Release Notes For GenBank Release 148
GBREL.TXT Genetic Sequence Data Bank
June 15 2005
NCBI-GenBank Flat File Release 148.0
Distribution Release Notes
45236251 loci, 49398852122 bases, from 45236251 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 148.0
1.2 Cutoff Date
1.3 Important Changes in Release 148.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 148.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 148.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 148.0, incorporates data available to the collaborating
databases as of June 14, 2005 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 148.0
1.3.1 Problems generating accession number and keyword indexes
Continuing software problems again prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.
A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .
The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 148.0 .
Our apologies for any inconvenience that this may cause.
1.3.2 Organizational changes
The total number of sequence data files increased by 17 with this release:
- the EST division is now comprised of 397 files (+9)
- the GSS division is now comprised of 144 files (+2)
- the HTC division is now comprised of 7 files (+1)
- the HTG division is now comprised of 65 files (+2)
- the PAT division is now comprised of 18 files (+1)
- the VRL division is now comprised of 5 files (+1)
- the VRT division is now comprised of 9 files (+1)
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
twenty-six GSS flatfiles in Release 148.0. Consider gbgss119.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
June 15 2005
NCBI-GenBank Flat File Release 148.0
GSS Sequences (Part 1)
87186 loci, 64735440 bases, from 87186 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "119" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
Several changes related to the Feature Table were agreed to during the
May 2005 collaborative meeting among DDBJ, EMBL, and GenBank. The descriptions
of the changes provided below are preliminary; complete definitions will appear
in future release notes.
1.4.1 New qualifiers for the source feature
A set of eight new source feature qualifiers will be legal as of the
October 2005 release.
/lat_lon : GPS coordinates for the location at which a specimen,
from which the sequence was obtained, was collected.
Format: Decimal degrees (N/S, E/W).
/collected_by : Name of the person who collected the specimen.
/collection_date : Date that the specimen was collected.
Format: DD-MMM-YYYY (two-digit month, three letter
month abbreviation, 4-digit year)
/identified_by : Name of the person who identified the specimen.
/fwd_primer_seq : Forward PCR primer sequence used to amplify
the sequence.
/fwd_primer_name : Name of the forward PCR primer.
/rev_primer_seq : Reverse PCR primer sequence used to amplify
the sequence.
/rev_primer_name : Name of the reverse PCR primer.
These qualifiers will most likely see their first use in association
with environmental sampling projects and the BarCode project.
1.4.2 : /evidence qualifer to be replaced
Two new qualifiers designed to replace /evidence will be legal as
of the October 2005 GenBank release : /experiment and /inference .
The current /evidence="not_experimental" qualifier will be replaced
by /inference . The /inference values will be from a controlled list
which is intended to capture several different classes of inferential
methods.
The current /evidence="experimental" qualifier will be replaced
by /experiment. This will be a free-text qualifier in which a brief
description of the nature of the bench experiment which supports
the associated feature can be provided by the submittor.
1.4.3 New /organelle qualifier value
As of the October 2005 GenBank release, a new value for the /organelle
qualifier will be legal : hydrogenosome
This will support the annotation of sequences from anaerobic protozoa
and fungi, for which the hydrogenosome has a role in anaerobic respiration.
1.4.4 Two new CDS qualifiers
As of the October 2005 GenBank release, two new CDS feature qualifiers
will be introduced:
/trans_splicing
/ribosomal_slippage
Coding regions involved in such processes will be more easily identified
with the addition of these qualifiers.
1.4.5 New /exception qualifier value
Coding regions for which the conceptual protein translation differs from
the supplied /translation qualifier are flagged with an /exception
qualifier. The value :
"rearrangement required for product"
will be legal for this qualifier as of the October 2005 GenBank release.
1.4.6 : /repeat_unit qualifer to be replaced
Two new qualifiers designed to replace /repeat_unit will be legal as
of the October 2005 GenBank release : /repeat_unit_seq and /repeat_unit_range .
The current qualifier accomodates both integer ranges (eg: "10..20") and
characters that represent a repeat unit pattern (eg: (AT)2(AA)5 ). Introducing
a distinct qualifier for each of these representations will make it easier
to submit and validate them.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 785 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut4.idx - Index of the entries according to accession number, part 4.
26. gbaut5.idx - Index of the entries according to accession number, part 5.
27. gbaut6.idx - Index of the entries according to accession number, part 6.
28. gbaut7.idx - Index of the entries according to accession number, part 7.
29. gbaut8.idx - Index of the entries according to accession number, part 8.
30. gbaut9.idx - Index of the entries according to accession number, part 9.
31. gbbct1.seq - Bacterial sequence entries, part 1.
32. gbbct10.seq - Bacterial sequence entries, part 10.
33. gbbct11.seq - Bacterial sequence entries, part 11.
34. gbbct2.seq - Bacterial sequence entries, part 2.
35. gbbct3.seq - Bacterial sequence entries, part 3.
36. gbbct4.seq - Bacterial sequence entries, part 4.
37. gbbct5.seq - Bacterial sequence entries, part 5.
38. gbbct6.seq - Bacterial sequence entries, part 6.
39. gbbct7.seq - Bacterial sequence entries, part 7.
40. gbbct8.seq - Bacterial sequence entries, part 8.
41. gbbct9.seq - Bacterial sequence entries, part 9.
42. gbchg.txt - Accession numbers of entries updated since the previous release.
43. gbcon.seq - Constructed sequence entries.
44. gbdel.txt - Accession numbers of entries deleted since the previous release.
45. gbenv1.seq - Environmental sampling sequence entries, part 1.
46. gbenv2.seq - Environmental sampling sequence entries, part 2.
47. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
48. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
49. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
50. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
51. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
52. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
53. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
54. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
55. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
56. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
57. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
58. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
59. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
60. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
61. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
62. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
63. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
64. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
65. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
66. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
67. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
68. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
69. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
70. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
71. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
72. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
73. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
74. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
75. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
76. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
77. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
78. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
79. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
80. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
81. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
82. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
83. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
84. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
85. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
86. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
87. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
88. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
89. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
90. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
91. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
92. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
93. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
94. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
95. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
96. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
97. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
98. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
99. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
100. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
101. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
102. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
103. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
104. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
105. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
106. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
107. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
108. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
109. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
110. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
111. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
112. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
113. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
114. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
115. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
116. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
117. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
118. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
119. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
120. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
121. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
122. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
123. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
124. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
125. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
126. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
127. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
128. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
129. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
130. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
131. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
132. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
133. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
134. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
135. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
136. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
137. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
138. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
139. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
140. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
141. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
142. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
143. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
144. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
145. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
146. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
147. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
148. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
149. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
150. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
151. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
152. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
153. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
154. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
155. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
156. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
157. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
158. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
159. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
160. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
161. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
162. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
163. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
164. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
165. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
166. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
167. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
168. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
169. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
170. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
171. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
172. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
173. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
174. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
175. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
176. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
177. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
178. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
179. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
180. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
181. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
182. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
183. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
184. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
185. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
186. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
187. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
188. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
189. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
190. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
191. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
192. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
193. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
194. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
195. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
196. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
197. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
198. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
199. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
200. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
201. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
202. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
203. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
204. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
205. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
206. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
207. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
208. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
209. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
210. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
211. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
212. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
213. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
214. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
215. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
216. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
217. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
218. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
219. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
220. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
221. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
222. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
223. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
224. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
225. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
226. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
227. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
228. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
229. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
230. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
231. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
232. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
233. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
234. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
235. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
236. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
237. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
238. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
239. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
240. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
241. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
242. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
243. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
244. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
245. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
246. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
247. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
248. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
249. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
250. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
251. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
252. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
253. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
254. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
255. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
256. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
257. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
258. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
259. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
260. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
261. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
262. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
263. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
264. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
265. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
266. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
267. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
268. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
269. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
270. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
271. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
272. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
273. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
274. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
275. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
276. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
277. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
278. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
279. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
280. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
281. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
282. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
283. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
284. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
285. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
286. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
287. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
288. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
289. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
290. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
291. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
292. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
293. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
294. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
295. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
296. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
297. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
298. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
299. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
300. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
301. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
302. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
303. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
304. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
305. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
306. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
307. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
308. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
309. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
310. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
311. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
312. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
313. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
314. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
315. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
316. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
317. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
318. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
319. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
320. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
321. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
322. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
323. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
324. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
325. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
326. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
327. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
328. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
329. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
330. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
331. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
332. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
333. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
334. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
335. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
336. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
337. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
338. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
339. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
340. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
341. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
342. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
343. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
344. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
345. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
346. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
347. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
348. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
349. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
350. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
351. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
352. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
353. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
354. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
355. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
356. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
357. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
358. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
359. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
360. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
361. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
362. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
363. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
364. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
365. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
366. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
367. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
368. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
369. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
370. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
371. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
372. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
373. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
374. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
375. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
376. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
377. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
378. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
379. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
380. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
381. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
382. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
383. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
384. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
385. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
386. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
387. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
388. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
389. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
390. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
391. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
392. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
393. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
394. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
395. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
396. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
397. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
398. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
399. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
400. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
401. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
402. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
403. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
404. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
405. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
406. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
407. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
408. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
409. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
410. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
411. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
412. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
413. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
414. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
415. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
416. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
417. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
418. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
419. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
420. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
421. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
422. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
423. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
424. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
425. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
426. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
427. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
428. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
429. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
430. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
431. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
432. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
433. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
434. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
435. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
436. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
437. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
438. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
439. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
440. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
441. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
442. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
443. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
444. gbgen.idx - Index of the entries according to gene symbols.
445. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
446. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
447. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
448. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
449. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
450. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
451. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
452. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
453. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
454. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
455. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
456. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
457. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
458. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
459. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
460. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
461. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
462. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
463. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
464. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
465. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
466. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
467. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
468. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
469. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
470. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
471. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
472. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
473. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
474. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
475. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
476. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
477. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
478. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
479. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
480. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
481. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
482. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
483. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
484. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
485. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
486. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
487. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
488. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
489. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
490. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
491. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
492. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
493. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
494. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
495. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
496. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
497. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
498. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
499. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
500. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
501. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
502. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
503. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
504. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
505. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
506. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
507. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
508. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
509. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
510. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
511. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
512. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
513. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
514. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
515. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
516. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
517. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
518. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
519. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
520. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
521. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
522. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
523. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
524. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
525. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
526. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
527. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
528. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
529. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
530. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
531. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
532. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
533. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
534. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
535. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
536. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
537. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
538. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
539. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
540. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
541. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
542. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
543. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
544. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
545. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
546. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
547. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
548. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
549. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
550. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
551. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
552. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
553. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
554. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
555. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
556. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
557. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
558. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
559. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
560. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
561. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
562. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
563. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
564. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
565. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
566. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
567. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
568. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
569. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
570. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
571. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
572. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
573. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
574. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
575. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
576. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
577. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
578. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
579. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
580. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
581. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
582. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
583. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
584. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
585. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
586. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
587. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
588. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
589. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
590. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
591. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
592. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
593. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
594. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
595. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
596. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
597. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
598. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
599. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
600. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
601. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
602. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
603. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
604. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
605. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
606. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
607. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
608. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
609. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
610. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
611. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
612. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
613. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
614. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
615. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
616. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
617. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
618. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
619. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
620. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
621. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
622. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
623. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
624. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
625. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
626. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
627. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
628. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
629. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
630. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
631. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
632. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
633. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
634. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
635. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
636. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
637. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
638. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
639. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
640. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
641. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
642. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
643. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
644. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
645. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
646. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
647. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
648. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
649. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
650. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
651. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
652. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
653. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
654. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
655. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
656. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
657. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
658. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
659. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
660. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
661. gbinv1.seq - Invertebrate sequence entries, part 1.
662. gbinv2.seq - Invertebrate sequence entries, part 2.
663. gbinv3.seq - Invertebrate sequence entries, part 3.
664. gbinv4.seq - Invertebrate sequence entries, part 4.
665. gbinv5.seq - Invertebrate sequence entries, part 5.
666. gbinv6.seq - Invertebrate sequence entries, part 6.
667. gbinv7.seq - Invertebrate sequence entries, part 7.
668. gbjou.idx - Index of the entries according to journal citation.
669. gbmam1.seq - Other mammalian sequence entries, part 1.
670. gbmam2.seq - Other mammalian sequence entries, part 2.
671. gbnew.txt - Accession numbers of entries new since the previous release.
672. gbpat1.seq - Patent sequence entries, part 1.
673. gbpat10.seq - Patent sequence entries, part 10.
674. gbpat11.seq - Patent sequence entries, part 11.
675. gbpat12.seq - Patent sequence entries, part 12.
676. gbpat13.seq - Patent sequence entries, part 13.
677. gbpat14.seq - Patent sequence entries, part 14.
678. gbpat15.seq - Patent sequence entries, part 15.
679. gbpat16.seq - Patent sequence entries, part 16.
680. gbpat17.seq - Patent sequence entries, part 17.
681. gbpat18.seq - Patent sequence entries, part 18.
682. gbpat2.seq - Patent sequence entries, part 2.
683. gbpat3.seq - Patent sequence entries, part 3.
684. gbpat4.seq - Patent sequence entries, part 4.
685. gbpat5.seq - Patent sequence entries, part 5.
686. gbpat6.seq - Patent sequence entries, part 6.
687. gbpat7.seq - Patent sequence entries, part 7.
688. gbpat8.seq - Patent sequence entries, part 8.
689. gbpat9.seq - Patent sequence entries, part 9.
690. gbphg.seq - Phage sequence entries.
691. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
692. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
693. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
694. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
695. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
696. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
697. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
698. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
699. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
700. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
701. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
702. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
703. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
704. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
705. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
706. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
707. gbpri1.seq - Primate sequence entries, part 1.
708. gbpri10.seq - Primate sequence entries, part 10.
709. gbpri11.seq - Primate sequence entries, part 11.
710. gbpri12.seq - Primate sequence entries, part 12.
711. gbpri13.seq - Primate sequence entries, part 13.
712. gbpri14.seq - Primate sequence entries, part 14.
713. gbpri15.seq - Primate sequence entries, part 15.
714. gbpri16.seq - Primate sequence entries, part 16.
715. gbpri17.seq - Primate sequence entries, part 17.
716. gbpri18.seq - Primate sequence entries, part 18.
717. gbpri19.seq - Primate sequence entries, part 19.
718. gbpri2.seq - Primate sequence entries, part 2.
719. gbpri20.seq - Primate sequence entries, part 20.
720. gbpri21.seq - Primate sequence entries, part 21.
721. gbpri22.seq - Primate sequence entries, part 22.
722. gbpri23.seq - Primate sequence entries, part 23.
723. gbpri24.seq - Primate sequence entries, part 24.
724. gbpri25.seq - Primate sequence entries, part 25.
725. gbpri26.seq - Primate sequence entries, part 26.
726. gbpri27.seq - Primate sequence entries, part 27.
727. gbpri28.seq - Primate sequence entries, part 28.
728. gbpri3.seq - Primate sequence entries, part 3.
729. gbpri4.seq - Primate sequence entries, part 4.
730. gbpri5.seq - Primate sequence entries, part 5.
731. gbpri6.seq - Primate sequence entries, part 6.
