbgss131.seq
250002666 gbgss132.seq
250000558 gbgss133.seq
250000989 gbgss134.seq
250001188 gbgss135.seq
250000344 gbgss136.seq
250000301 gbgss137.seq
250000175 gbgss138.seq
250000713 gbgss139.seq
230689439 gbgss14.seq
250001215 gbgss140.seq
243287235 gbgss141.seq
339891 gbgss142.seq
230688179 gbgss15.seq
230688209 gbgss16.seq
230690591 gbgss17.seq
230689322 gbgss18.seq
230690372 gbgss19.seq
230688297 gbgss2.seq
230691457 gbgss20.seq
230689146 gbgss21.seq
230688504 gbgss22.seq
230688493 gbgss23.seq
230688260 gbgss24.seq
230688273 gbgss25.seq
230688031 gbgss26.seq
230689830 gbgss27.seq
230689546 gbgss28.seq
230689684 gbgss29.seq
230689252 gbgss3.seq
230690900 gbgss30.seq
230688530 gbgss31.seq
230688558 gbgss32.seq
230690139 gbgss33.seq
230688465 gbgss34.seq
230689384 gbgss35.seq
230687650 gbgss36.seq
230689567 gbgss37.seq
230688351 gbgss38.seq
230688204 gbgss39.seq
230689122 gbgss4.seq
230689054 gbgss40.seq
230689985 gbgss41.seq
230688842 gbgss42.seq
230690571 gbgss43.seq
230687483 gbgss44.seq
230689765 gbgss45.seq
230687558 gbgss46.seq
230687859 gbgss47.seq
230690084 gbgss48.seq
230688063 gbgss49.seq
230688899 gbgss5.seq
230689023 gbgss50.seq
230688788 gbgss51.seq
230690064 gbgss52.seq
230690123 gbgss53.seq
230688547 gbgss54.seq
230689015 gbgss55.seq
230688317 gbgss56.seq
230689474 gbgss57.seq
230688004 gbgss58.seq
230690160 gbgss59.seq
230687669 gbgss6.seq
230690696 gbgss60.seq
229603545 gbgss61.seq
230688449 gbgss62.seq
230688944 gbgss63.seq
230687741 gbgss64.seq
230688295 gbgss65.seq
230687634 gbgss66.seq
230689678 gbgss67.seq
230688130 gbgss68.seq
230687607 gbgss69.seq
230688480 gbgss7.seq
230688326 gbgss70.seq
230689419 gbgss71.seq
230689222 gbgss72.seq
230689072 gbgss73.seq
230687838 gbgss74.seq
230687460 gbgss75.seq
230688542 gbgss76.seq
230687933 gbgss77.seq
230688403 gbgss78.seq
230688339 gbgss79.seq
230687496 gbgss8.seq
230688965 gbgss80.seq
191963727 gbgss81.seq
193709429 gbgss82.seq
230043712 gbgss83.seq
230689279 gbgss84.seq
230687802 gbgss85.seq
230689788 gbgss86.seq
230687717 gbgss87.seq
230689196 gbgss88.seq
230687737 gbgss89.seq
230687997 gbgss9.seq
230690130 gbgss90.seq
230689549 gbgss91.seq
230690184 gbgss92.seq
230687930 gbgss93.seq
230687676 gbgss94.seq
230689763 gbgss95.seq
230688664 gbgss96.seq
230689217 gbgss97.seq
230688221 gbgss98.seq
230689668 gbgss99.seq
250000406 gbhtc1.seq
250002703 gbhtc2.seq
250000822 gbhtc3.seq
250003189 gbhtc4.seq
250000997 gbhtc5.seq
245923765 gbhtc6.seq
250109543 gbhtg1.seq
250193136 gbhtg10.seq
250014188 gbhtg11.seq
250123369 gbhtg12.seq
250220884 gbhtg13.seq
250299169 gbhtg14.seq
250198982 gbhtg15.seq
250008215 gbhtg16.seq
250249893 gbhtg17.seq
250180580 gbhtg18.seq
250276531 gbhtg19.seq
250059233 gbhtg2.seq
250049009 gbhtg20.seq
250044682 gbhtg21.seq
250087479 gbhtg22.seq
250075064 gbhtg23.seq
250127499 gbhtg24.seq
250096281 gbhtg25.seq
250105369 gbhtg26.seq
250228726 gbhtg27.seq
250012735 gbhtg28.seq
250007509 gbhtg29.seq