732. gbpri7.seq - Primate sequence entries, part 7.
733. gbpri8.seq - Primate sequence entries, part 8.
734. gbpri9.seq - Primate sequence entries, part 9.
735. gbrel.txt - Release notes (this document).
736. gbrod1.seq - Rodent sequence entries, part 1.
737. gbrod10.seq - Rodent sequence entries, part 10.
738. gbrod11.seq - Rodent sequence entries, part 11.
739. gbrod12.seq - Rodent sequence entries, part 12.
740. gbrod13.seq - Rodent sequence entries, part 13.
741. gbrod14.seq - Rodent sequence entries, part 14.
742. gbrod15.seq - Rodent sequence entries, part 15.
743. gbrod16.seq - Rodent sequence entries, part 16.
744. gbrod17.seq - Rodent sequence entries, part 17.
745. gbrod18.seq - Rodent sequence entries, part 18.
746. gbrod2.seq - Rodent sequence entries, part 2.
747. gbrod3.seq - Rodent sequence entries, part 3.
748. gbrod4.seq - Rodent sequence entries, part 4.
749. gbrod5.seq - Rodent sequence entries, part 5.
750. gbrod6.seq - Rodent sequence entries, part 6.
751. gbrod7.seq - Rodent sequence entries, part 7.
752. gbrod8.seq - Rodent sequence entries, part 8.
753. gbrod9.seq - Rodent sequence entries, part 9.
754. gbsdr.txt - Short directory of the data bank.
755. gbsec.idx - Index of the entries according to secondary accession number.
756. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
757. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
758. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
759. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
760. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
761. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
762. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
763. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
764. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
765. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
766. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
767. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
768. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
769. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
770. gbsyn.seq - Synthetic and chimeric sequence entries.
771. gbuna.seq - Unannotated sequence entries.
772. gbvrl1.seq - Viral sequence entries, part 1.
773. gbvrl2.seq - Viral sequence entries, part 2.
774. gbvrl3.seq - Viral sequence entries, part 3.
775. gbvrl4.seq - Viral sequence entries, part 4.
776. gbvrl5.seq - Viral sequence entries, part 5.
777. gbvrt1.seq - Other vertebrate sequence entries, part 1.
778. gbvrt2.seq - Other vertebrate sequence entries, part 2.
779. gbvrt3.seq - Other vertebrate sequence entries, part 3.
780. gbvrt4.seq - Other vertebrate sequence entries, part 4.
781. gbvrt5.seq - Other vertebrate sequence entries, part 5.
782. gbvrt6.seq - Other vertebrate sequence entries, part 6.
783. gbvrt7.seq - Other vertebrate sequence entries, part 7.
784. gbvrt8.seq - Other vertebrate sequence entries, part 8.
785. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 148.0 flatfiles require roughly 172 GB (sequence
files only) or 189 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1394936206 gbacc.idx
507277425 gbaut1.idx
507694605 gbaut10.idx
502675279 gbaut11.idx
541301666 gbaut12.idx
517534345 gbaut13.idx
509130832 gbaut14.idx
501363440 gbaut15.idx
514414062 gbaut16.idx
502305566 gbaut17.idx
506141547 gbaut18.idx
500038908 gbaut19.idx
501754160 gbaut2.idx
517210828 gbaut20.idx
500515977 gbaut21.idx
504051758 gbaut22.idx
505632777 gbaut23.idx
508174498 gbaut24.idx
511244506 gbaut25.idx
502375430 gbaut26.idx
508672334 gbaut27.idx
500219761 gbaut28.idx
476004142 gbaut29.idx
528821652 gbaut3.idx
503350165 gbaut4.idx
500069346 gbaut5.idx
500403152 gbaut6.idx
500137643 gbaut7.idx
512811391 gbaut8.idx
503117315 gbaut9.idx
250018560 gbbct1.seq
250000502 gbbct10.seq
80155728 gbbct11.seq
250020511 gbbct2.seq
250234285 gbbct3.seq
250002289 gbbct4.seq
250002532 gbbct5.seq
255149444 gbbct6.seq
250275100 gbbct7.seq
250005224 gbbct8.seq
250003060 gbbct9.seq
7707729 gbchg.txt
1169137252 gbcon.seq
16778 gbdel.txt
250001019 gbenv1.seq
131514510 gbenv2.seq
230687973 gbest1.seq
230690225 gbest10.seq
230687483 gbest100.seq
230689762 gbest101.seq
230689546 gbest102.seq
230690286 gbest103.seq
230689378 gbest104.seq
230689259 gbest105.seq
230689614 gbest106.seq
230687833 gbest107.seq
230689741 gbest108.seq
230690259 gbest109.seq
230690093 gbest11.seq
230666954 gbest110.seq
230689696 gbest111.seq
230687646 gbest112.seq
230688667 gbest113.seq
230687973 gbest114.seq
230687702 gbest115.seq
230688229 gbest116.seq
230687750 gbest117.seq
230689806 gbest118.seq
230689581 gbest119.seq
230690176 gbest12.seq
230689284 gbest120.seq
230690383 gbest121.seq
230689026 gbest122.seq
230690364 gbest123.seq
230689986 gbest124.seq
230689168 gbest125.seq
230688272 gbest126.seq
230687691 gbest127.seq
230688318 gbest128.seq
230688223 gbest129.seq
230689778 gbest13.seq
230690238 gbest130.seq
230691744 gbest131.seq
230689485 gbest132.seq
230690317 gbest133.seq
230687468 gbest134.seq
230689525 gbest135.seq
230687917 gbest136.seq
230688803 gbest137.seq
230691324 gbest138.seq
230688795 gbest139.seq
230689531 gbest14.seq
230688053 gbest140.seq
230687762 gbest141.seq
230688784 gbest142.seq
230687912 gbest143.seq
230687831 gbest144.seq
230688489 gbest145.seq
230689218 gbest146.seq
230689658 gbest147.seq
230687576 gbest148.seq
230689086 gbest149.seq
230688898 gbest15.seq
230690315 gbest150.seq
230690647 gbest151.seq
230688187 gbest152.seq
230688458 gbest153.seq
230688925 gbest154.seq
230688163 gbest155.seq
230689493 gbest156.seq
230687714 gbest157.seq
230688621 gbest158.seq
230690862 gbest159.seq
230688202 gbest16.seq
230690894 gbest160.seq
230687486 gbest161.seq
230689470 gbest162.seq
230690580 gbest163.seq
230689076 gbest164.seq
230687466 gbest165.seq
230688389 gbest166.seq
230688041 gbest167.seq
230689822 gbest168.seq
230688247 gbest169.seq
230688030 gbest17.seq
230689296 gbest170.seq
230689404 gbest171.seq
230688442 gbest172.seq
230691113 gbest173.seq
230688209 gbest174.seq
230688266 gbest175.seq
230688979 gbest176.seq
230688463 gbest177.seq
228553702 gbest178.seq
230689311 gbest179.seq
230688207 gbest18.seq
230688260 gbest180.seq
230688638 gbest181.seq
230687612 gbest182.seq
230690038 gbest183.seq
230688064 gbest184.seq
230688823 gbest185.seq
230689158 gbest186.seq
230689895 gbest187.seq
230690357 gbest188.seq
230689664 gbest189.seq
230688108 gbest19.seq
230689913 gbest190.seq
230689486 gbest191.seq
230689146 gbest192.seq
230688389 gbest193.seq
230687871 gbest194.seq
230689301 gbest195.seq
230689166 gbest196.seq
230688126 gbest197.seq
230689264 gbest198.seq
230689453 gbest199.seq
230689444 gbest2.seq
230687630 gbest20.seq
230690565 gbest200.seq
230688559 gbest201.seq
230687859 gbest202.seq
230689288 gbest203.seq
230687646 gbest204.seq
230688867 gbest205.seq
230688655 gbest206.seq
230689618 gbest207.seq
230688156 gbest208.seq
230688355 gbest209.seq
230690274 gbest21.seq
230688049 gbest210.seq
230688462 gbest211.seq
230689303 gbest212.seq
230688628 gbest213.seq
230688924 gbest214.seq
230687702 gbest215.seq
230689188 gbest216.seq
230690288 gbest217.seq
191310358 gbest218.seq
162709328 gbest219.seq
230689677 gbest22.seq
163091807 gbest220.seq
170943279 gbest221.seq
169615103 gbest222.seq
164377261 gbest223.seq
165194000 gbest224.seq
164761168 gbest225.seq
163988985 gbest226.seq
164607343 gbest227.seq
164144907 gbest228.seq
164160829 gbest229.seq
230688136 gbest23.seq
163045960 gbest230.seq
168173205 gbest231.seq
162626269 gbest232.seq
162718008 gbest233.seq
166747833 gbest234.seq
168031029 gbest235.seq
165913839 gbest236.seq
165710270 gbest237.seq
165395155 gbest238.seq
165165380 gbest239.seq
230689006 gbest24.seq
164339397 gbest240.seq
164188175 gbest241.seq
164939479 gbest242.seq
164657975 gbest243.seq
179283300 gbest244.seq
173315061 gbest245.seq
180451588 gbest246.seq
230688763 gbest247.seq
230688210 gbest248.seq
230688569 gbest249.seq
230690305 gbest25.seq
230687457 gbest250.seq
230687688 gbest251.seq
230687858 gbest252.seq
230689323 gbest253.seq
230690154 gbest254.seq
230688510 gbest255.seq
230687488 gbest256.seq
230688296 gbest257.seq
230688400 gbest258.seq
230690128 gbest259.seq
230687449 gbest26.seq
230687858 gbest260.seq
230689250 gbest261.seq
230690257 gbest262.seq
230689882 gbest263.seq
230689730 gbest264.seq
230689944 gbest265.seq
230691339 gbest266.seq
230688697 gbest267.seq
230687937 gbest268.seq
230687606 gbest269.seq
230690270 gbest27.seq
230688073 gbest270.seq
230688602 gbest271.seq
230688904 gbest272.seq
230689036 gbest273.seq
230688793 gbest274.seq
225270512 gbest275.seq
207005222 gbest276.seq
230690417 gbest277.seq
230689455 gbest278.seq
230689003 gbest279.seq
230687712 gbest28.seq
230687796 gbest280.seq
230688079 gbest281.seq
230687821 gbest282.seq
230688528 gbest283.seq
230689396 gbest284.seq
230687496 gbest285.seq
230688884 gbest286.seq
230690346 gbest287.seq
230688992 gbest288.seq
230689833 gbest289.seq
230689357 gbest29.seq
230687935 gbest290.seq
230688263 gbest291.seq
230688405 gbest292.seq
230690491 gbest293.seq
230689871 gbest294.seq
230693097 gbest295.seq
230689647 gbest296.seq
230689690 gbest297.seq
230687761 gbest298.seq
230691783 gbest299.seq
230687582 gbest3.seq
230688009 gbest30.seq
229916636 gbest300.seq
230688243 gbest301.seq
197088819 gbest302.seq
230689927 gbest303.seq
230690737 gbest304.seq
230689254 gbest305.seq
230688084 gbest306.seq
230688574 gbest307.seq
224159047 gbest308.seq
143069612 gbest309.seq
230689851 gbest31.seq
211010411 gbest310.seq
230690220 gbest311.seq
230688453 gbest312.seq
230688564 gbest313.seq
230689499 gbest314.seq
230690102 gbest315.seq
230691827 gbest316.seq
230689332 gbest317.seq
230688445 gbest318.seq
230687467 gbest319.seq
230689822 gbest32.seq
230688614 gbest320.seq
230687634 gbest321.seq
230692847 gbest322.seq
230688961 gbest323.seq
230690287 gbest324.seq
230688824 gbest325.seq
230689172 gbest326.seq
230687477 gbest327.seq
230688969 gbest328.seq
230691134 gbest329.seq
230689417 gbest33.seq
230688540 gbest330.seq
230690180 gbest331.seq
230688112 gbest332.seq
230689649 gbest333.seq
230689616 gbest334.seq
230689269 gbest335.seq
230690125 gbest336.seq
230689272 gbest337.seq
230687612 gbest338.seq
230688232 gbest339.seq
230689604 gbest34.seq
230690059 gbest340.seq
230688703 gbest341.seq
230691869 gbest342.seq
230689879 gbest343.seq
230688142 gbest344.seq
230689317 gbest345.seq
230688632 gbest346.seq
230688957 gbest347.seq
230692777 gbest348.seq
230689160 gbest349.seq
230688517 gbest35.seq
230687447 gbest350.seq
230688318 gbest351.seq
222361875 gbest352.seq
230689118 gbest353.seq
230689564 gbest354.seq
230689124 gbest355.seq
230687838 gbest356.seq
230690089 gbest357.seq
230688931 gbest358.seq
230689282 gbest359.seq
230687733 gbest36.seq
230692130 gbest360.seq
230689894 gbest361.seq
230688387 gbest362.seq
230691300 gbest363.seq
230691208 gbest364.seq
230688128 gbest365.seq
230691075 gbest366.seq
230689158 gbest367.seq
230692039 gbest368.seq
230689882 gbest369.seq
230687461 gbest37.seq
230688530 gbest370.seq
230688529 gbest371.seq
230688414 gbest372.seq
230690554 gbest373.seq
230688297 gbest374.seq
230690821 gbest375.seq
230690985 gbest376.seq
230688073 gbest377.seq
230689932 gbest378.seq
230689653 gbest379.seq
230688017 gbest38.seq
230687745 gbest380.seq
230689758 gbest381.seq
230690500 gbest382.seq
230695311 gbest383.seq
230689910 gbest384.seq
230690622 gbest385.seq
230697049 gbest386.seq
230690783 gbest387.seq
230689187 gbest388.seq
230688966 gbest389.seq
199328010 gbest39.seq
230689500 gbest390.seq
230689871 gbest391.seq
230690844 gbest392.seq
230690688 gbest393.seq
230688522 gbest394.seq
218289442 gbest395.seq