250022413 gbhtg3.seq
250147758 gbhtg30.seq
250253008 gbhtg31.seq
250099589 gbhtg32.seq
250038191 gbhtg33.seq
250200656 gbhtg34.seq
250236019 gbhtg35.seq
250167227 gbhtg36.seq
250006814 gbhtg37.seq
250070829 gbhtg38.seq
250284353 gbhtg39.seq
250167821 gbhtg4.seq
250096765 gbhtg40.seq
250026994 gbhtg41.seq
250006065 gbhtg42.seq
250220374 gbhtg43.seq
250021617 gbhtg44.seq
250151600 gbhtg45.seq
250189774 gbhtg46.seq
250110841 gbhtg47.seq
250258270 gbhtg48.seq
250167064 gbhtg49.seq
250083826 gbhtg5.seq
250166121 gbhtg50.seq
250086455 gbhtg51.seq
250018551 gbhtg52.seq
250064622 gbhtg53.seq
250214084 gbhtg54.seq
250099929 gbhtg55.seq
250121359 gbhtg56.seq
250113233 gbhtg57.seq
250040532 gbhtg58.seq
250100504 gbhtg59.seq
250210488 gbhtg6.seq
250278731 gbhtg60.seq
250121981 gbhtg61.seq
250004454 gbhtg62.seq
195071375 gbhtg63.seq
250139724 gbhtg7.seq
250223803 gbhtg8.seq
250036109 gbhtg9.seq
250179134 gbinv1.seq
250112803 gbinv2.seq
250002599 gbinv3.seq
250001058 gbinv4.seq
250002221 gbinv5.seq
250000091 gbinv6.seq
180683601 gbinv7.seq
1137225281 gbjou.idx
250001922 gbmam1.seq
59713783 gbmam2.seq
23319553 gbnew.txt
250001085 gbpat1.seq
250000759 gbpat10.seq
250000604 gbpat11.seq
250000028 gbpat12.seq
250001082 gbpat13.seq
250000737 gbpat14.seq
250001548 gbpat15.seq
250000001 gbpat16.seq
231762097 gbpat17.seq
250002153 gbpat2.seq
250001511 gbpat3.seq
250004561 gbpat4.seq
250000798 gbpat5.seq
250000524 gbpat6.seq
250005228 gbpat7.seq
250001968 gbpat8.seq
250000416 gbpat9.seq
40186746 gbphg.seq
250185858 gbpln1.seq
250145052 gbpln10.seq
250001598 gbpln11.seq
250002329 gbpln12.seq
250073125 gbpln13.seq
250353084 gbpln14.seq
250002916 gbpln15.seq
63209364 gbpln16.seq
250106731 gbpln2.seq
250000113 gbpln3.seq
250001765 gbpln4.seq
250002444 gbpln5.seq
250200668 gbpln6.seq
250125988 gbpln7.seq
266300621 gbpln8.seq
269778888 gbpln9.seq
250016439 gbpri1.seq
250032161 gbpri10.seq
250032279 gbpri11.seq
250006374 gbpri12.seq
250128590 gbpri13.seq
250075089 gbpri14.seq
250017409 gbpri15.seq
250001290 gbpri16.seq
250015934 gbpri17.seq
250061470 gbpri18.seq
250021379 gbpri19.seq
250119317 gbpri2.seq
250080435 gbpri20.seq
250360932 gbpri21.seq
250000738 gbpri22.seq
250002592 gbpri23.seq
250113195 gbpri24.seq
250063547 gbpri25.seq
250000781 gbpri26.seq
250000473 gbpri27.seq
206590654 gbpri28.seq
250016211 gbpri3.seq
250005525 gbpri4.seq
250102194 gbpri5.seq
250043431 gbpri6.seq
250241312 gbpri7.seq
250050508 gbpri8.seq
250014879 gbpri9.seq
185492 gbrel.txt
250092007 gbrod1.seq
250223937 gbrod10.seq
250003246 gbrod11.seq
250118147 gbrod12.seq
250149284 gbrod13.seq
250253334 gbrod14.seq
250003516 gbrod15.seq
250004450 gbrod16.seq
250000317 gbrod17.seq
3990399 gbrod18.seq
250132263 gbrod2.seq
250149685 gbrod3.seq
250049419 gbrod4.seq
250026940 gbrod5.seq
250121171 gbrod6.seq
250208297 gbrod7.seq
250182946 gbrod8.seq
250143576 gbrod9.seq
3536218301 gbsdr.txt
1548959 gbsec.idx
250000925 gbsts1.seq