230687793 gbest396.seq
172618127 gbest397.seq
230689771 gbest4.seq
191753281 gbest40.seq
202518090 gbest41.seq
214681834 gbest42.seq
216269223 gbest43.seq
216190929 gbest44.seq
216633861 gbest45.seq
230688007 gbest46.seq
230687762 gbest47.seq
221621059 gbest48.seq
230687934 gbest49.seq
164512939 gbest5.seq
230689000 gbest50.seq
230689773 gbest51.seq
230690649 gbest52.seq
230689934 gbest53.seq
230690612 gbest54.seq
230688990 gbest55.seq
230689848 gbest56.seq
230688082 gbest57.seq
230688272 gbest58.seq
230689838 gbest59.seq
177381218 gbest6.seq
230688591 gbest60.seq
230690624 gbest61.seq
230690472 gbest62.seq
230687879 gbest63.seq
229553075 gbest64.seq
209753634 gbest65.seq
209190062 gbest66.seq
208839723 gbest67.seq
209097587 gbest68.seq
210357949 gbest69.seq
230689592 gbest7.seq
209783445 gbest70.seq
208630852 gbest71.seq
209373022 gbest72.seq
210508854 gbest73.seq
206349334 gbest74.seq
206706341 gbest75.seq
208104789 gbest76.seq
208557541 gbest77.seq
215552257 gbest78.seq
230692510 gbest79.seq
230687624 gbest8.seq
230690478 gbest80.seq
230689918 gbest81.seq
216529690 gbest82.seq
214756165 gbest83.seq
216948883 gbest84.seq
230688414 gbest85.seq
230687856 gbest86.seq
230689925 gbest87.seq
230688102 gbest88.seq
230689510 gbest89.seq
230689095 gbest9.seq
230687836 gbest90.seq
230688777 gbest91.seq
230689813 gbest92.seq
230690064 gbest93.seq
230687504 gbest94.seq
230688973 gbest95.seq
230688052 gbest96.seq
230691029 gbest97.seq
230690587 gbest98.seq
230689139 gbest99.seq
46635954 gbgen.idx
230688107 gbgss1.seq
230687725 gbgss10.seq
227235789 gbgss100.seq
228620171 gbgss101.seq
228716887 gbgss102.seq
228639035 gbgss103.seq
227787500 gbgss104.seq
227476355 gbgss105.seq
230688810 gbgss106.seq
230687872 gbgss107.seq
230688263 gbgss108.seq
230687444 gbgss109.seq
230688531 gbgss11.seq
230689443 gbgss110.seq
230689984 gbgss111.seq
230687785 gbgss112.seq
230688721 gbgss113.seq
230689040 gbgss114.seq
230687798 gbgss115.seq
230689904 gbgss116.seq
230689214 gbgss117.seq
16727697 gbgss118.seq
250000072 gbgss119.seq
230689840 gbgss12.seq
250000918 gbgss120.seq
250002014 gbgss121.seq
250001592 gbgss122.seq
250001313 gbgss123.seq
250000446 gbgss124.seq
250000344 gbgss125.seq
250002066 gbgss126.seq
250003131 gbgss127.seq
250003126 gbgss128.seq
250003425 gbgss129.seq
230688781 gbgss13.seq
250000010 gbgss130.seq
250000371 gbgss131.seq
250001411 gbgss132.seq
250000292 gbgss133.seq
250001979 gbgss134.seq
250000346 gbgss135.seq
250002153 gbgss136.seq
250000192 gbgss137.seq
250000959 gbgss138.seq
250001496 gbgss139.seq
230689491 gbgss14.seq
250002545 gbgss140.seq
250002156 gbgss141.seq
250001785 gbgss142.seq
250000536 gbgss143.seq
168081854 gbgss144.seq
230689388 gbgss15.seq
230690312 gbgss16.seq
230689416 gbgss17.seq
230688168 gbgss18.seq
230691242 gbgss19.seq
230689104 gbgss2.seq
230687646 gbgss20.seq
230688389 gbgss21.seq
230688117 gbgss22.seq
230689818 gbgss23.seq
230688417 gbgss24.seq
230690148 gbgss25.seq
230688716 gbgss26.seq
230689159 gbgss27.seq
230690503 gbgss28.seq
230688067 gbgss29.seq
230688773 gbgss3.seq
230689847 gbgss30.seq
230689064 gbgss31.seq
230688274 gbgss32.seq
230690251 gbgss33.seq
230688223 gbgss34.seq
230689251 gbgss35.seq
230689763 gbgss36.seq
230689765 gbgss37.seq
230689824 gbgss38.seq
230687720 gbgss39.seq
230688472 gbgss4.seq
230687796 gbgss40.seq
230689676 gbgss41.seq
230688528 gbgss42.seq
230687628 gbgss43.seq
230689741 gbgss44.seq
230689064 gbgss45.seq
230690403 gbgss46.seq
230688640 gbgss47.seq
230687840 gbgss48.seq
230688626 gbgss49.seq
230689545 gbgss5.seq
230688657 gbgss50.seq
230687636 gbgss51.seq
230690129 gbgss52.seq
230688632 gbgss53.seq
230689238 gbgss54.seq
230689781 gbgss55.seq
230689722 gbgss56.seq
230688949 gbgss57.seq
230689074 gbgss58.seq
230688312 gbgss59.seq
230688226 gbgss6.seq
230689209 gbgss60.seq
229550355 gbgss61.seq
230687780 gbgss62.seq
230688630 gbgss63.seq
230688826 gbgss64.seq
230688551 gbgss65.seq
230687940 gbgss66.seq
230689586 gbgss67.seq
230689543 gbgss68.seq
230688123 gbgss69.seq
230690492 gbgss7.seq
230688835 gbgss70.seq
230688443 gbgss71.seq
230687585 gbgss72.seq
230688644 gbgss73.seq
230687941 gbgss74.seq
230688938 gbgss75.seq
230688446 gbgss76.seq
230689320 gbgss77.seq
230688982 gbgss78.seq
230689461 gbgss79.seq
230690266 gbgss8.seq
230687514 gbgss80.seq
194290464 gbgss81.seq
194642016 gbgss82.seq
227293003 gbgss83.seq
230688120 gbgss84.seq
230687899 gbgss85.seq
230687651 gbgss86.seq
230688769 gbgss87.seq
230688928 gbgss88.seq
230688353 gbgss89.seq
230689344 gbgss9.seq
230687902 gbgss90.seq
230688571 gbgss91.seq
230687903 gbgss92.seq
230687535 gbgss93.seq
230687801 gbgss94.seq
230689712 gbgss95.seq
230689270 gbgss96.seq
230688595 gbgss97.seq
230687702 gbgss98.seq
230687607 gbgss99.seq
250000418 gbhtc1.seq
250002703 gbhtc2.seq
250003174 gbhtc3.seq
250001551 gbhtc4.seq
250002395 gbhtc5.seq
250000290 gbhtc6.seq
22663640 gbhtc7.seq
250109557 gbhtg1.seq
250131238 gbhtg10.seq
250009200 gbhtg11.seq
250008798 gbhtg12.seq
250063546 gbhtg13.seq
250280245 gbhtg14.seq
250212351 gbhtg15.seq
250041376 gbhtg16.seq
250043860 gbhtg17.seq
250106321 gbhtg18.seq
250046945 gbhtg19.seq
250059239 gbhtg2.seq
250583467 gbhtg20.seq
250267953 gbhtg21.seq
250286406 gbhtg22.seq
250197346 gbhtg23.seq
250226398 gbhtg24.seq
250247948 gbhtg25.seq
250211770 gbhtg26.seq
250093686 gbhtg27.seq
250253958 gbhtg28.seq
250241575 gbhtg29.seq
250022419 gbhtg3.seq
250011801 gbhtg30.seq
250229465 gbhtg31.seq
250075219 gbhtg32.seq
250029593 gbhtg33.seq
250286191 gbhtg34.seq
250119281 gbhtg35.seq
250180624 gbhtg36.seq
250097627 gbhtg37.seq
250179971 gbhtg38.seq
250133143 gbhtg39.seq
250167821 gbhtg4.seq
250063417 gbhtg40.seq
250280629 gbhtg41.seq
250075696 gbhtg42.seq
250238378 gbhtg43.seq
250305179 gbhtg44.seq
250045057 gbhtg45.seq
250208484 gbhtg46.seq
250247213 gbhtg47.seq
250045357 gbhtg48.seq
250045553 gbhtg49.seq
250083826 gbhtg5.seq
250055182 gbhtg50.seq
250244779 gbhtg51.seq
250004648 gbhtg52.seq
250261280 gbhtg53.seq
250211438 gbhtg54.seq
250051223 gbhtg55.seq
250124249 gbhtg56.seq
250009898 gbhtg57.seq
250205305 gbhtg58.seq
250122401 gbhtg59.seq
250210506 gbhtg6.seq
250229317 gbhtg60.seq
250059167 gbhtg61.seq
250055857 gbhtg62.seq
250124043 gbhtg63.seq
250119013 gbhtg64.seq
26125514 gbhtg65.seq
250150190 gbhtg7.seq
250072550 gbhtg8.seq
250256560 gbhtg9.seq
250079231 gbinv1.seq
250346661 gbinv2.seq
250001345 gbinv3.seq
250007465 gbinv4.seq
250002328 gbinv5.seq
250002810 gbinv6.seq
216977997 gbinv7.seq
1165360502 gbjou.idx
250002495 gbmam1.seq
71777791 gbmam2.seq
16304530 gbnew.txt
250000401 gbpat1.seq
250002695 gbpat10.seq
250002172 gbpat11.seq
250000068 gbpat12.seq
250000440 gbpat13.seq
250000629 gbpat14.seq
250004563 gbpat15.seq
250002784 gbpat16.seq
250000303 gbpat17.seq
91995579 gbpat18.seq
250000151 gbpat2.seq
250001647 gbpat3.seq
250000436 gbpat4.seq
250005674 gbpat5.seq
250020644 gbpat6.seq
250000542 gbpat7.seq
250001648 gbpat8.seq
250000485 gbpat9.seq
40415593 gbphg.seq
250023914 gbpln1.seq
250053436 gbpln10.seq
250004369 gbpln11.seq
250001548 gbpln12.seq
250000273 gbpln13.seq
250001795 gbpln14.seq
250027589 gbpln15.seq
98892021 gbpln16.seq
250183998 gbpln2.seq
250000487 gbpln3.seq
250002217 gbpln4.seq
250008704 gbpln5.seq
250019283 gbpln6.seq
250010566 gbpln7.seq
286380636 gbpln8.seq
269778888 gbpln9.seq
250205471 gbpri1.seq
250204151 gbpri10.seq
250126277 gbpri11.seq
250114686 gbpri12.seq
250117529 gbpri13.seq
250032315 gbpri14.seq
250018695 gbpri15.seq
250000136 gbpri16.seq
250007265 gbpri17.seq
250001943 gbpri18.seq
250016132 gbpri19.seq
250011821 gbpri2.seq
250048265 gbpri20.seq
250135243 gbpri21.seq
250001177 gbpri22.seq
250007584 gbpri23.seq
250028748 gbpri24.seq
250084573 gbpri25.seq
250002128 gbpri26.seq
250003120 gbpri27.seq
212489426 gbpri28.seq
250093884 gbpri3.seq
250218049 gbpri4.seq
250033374 gbpri5.seq
250081125 gbpri6.seq
250025514 gbpri7.seq
250044103 gbpri8.seq
250101424 gbpri9.seq
188912 gbrel.txt
250053858 gbrod1.seq
250228075 gbrod10.seq
250187986 gbrod11.seq
250000096 gbrod12.seq
250253800 gbrod13.seq
250053618 gbrod14.seq
250107656 gbrod15.seq
250003294 gbrod16.seq
250031602 gbrod17.seq
226337322 gbrod18.seq
250064338 gbrod2.seq
250099600 gbrod3.seq
250134909 gbrod4.seq
250055076 gbrod5.seq
250103400 gbrod6.seq
250046964 gbrod7.seq
250187068 gbrod8.seq
250229255 gbrod9.seq
3618948876 gbsdr.txt
1552108 gbsec.idx
250000337 gbsts1.seq
250002547 gbsts10.seq
250000288 gbsts11.seq
250000494 gbsts12.seq
250001160 gbsts13.seq
8757056 gbsts14.seq
250000356 gbsts2.seq
250000065 gbsts3.seq
250002109 gbsts4.seq
250001337 gbsts5.seq
250003615 gbsts6.seq
250001117 gbsts7.seq
250003820 gbsts8.seq
250001377 gbsts9.seq
101203530 gbsyn.seq
504040 gbuna.seq
250001298 gbvrl1.seq
250008632 gbvrl2.seq
250001180 gbvrl3.seq
250057230 gbvrl4.seq
14445073 gbvrl5.seq
250001471 gbvrt1.seq
250080776 gbvrt2.seq
250000015 gbvrt3.seq
250044655 gbvrt4.seq
250141537 gbvrt5.seq
250012518 gbvrt6.seq
250353261 gbvrt7.seq
250001715 gbvrt8.seq
80186922 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 26664 101088072
BCT10 38247 90955931
BCT11 14230 29324093
BCT2 7595 107027017
BCT3 463 114552258
BCT4 27625 103505191
BCT5 30148 96691977
BCT6 62752 88303007
BCT7 7037 113146296
BCT8 531 94066964
BCT9 3215 108245254
ENV1 97610 71522493
ENV2 49067 42111079
EST1 68120 26287999
EST10 76551 29777005
EST100 71659 47331703
EST101 70084 43424166
EST102 73328 44294259
EST103 71275 30869153
EST104 70621 30374209
EST105 65669 36911858
EST106 68035 37213126
EST107 69108 45257899
EST108 73983 31621346
EST109 75228 34976790
EST11 74768 28648170
EST110 74908 27372600
EST111 73963 35580028
EST112 71941 34855270
EST113 69180 40571008
EST114 80246 44367337
EST115 76544 46315848
EST116 68457 43140439
EST117 67250 43096940
EST118 74351 49790480
EST119 70080 42772975
EST12 77401 30639736
EST120 74787 43102987
EST121 74027 46560382
EST122 72002 47864574
EST123 73938 51665047
EST124 78950 39034837
EST125 76139 30886903
EST126 78932 41145531
EST127 78290 41902160
EST128 76338 47664125
EST129 60649 28317049
EST13 76282 29157393
EST130 72330 38372820
EST131 67385 39680315
EST132 67148 36168617
EST133 71399 43809033
EST134 72950 44499542
EST135 67491 39106708
EST136 72894 41541018
EST137 70301 43265540
EST138 62732 39011965
EST139 76902 41968874
EST14 78057 31443273
EST140 99570 54444351
EST141 67996 37823627
EST142 103656 54533546
EST143 110110 58793209
EST144 100927 56039347
EST145 82676 48700881
EST146 88951 49863743
EST147 95913 58956108
EST148 98490 59210065
EST149 76744 43791286
EST15 74364 31405618
EST150 69339 36738691
EST151 63717 28498782
EST152 56259 25905045
EST153 63408 30741788
EST154 59841 30760658
EST155 64601 34665469
EST156 76488 53176058
EST157 63968 43919986
EST158 80830 47405554
EST159 61581 31584579
EST16 75777 33355322
EST160 61699 31186472
EST161 66869 40928365
EST162 65638 32858736
EST163 63979 46615505
EST164 83148 43687889
EST165 94393 45232869
EST166 94115 55922526
EST167 102787 59610329
EST168 95781 53450750
EST169 95468 43077389
EST17 81616 33405778
EST170 91949 43886310
EST171 93779 45233231
EST172 90422 36522722
EST173 88680 42416368
EST174 64513 44572292
EST175 70692 37843147
EST176 57661 34250551
EST177 71534 43102812
EST178 72589 26536776
EST179 75654 45909732
EST18 80785 32719057
EST180 74985 37803874
EST181 68004 34403370
EST182 68374 40574003
EST183 70151 52942930
EST184 69208 38709017
EST185 67849 33755764
EST186 69791 55052830
EST187 68244 44517307
EST188 72769 37099635
EST189 68810 48653142
EST19 78746 31493979
EST190 70265 57308297
EST191 64585 47975102
EST192 64520 47059293
EST193 64998 47477601
EST194 65166 45865696
EST195 66432 50566351
EST196 62782 39457538
EST197 63972 35329937
EST198 63140 36282355