250001992 gbsts10.seq
250002781 gbsts11.seq
250001200 gbsts12.seq
250000787 gbsts13.seq
4159524 gbsts14.seq
250001788 gbsts2.seq
250001417 gbsts3.seq
250002402 gbsts4.seq
250002499 gbsts5.seq
250002209 gbsts6.seq
250001258 gbsts7.seq
250000160 gbsts8.seq
250000113 gbsts9.seq
100029396 gbsyn.seq
507187 gbuna.seq
250002718 gbvrl1.seq
250002970 gbvrl2.seq
250013898 gbvrl3.seq
221043189 gbvrl4.seq
250002129 gbvrt1.seq
250133371 gbvrt2.seq
250006672 gbvrt3.seq
250120709 gbvrt4.seq
250105497 gbvrt5.seq
250140225 gbvrt6.seq
250001753 gbvrt7.seq
216492863 gbvrt8.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 26586 100958657
BCT10 35264 91579583
BCT11 8838 10463929
BCT2 7778 106921993
BCT3 428 114741631
BCT4 27961 103371455
BCT5 29858 96932966
BCT6 59058 88886833
BCT7 7049 111569550
BCT8 2230 94981242
BCT9 8338 106095793
ENV1 97804 71419088
ENV2 30767 21207544
EST1 68123 26288742
EST10 76553 29777600
EST100 72337 43069156
EST101 70577 42096846
EST102 74118 40287178
EST103 69471 30344703
EST104 68482 32397546
EST105 64501 36249872
EST106 69697 39023388
EST107 70491 45437999
EST108 75895 35660044
EST109 74537 27616457
EST11 74773 28650551
EST110 75696 25952699
EST111 73515 36633820
EST112 63260 33757047
EST113 79410 44848114
EST114 79242 44915550
EST115 72837 45851293
EST116 68463 43315059
EST117 73005 47821459
EST118 67975 44723489
EST119 73478 44348505
EST12 77403 30640591
EST120 75263 44778617
EST121 73553 47495661
EST122 74550 49284048
EST123 73363 45888367
EST124 78259 40344378
EST125 74724 24175002
EST126 83008 47914589
EST127 75102 44220459
EST128 69444 40203721
EST129 68298 33496236
EST13 76282 29157878
EST130 67497 38327458
EST131 67521 36817690
EST132 68569 41552215
EST133 72306 41145697
EST134 70272 44498475
EST135 69266 41993250
EST136 72785 40007248
EST137 68383 42565248
EST138 59147 34154861
EST139 93904 50851709
EST14 78045 31441135
EST140 92354 52748181
EST141 74965 38836669
EST142 107464 57341202
EST143 108830 59030045
EST144 98233 54312815
EST145 73982 44923743
EST146 94701 54817499
EST147 97235 58800302
EST148 70814 41555222
EST149 65929 31557411
EST15 74367 31408613
EST150 62658 28464186
EST151 55591 26391305
EST152 64970 32019382
EST153 55647 28134204
EST154 76389 47789756
EST155 68270 41455450
EST156 71452 51075107
EST157 75013 42966508
EST158 59937 30400124
EST159 64527 35150201
EST16 75774 33353552
EST160 66054 36414182
EST161 64044 45617871
EST162 62691 36050104
EST163 101575 45496582
EST164 86436 50800819
EST165 102202 58700290
EST166 104243 58995847
EST167 90115 48166737
EST168 90532 36949278
EST169 94972 49460785
EST17 81663 33430377
EST170 89895 38884947
EST171 95816 40331905
EST172 67636 40693229
EST173 68883 41874032
EST174 63694 36932663
EST175 65755 42718735
EST176 69775 30321260
EST177 77290 34100735
EST178 68499 42600351
EST179 81757 40454454
EST18 80744 32692054
EST180 63369 32881764
EST181 68726 49375875
EST182 69343 45789259