EST199 71366 40780171
EST2 74809 28707246
EST20 74116 30816830
EST200 92624 53520877
EST201 69021 47154755
EST202 94412 57003389
EST203 107186 66143325
EST204 108690 64389084
EST205 107353 65161998
EST206 103095 66959190
EST207 118523 55797106
EST208 101544 60749905
EST209 110794 49508984
EST21 74470 34190059
EST210 86529 47863972
EST211 69410 38647009
EST212 68997 58131988
EST213 68222 59211981
EST214 80115 40296905
EST215 81061 44781549
EST216 74649 52854332
EST217 72240 50290556
EST218 43072 21244291
EST219 27821 10564022
EST22 74009 29716264
EST220 27739 10242000
EST221 26390 9803971
EST222 26686 9006263
EST223 27546 9756124
EST224 27223 10084316
EST225 27206 9768481
EST226 27360 10244195
EST227 27141 12096192
EST228 27240 11299892
EST229 27352 10142795
EST23 77324 32932723
EST230 27636 9309562
EST231 26889 9197750
EST232 27809 11277776
EST233 27814 10812359
EST234 27128 11354017
EST235 26651 11932582
EST236 27094 11390571
EST237 27080 10908971
EST238 27051 11522721
EST239 27167 11556532
EST24 74246 32217079
EST240 27294 11182236
EST241 27297 10833837
EST242 27216 10575551
EST243 27274 10825698
EST244 24685 17278872
EST245 25631 17076348
EST246 40304 19121364
EST247 108862 40795248
EST248 72902 41165900
EST249 68673 44539809
EST25 74626 32505243
EST250 69358 44556131
EST251 69185 44320701
EST252 67002 39291741
EST253 74731 43463707
EST254 64637 48230306
EST255 65057 33874879
EST256 76481 38121742
EST257 102482 47331514
EST258 75165 42444419
EST259 67009 34235468
EST26 74312 30365381
EST260 67975 32841445
EST261 70463 42307044
EST262 73313 34520681
EST263 70908 35861893
EST264 73006 46620663
EST265 63125 33780886
EST266 67606 37349924
EST267 83637 44128312
EST268 75837 42341616
EST269 79735 52403175
EST27 74827 32506654
EST270 77692 53703767
EST271 112478 49433307
EST272 80895 42269720
EST273 73943 46360384
EST274 72747 39110002
EST275 72419 37585450
EST276 69871 27347444
EST277 68814 41445750
EST278 62730 35148067
EST279 64639 41486593
EST28 106860 50550021
EST280 70619 40588714
EST281 64241 44387262
EST282 63096 32230253
EST283 81427 43121616
EST284 83651 44328068
EST285 81580 50307999
EST286 109209 54368694
EST287 117138 48234593
EST288 73268 35611659
EST289 67670 36762048
EST29 97907 45907095
EST290 71396 46840628
EST291 81191 39714658
EST292 69967 41935409
EST293 71340 41523180
EST294 60262 34457835
EST295 52572 31529593
EST296 68876 43905776
EST297 69625 44629474
EST298 68369 42737030
EST299 70186 40681430
EST3 73670 29894145
EST30 98226 53437358
EST300 76760 38197244
EST301 73011 49675355
EST302 69672 36957539
EST303 71303 46814989
EST304 66968 53329090
EST305 62345 47581275
EST306 64917 38612463
EST307 67385 42551850
EST308 69911 44352200
EST309 47977 24017004
EST31 75718 38178867
EST310 61971 32925020
EST311 71191 37748175
EST312 57986 28777893
EST313 66907 41863439
EST314 70578 42273416
EST315 81086 41186454
EST316 63706 37595016
EST317 75703 45660026
EST318 67147 43098413
EST319 74686 46041315
EST32 66355 62892955
EST320 85082 49291083
EST321 91132 49876647
EST322 65479 34852856
EST323 60558 38536529
EST324 77374 37950497
EST325 52151 28826707
EST326 56804 31157689
EST327 70478 40367721
EST328 88588 47032083
EST329 86452 43677246
EST33 81235 47957211
EST330 69693 47115681
EST331 79160 53827224
EST332 65096 37083501
EST333 67723 34943453
EST334 85158 38991506
EST335 60699 39077291
EST336 50690 36550094
EST337 65701 36351700
EST338 86451 52789419
EST339 89930 49573623
EST34 91292 44786436
EST340 68587 39818582
EST341 80291 41124406
EST342 48248 30227726
EST343 44259 23141822
EST344 75765 48952119
EST345 80376 39707775
EST346 78172 47661634
EST347 74092 38903442
EST348 62679 41484625
EST349 71135 39348069
EST35 85056 45875728
EST350 59878 36274790
EST351 73732 31924537
EST352 79982 25696253
EST353 68381 40343183
EST354 68019 38361993
EST355 70797 37817138
EST356 79238 47347385
EST357 65046 45389086
EST358 73742 43853105
EST359 61591 34275805
EST36 99712 46048781
EST360 70399 42525122
EST361 77566 50081797
EST362 82971 48489230
EST363 70839 42262844
EST364 59410 42013294
EST365 57526 41659871
EST366 57574 41217907
EST367 64456 39915473
EST368 72313 43337281
EST369 57988 36245953
EST37 97572 50023360
EST370 57921 38482039
EST371 59311 40729773
EST372 60451 42008869
EST373 55508 41637832
EST374 46822 33411246
EST375 83375 39000226
EST376 52345 40722474
EST377 66517 46431422
EST378 67542 38032168
EST379 65253 40701780
EST38 103249 47219823
EST380 120346 60200595
EST381 77808 48412073
EST382 78281 57171018
EST383 38086 21279286
EST384 51684 56670468
EST385 48183 58044223
EST386 65339 45900951
EST387 72938 42635282
EST388 71021 43823654
EST389 66867 43565792
EST39 72890 22973757
EST390 77319 33387726
EST391 70059 25566021
EST392 73079 27282210
EST393 73957 26161094
EST394 76511 27326926
EST395 72352 24991487
EST396 71161 29317326
EST397 57194 21042344
EST4 74044 28188819
EST40 68914 18328634
EST41 78040 22664316
EST42 43618 12147690
EST43 43326 11779338
EST44 42992 12023052
EST45 43026 11258680
EST46 96445 42627733
EST47 94407 43779636
EST48 90848 47635534
EST49 86077 39424937
EST5 48459 15407185
EST50 106817 56705020
EST51 92485 44456592
EST52 74469 31439025
EST53 68534 30503510
EST54 71031 30757683
EST55 72830 30458823
EST56 82553 33072151
EST57 72971 28312140
EST58 63909 27930792
EST59 72180 31539734
EST6 55072 17488108
EST60 75558 35594373
EST61 73092 32008324
EST62 76076 27279410
EST63 79200 30811884
EST64 72808 31775916
EST65 40086 11445647
EST66 40088 11311395
EST67 40249 12626379
EST68 40521 12251779
EST69 40501 12464413
EST7 74129 29185232
EST70 40413 12897723
EST71 40422 12522630
EST72 40247 12081148
EST73 40269 12320636
EST74 41081 12227149
EST75 41201 12365223
EST76 41124 13072758
EST77 40924 12989600
EST78 43521 12465320
EST79 43488 20022563
EST8 75475 30478019
EST80 40732 24679120