EST183 68211 36268231
EST184 69615 44775885
EST185 69208 53301724
EST186 70409 35788602
EST187 70617 41930529
EST188 70503 60772634
EST189 65825 48372474
EST19 78742 31494918
EST190 64572 47107083
EST191 64107 47573881
EST192 66119 45893866
EST193 66526 50089952
EST194 62593 42463073
EST195 63270 37838233
EST196 62840 34711937
EST197 68313 39295636
EST198 81920 48038507
EST199 82908 53981387
EST2 74809 28707014
EST20 74149 30833193
EST200 78521 45829196
EST201 106539 66125687
EST202 108949 65299984
EST203 108598 64505728
EST204 103298 66782833
EST205 115406 59744732
EST206 82748 45038875
EST207 69965 41829228
EST208 68549 59112310
EST209 71108 56276898
EST21 74502 34224300
EST210 78890 39717199
EST211 80743 46966788
EST212 74375 52866681
EST213 72397 48948883
EST214 34399 14894204
EST215 27827 10632679
EST216 27490 10150265
EST217 26373 9682241
EST218 26696 8978299
EST219 27666 10069561
EST22 74003 29690275
EST220 27237 9855907
EST221 27227 9832509
EST222 27330 10522117
EST223 27151 12013746
EST224 27256 11173805
EST225 27384 10013849
EST226 27654 9272071
EST227 26911 9393682
EST228 27845 11311657
EST229 27733 10885610
EST23 77321 32941343
EST230 26992 11349624
EST231 26713 12023341
EST232 27111 11258600
EST233 27068 10895245
EST234 27061 11694202
EST235 27187 11569847
EST236 27301 10961187
EST237 27293 10864181
EST238 27192 10474696
EST239 27135 11752286
EST24 74289 32233256
EST240 24439 17185984
EST241 25850 17292144
EST242 52111 21419062
EST243 104483 41761779
EST244 71954 42086544
EST245 68656 44606556
EST246 69404 44494375
EST247 69508 43900663
EST248 68937 40364308
EST249 71233 41130633
EST25 74607 32476955
EST250 65225 49407539
EST251 63698 31675206
EST252 83893 41367616
EST253 99919 46313524
EST254 71826 41293885
EST255 65502 33125256
EST256 69309 33455464
EST257 70559 42873863
EST258 74446 34505080
EST259 71056 37467123
EST26 74390 30421570
EST260 72261 46034241
EST261 63275 35479777
EST262 68770 34970284
EST263 85542 45676449
EST264 73669 40907614
EST265 80394 56045892
EST266 87890 53461456
EST267 105943 48047962
EST268 79323 45307133
EST269 72648 42830568
EST27 74794 32497756
EST270 73939 40184430
EST271 69443 33515154
EST272 70089 27720800
EST273 66253 40265726
EST274 62823 36100371
EST275 66323 42235308
EST276 69569 40073540
EST277 63859 44119087
EST278 68403 34337163
EST279 82088 44327212
EST28 107010 50649156
EST280 79581 43305748
EST281 87740 52176464
EST282 113924 51792559
EST283 107748 47869050
EST284 71321 37184282
EST285 68244 38488412
EST286 73498 45751330
EST287 79172 38575450
EST288 71470 43875439
EST289 69865 38881173
EST29 97904 45918912
EST290 60106 37300028
EST291 52811 27902113
EST292 71386 49310296
EST293 65335 40234529
EST294 75466 44113199
EST295 65623 39560074
EST296 76104 39626130
EST297 73087 49641263
EST298 72063 35097164
EST299 67685 50194997
EST3 73671 29895129
EST30 98728 52004367
EST300 66346 50406137
EST301 61529 47190245
EST302 63832 37945575
EST303 69191 42353524
EST304 67080 42881223
EST305 48073 23725168
EST306 68356 35792360
EST307 67509 36648148
EST308 60088 29333555
EST309 65814 42034565
EST31 70222 43462920
EST310 76623 44597299
EST311 76904 40856307
EST312 64781 37921909
EST313 74401 43596777
EST314 64976 44106712
EST315 80063 46991011
EST316 85096 49707245
EST317 81807 45062567
EST318 63251 35542620
EST319 67772 37153628
EST32 71299 57718278
EST320 72704 39832021
EST321 48119 24864511
EST322 62208 34097369
EST323 74650 42895977
EST324 98102 46185631
EST325 72812 50187904
EST326 74884 48079948
EST327 70789 43667215
EST328 61164 34098268
EST329 88460 38249210
EST33 85263 48763203
EST330 68277 40639532
EST331 63816 39384862
EST332 62490 38021300
EST333 93578 54428044
EST334 83915 44436285
EST335 75904 43140276
EST336 67486 35187707
EST337 41702 25598069
EST338 52183 29467819
EST339 82366 52048453
EST34 86421 43469494
EST340 81641 43883851
EST341 76484 42536024
EST342 67096 38505891
EST343 61634 40573764
EST344 76040 40189870
EST345 56455 35941105
EST346 82102 28186871
EST347 77557 30699446
EST348 69634 41759028
EST349 68952 34422894
EST35 90972 45146882
EST350 75565 46303691
EST351 72369 47900708
EST352 64902 39743515
EST353 77087 45373430
EST354 59212 33181504
EST355 67894 43493388
EST356 81701 49929251
EST357 79345 46624368
EST358 59427 41967721
EST359 57426 41711235
EST36 101241 46720481
EST360 57665 41187523
EST361 64427 39833249
EST362 73873 44789920
EST363 55045 34637427
EST364 59468 38699537
EST365 58536 40656880
EST366 61344 42157813
EST367 55535 41653738
EST368 46882 33546466
EST369 83581 38965007
EST37 98163 52081014
EST370 52306 40669813
EST371 65277 46529716
EST372 68794 38488626
EST373 63269 39238849
EST374 118520 59800613
EST375 79752 48734479
EST376 79662 58135443
EST377 40066 22729494
EST378 50337 54320132
EST379 46558 58478725
EST38 98205 40951835
EST380 68176 48033065
EST381 76586 30691889
EST382 69784 25348964
EST383 73277 27448707
EST384 73923 25995289
EST385 77987 27541221
EST386 70311 24453665
EST387 70777 29532934
EST388 52455 19072633
EST39 68700 18453238
EST4 74043 28188390
EST40 68923 18398902
EST41 69046 20790854
EST42 43271 11834059
EST43 43197 12061088
EST44 42939 11573217
EST45 64172 24513228
EST46 98398 43441383
EST47 94646 45354537
EST48 90511 45783961
EST49 96641 47071458
EST5 48459 15406932
EST50 107457 56026114
EST51 75936 33356067
EST52 67187 28573711
EST53 72011 32123087
EST54 74313 32018880
EST55 75392 31082737
EST56 80633 31784154
EST57 69527 27710606
EST58 63749 28673127
EST59 72218 32317396
EST6 55076 17490023
EST60 80043 36246569
EST61 74088 29257406
EST62 74182 26232952
EST63 86868 41040548
EST64 48175 15337759
EST65 40088 11045623
EST66 40111 12016391
EST67 40415 12495767
EST68 40506 12159991
EST69 40424 12998703
EST7 74129 29185758
EST70 40478 12654405
EST71 40339 12284396
EST72 40053 12045751
EST73 40525 12660291
EST74 41387 11781676
EST75 41151 13059163
EST76 41015 12643650
EST77 40907 13478752
EST78 45607 11867664
EST79 40405 24881301
EST8 75477 30478673
EST80 41989 22060512
EST81 45747 18769473
EST82 49768 22825618
EST83 51508 21409877
EST84 56331 22904355
EST85 75890 31694060
EST86 74529 28897729
EST87 72909 33436625
EST88 77593 46537129
EST89 76414 41408241
EST9 77494 29868977
EST90 77587 38697948
EST91 75737 40524724
EST92 71900 39418596
EST93 73484 31847365
EST94 75244 43423894
EST95 70254 32866867
EST96 77217 49610090
EST97 64151 34385768
EST98 71401 36705011
EST99 74155 44608131
GSS1 90836 38842477
GSS10 75208 43836508
GSS100 75331 41509710
GSS101 73676 45657770
GSS102 73754 45461499
GSS103 73774 45377670
GSS104 73464 45052718
GSS105 73772 44273843
GSS106 81846 54449635
GSS107 85938 57876411
GSS108 80574 53685947
GSS109 85259 51405622
GSS11 70000 35699178
GSS110 84958 54894149
GSS111 80689 62623214
GSS112 93581 43005298
GSS113 91389 53736441
GSS114 73240 48875140
GSS115 88709 66047215
GSS116 69202 45677353
GSS117 87197 64745577
GSS118 83935 63019860
GSS119 101811 47223456
GSS12 73608 38702548
GSS120 68848 58673824
GSS121 68481 58909359
GSS122 69546 56761282
GSS123 69798 56274167
GSS124 70631 55730776
GSS125 86085 72995386
GSS126 85119 41400077
GSS127 70382 46472750
GSS128 110762 72822195
GSS129 84859 35553941
GSS13 76643 38844833
GSS130 90240 68149845
GSS131 72904 60663505
GSS132 70477 59277363
GSS133 66035 63424612
GSS134 78169 57435686
GSS135 121264 73506249
GSS136 118538 76288833
GSS137 104388 58421857
GSS138 87067 55375134
GSS139 97819 55487686
GSS14 71653 32200787
GSS140 90435 47882037
GSS141 98386 45817181
GSS142 114 86870
GSS15 71100 35448621
GSS16 77492 45681031
GSS17 71232 33509805
GSS18 57963 27843054
GSS19 57000 28965854
GSS2 89386 39537704
GSS20 57919 26494676
GSS21 62283 31416561
GSS22 64355 36094912
GSS23 57735 26980718
GSS24 67913 43061535
GSS25 66718 27435176
GSS26 58232 25662727
GSS27 67992 32487290
GSS28 62972 32554914
GSS29 81188 40721148
GSS3 87707 41943972
GSS30 81324 39942710
GSS31 74483 40451723
GSS32 70651 48514417
GSS33 80030 37771909
GSS34 76197 40343980
GSS35 75356 40149745
GSS36 87784 58322137
GSS37 87789 58316593
GSS38 85868 44842527
GSS39 84733 48447833
GSS4 79301 41207693
GSS40 88804 37368497
GSS41 82279 36963706
GSS42 81457 57001778
GSS43 79091 56972488
GSS44 72222 47691847
GSS45 72274 47557004
GSS46 78311 44914325
GSS47 78387 40833740
GSS48 84148 58850382
GSS49 86253 68388474
GSS5 79043 40732356
GSS50 84163 50897980
GSS51 93160 60265320
GSS52 87265 56829775
GSS53 74532 39722874
GSS54 76717 45526094
GSS55 86016 45249706
GSS56 87216 57244393
GSS57 75637 70333120
GSS58 72485 78627825
GSS59 89751 68029017
GSS6 78252 38893868
GSS60 84322 55767764
GSS61 63647 45424944
GSS62 71610 49673077
GSS63 89651 67273610
GSS64 86227 55651049
GSS65 87535 54836387
GSS66 87595 57562331
GSS67 98136 57721043
GSS68 100635 54499365
GSS69 100877 54192340
GSS7 77536 39418685
GSS70 101235 53739885
GSS71 102491 52146637
GSS72 102253 52447668
GSS73 102632 51967344
GSS74 102121 52614356
GSS75 97487 58141291
GSS76 90102 70455196
GSS77 89838 70776651
GSS78 87860 69499273
GSS79 87814 69692490
GSS8 76334 38105756
GSS80 89104 61075860
GSS81 79707 21224547
GSS82 78275 24800233
GSS83 90782 37616668
GSS84 84345 51246290
GSS85 81580 52968907
GSS86 89030 64285859
GSS87 77532 64601964
GSS88 79203 79157977
GSS89 77846 53370041
GSS9 72576 37287448
GSS90 94172 50620212
GSS91 74390 39304371
GSS92 85698 53653909
GSS93 73069 59222734
GSS94 85880 52865787
GSS95 83073 61065858
GSS96 86876 57778156
GSS97 84731 55145889
GSS98 87397 60371400
GSS99 81038 61432651
HTC1 32150 55611252
HTC2 31636 66259760
HTC3 75093 40628412
HTC4 84085 78220313
HTC5 93333 82579504
HTC6 62853 98845849
HTG1 1317 188906440
HTG10 1239 186683604
HTG11 1426 184144548
HTG12 888 191933080
HTG13 751 192396407
HTG14 742 192402878
HTG15 776 192297612
HTG16 802 191977482
HTG17 766 192372264
HTG18 1987 172458347
HTG19 951 189891941
HTG2 2563 186021293
HTG20 1209 186038477
HTG21 778 191945541
HTG22 905 190501564
HTG23 868 191330741
HTG24 870 190655619
HTG25 774 192120022
HTG26 835 191502226
HTG27 870 191475339
HTG28 927 190367253
HTG29 923 190355673
HTG3 2449 185332304
HTG30 928 190735662
HTG31 908 191051335
HTG32 861 191589246
HTG33 978 189710060
HTG34 879 191300076
HTG35 858 191628224
HTG36 824 191928089
HTG37 932 190200320
HTG38 932 190954718
HTG39 939 190608976
HTG4 2529 188498207
HTG40 1003 190072838
HTG41 1155 187606002
HTG42 1178 187696091
HTG43 1273 188375955
HTG44 1152 188273475
HTG45 1106 189758123
HTG46 1176 191384535
HTG47 1267 190942925
HTG48 1169 191639097
HTG49 1213 191264409
HTG5 1281 185666662
HTG50 1135 190975010
HTG51 1087 188826217
HTG52 1145 190519252
HTG53 1418 188373898
HTG54 1424 188604537
HTG55 1197 190539217
HTG56 1317 190207419
HTG57 1121 191938364
HTG58 1402 190257936
HTG59 1176 190929014
HTG6 1274 185376276
HTG60 1084 193876193
HTG61 1038 193820133
HTG62 1043 193449516
HTG63 860 147194259
HTG7 1246 185596893
HTG8 1288 185096451
HTG9 1185 187067144
INV1 15015 165948540
INV2 1609 166279366
INV3 38404 111838431
INV4 73667 75364900
INV5 79075 73729487
INV6 38596 109764377
INV7 31783 73915055
MAM1 56526 108700891
MAM2 16354 20921439
PAT1 222997 70290345
PAT10 106497 60501319
PAT11 104254 49775791
PAT12 145667 58531456
PAT13 157035 64895647
PAT14 107629 116116106
PAT15 141920 93397065
PAT16 108939 111161543
PAT17 146679 71460688
PAT2 194349 84712749
PAT3 171910 95946236
PAT4 146893 101792246
PAT5 151668 82659422
PAT6 105935 118830630
PAT7 143962 90302289
PAT8 127616 99286405
PAT9 142512 64816727
PHG 2547 16072018
PLN1 32575 124993092
PLN10 19811 137996008
PLN11 63897 68632446
PLN12 77695 79054042
PLN13 65301 86381379
PLN14 29241 122666882
PLN15 33448 116892555
PLN16 13517 24919003
PLN2 1371 177338516
PLN3 17158 145730551
PLN4 77477 77321436
PLN5 61083 63199088
PLN6 28325 71905866
PLN7 1258 165650330
PLN8 930 192375334
PLN9 7 212935788
PRI1 18303 149715653
PRI10 1423 177872727
PRI11 1279 176268873
PRI12 1501 175688597
PRI13 1590 178926376
PRI14 1518 184903394
PRI15 20885 157557015
PRI16 42792 100877321
PRI17 16896 137736774
PRI18 1606 183879489
PRI19 1727 183469198
PRI2 1438 173189596
PRI20 2107 181871130
PRI21 1657 185390402
PRI22 27436 143351116
PRI23 46826 78331411
PRI24 19467 128887025
PRI25 15065 166566381
PRI26 37965 135691672
PRI27 33640 134493687
PRI28 50177 80438425
PRI3 1264 183872781
PRI4 1307 180202583
PRI5 1160 175578585
PRI6 1193 178834555
PRI7 1221 178223519
PRI8 1346 171774397
PRI9 1221 177462382
ROD1 8408 170890618
ROD10 1027 186206121
ROD11 2435 183268479
ROD12 26217 146262569
ROD13 1186 191534612
ROD14 1248 193831118
ROD15 25221 150519261
ROD16 26561 89664696
ROD17 44778 119255560
ROD18 1340 1142471
ROD2 919 174192739
ROD3 897 174288482
ROD4 913 174829940
ROD5 958 176564993
ROD6 974 180015970
ROD7 976 181345619
ROD8 1005 182200210
ROD9 985 181913369
STS1 81967 35402865
STS10 58199 44464833
STS11 57993 43685996
STS12 77473 38095654
STS13 89549 39277791
STS14 1941 1151510
STS2 83773 43698902
STS3 78819 32192711
STS4 63998 33049577
STS5 54895 31904461
STS6 54697 32308890
STS7 54684 32231985
STS8 56543 39216118
STS9 58081 44559351
SYN 22992 31396122
UNA 259 135466
VRL1 72961 65687246
VRL2 72677 66529403
VRL3 72187 69403184
VRL4 64207 60903632
VRT1 59781 102690036
VRT2 12818 171430305
VRT3 76250 75077664
VRT4 21178 110367601
VRT5 1227 193316431
VRT6 1295 193101006
VRT7 14648 172194206
VRT8 37915 110428845
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 147.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
8479400 11096908301 Homo sapiens
6214089 7112181496 Mus musculus
997087 5656261578 Rattus norvegicus
798764 2081895252 Danio rerio
2450906 1623715561 Zea mays
353603 1163554675 Oryza sativa (japonica cultivar-group)
1103208 1081651181 Bos taurus
1027563 833436299 Xenopus tropicalis
1381233 787975168 Canis familiaris
502530 773403017 Drosophila melanogaster
974522 642974899 Arabidopsis thaliana
724319 623861517 Gallus gallus
194912 479865917 Pan troglodytes
784402 462484333 Sorghum bicolor
693197 418419967 Ciona intestinalis
596152 404044922 Brassica oleracea
599903 382736619 Sus scrofa
58430 378166251 Macaca mulatta
377638 376759242 Medicago truncatula
597832 335406151 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2005
NCBI-GenBank Flat File Release 147.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
Mirrors of the GenBank FTP site at the NCBI are available from the
San Diego Supercomputer Center and the University of Indiana:
ftp://genbank.sdsc.edu/pub
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 147.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
Renata Geer, Scott McGinnis, Donna Messersmith, Rana Morris, Vyvy Pham,
Monica Romiti, Eric Sayers, Tao Tao, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