EST81 42659 18431985
EST82 49826 21345614
EST83 50973 21395731
EST84 49875 21862936
EST85 72941 31972425
EST86 73954 28680340
EST87 72505 29735024
EST88 76838 43029179
EST89 77717 40885936
EST9 77491 29868758
EST90 75659 41897926
EST91 78092 34781473
EST92 71558 42693940
EST93 72244 36648250
EST94 75192 39042425
EST95 70642 37396263
EST96 76789 44753523
EST97 69736 39812153
EST98 69387 35250456
EST99 73463 34869799
GSS1 90830 38840325
GSS10 75206 43834733
GSS100 75212 41059945
GSS101 73602 45108630
GSS102 73487 45397443
GSS103 73577 45171185
GSS104 73248 44908249
GSS105 73550 44099486
GSS106 80755 53471685
GSS107 85945 58093475
GSS108 81303 53501293
GSS109 84497 53070253
GSS11 69996 35692760
GSS110 84988 50873645
GSS111 81004 65397777
GSS112 92395 43070580
GSS113 91919 54309323
GSS114 74137 48104664
GSS115 88263 64893392
GSS116 80050 51966745
GSS117 75406 49632912
GSS118 6725 3070419
GSS119 87186 64735440
GSS12 73602 38703339
GSS120 83935 63019590
GSS121 101315 46890949
GSS122 68987 58741465
GSS123 68486 58900409
GSS124 69543 56767222
GSS125 69807 56256256
GSS126 70545 55626531
GSS127 86106 73157964
GSS128 85147 41145094
GSS129 70900 47111306
GSS13 76603 38828632
GSS130 110664 72686395
GSS131 85620 36024855
GSS132 90317 68161536
GSS133 73102 60784188
GSS134 70488 59255772
GSS135 66160 63490090
GSS136 77503 57245413
GSS137 121253 73516762
GSS138 118587 76239211
GSS139 104445 58594833
GSS14 71650 32201312
GSS140 87258 55418188
GSS141 97210 56407517
GSS142 79406 44052823
GSS143 98949 64322550
GSS144 68495 31169400
GSS15 71086 35441254
GSS16 77507 45686526
GSS17 71228 33510360
GSS18 57979 27843556
GSS19 57001 28963862
GSS2 89386 39537365
GSS20 57915 26502413
GSS21 62239 31416422
GSS22 64364 36076679
GSS23 57734 26984473
GSS24 67882 43045055
GSS25 66749 27450949
GSS26 58232 25663358
GSS27 67954 32485197
GSS28 63014 32542480
GSS29 81089 40672773
GSS3 87699 41940140
GSS30 81280 39914030
GSS31 74482 40453148
GSS32 70617 48527552
GSS33 79978 37722016
GSS34 76202 40335393
GSS35 75284 40076535
GSS36 87594 58177141
GSS37 87583 58192851
GSS38 85714 44767061
GSS39 84741 48507593
GSS4 79302 41207098
GSS40 88426 37648164
GSS41 82336 36334432
GSS42 81277 56890790
GSS43 79117 57053348
GSS44 72241 47667100
GSS45 72251 47598633
GSS46 78280 44955865
GSS47 78172 40525870
GSS48 83990 58703719
GSS49 86274 67735239
GSS5 79041 40731400
GSS50 83779 51530385
GSS51 93222 60183869
GSS52 87653 57321998
GSS53 74724 39810038
GSS54 76088 44765936
GSS55 85984 45327428
GSS56 87644 57687353
GSS57 75738 69473941
GSS58 72279 78907099
GSS59 89418 68082593
GSS6 78254 38894764
GSS60 85002 56288785
GSS61 63608 45418536
GSS62 71007 49146092
GSS63 89658 67264637
GSS64 86292 56740883
GSS65 87515 54644266
GSS66 87448 56612904
GSS67 97902 58021877
GSS68 100639 54495632
GSS69 100833 54248472
GSS7 77539 39418763
GSS70 101256 53713400
GSS71 102445 52204338
GSS72 102244 52457905
GSS73 102706 51873146
GSS74 102120 52615559
GSS75 97729 57973249
GSS76 90121 70212028
GSS77 89836 70779239
GSS78 87901 69540084
GSS79 87819 69686487
GSS8 76331 38106216
GSS80 88911 61596013
GSS81 79916 21971523
GSS82 78051 24611364
GSS83 89843 37208310
GSS84 84388 51170737
GSS85 81031 51775476
GSS86 89748 64981511
GSS87 77441 62868973
GSS88 78840 79267400
GSS89 76917 55077765
GSS9 72576 37287310
GSS90 94598 49290186
GSS91 75069 40308494
GSS92 85911 52282976
GSS93 72008 59734425
GSS94 85704 53044600
GSS95 82838 60644850
GSS96 87219 57700740
GSS97 83897 56056740
GSS98 88543 58255806
GSS99 80577 63755679
HTC1 32150 55611252
HTC2 31636 66259760
HTC3 75197 40605663
HTC4 78495 71501582
HTC5 88003 82548838
HTC6 70897 96781356
HTC7 3773 9642788
HTG1 1317 188906440
HTG10 1240 186631208
HTG11 1429 184128870
HTG12 884 191847818
HTG13 751 192271968
HTG14 741 192392029
HTG15 776 192307789
HTG16 802 192004940
HTG17 766 192210840
HTG18 1991 172300389
HTG19 956 189542721
HTG2 2563 186021293
HTG20 1184 186796041
HTG21 785 192070821
HTG22 895 190715809
HTG23 892 191030479
HTG24 845 191105384
HTG25 768 192244591
HTG26 846 191572919
HTG27 862 191391532
HTG28 920 190587618
HTG29 935 190412440
HTG3 2449 185332304
HTG30 960 190293544
HTG31 871 191390266
HTG32 842 191698217
HTG33 983 189657813
HTG34 871 191443900
HTG35 864 191448401
HTG36 815 192050979
HTG37 957 189945146
HTG38 947 190884545
HTG39 941 190460140
HTG4 2529 188498207
HTG40 1040 189405878
HTG41 1204 187096880
HTG42 1265 188255216
HTG43 1161 188749165
HTG44 1167 187304832
HTG45 1091 191578721
HTG46 1217 191058998
HTG47 1241 191266172
HTG48 1176 191246655
HTG49 1156 190824262
HTG5 1281 185666662
HTG50 1106 190399028
HTG51 1146 189868996
HTG52 1438 188167836
HTG53 1505 187950158
HTG54 1270 189990080
HTG55 1393 189146518
HTG56 1498 187531290
HTG57 1400 188350863
HTG58 1136 192699435
HTG59 1191 191143480
HTG6 1274 185376276
HTG60 1460 188721861
HTG61 1054 193939310
HTG62 1024 193939416
HTG63 1039 193732937
HTG64 1021 190472340
HTG65 86 15436436
HTG7 1247 185590985
HTG8 1288 184967388
HTG9 1184 187271351
INV1 16025 164186392
INV2 1625 166905604
INV3 36770 113722932
INV4 74454 75366928
INV5 78995 73164596
INV6 41301 106055548
INV7 39867 88001603
MAM1 56018 110589561
MAM2 18859 25315921
PAT1 222992 70284635
PAT10 120456 49142420
PAT11 95772 59599231
PAT12 141786 56093795
PAT13 146764 60898774
PAT14 138575 94136863
PAT15 116090 112705379
PAT16 109755 112694745
PAT17 129180 84201697
PAT18 81670 23197205
PAT2 194348 84711886
PAT3 171908 95947517
PAT4 149245 105447674
PAT5 141910 87814164
PAT6 113021 112456929
PAT7 142254 93631405
PAT8 132678 95529170
PAT9 135112 83229998
PHG 2584 16172659
PLN1 33345 123907235
PLN10 19824 137911829
PLN11 63867 68572945
PLN12 78327 78010321
PLN13 67813 80854457
PLN14 25738 130160302
PLN15 41122 112835169
PLN16 16186 40219003
PLN2 1375 177015036
PLN3 13849 150837082
PLN4 77635 77706690
PLN5 64462 64712097
PLN6 30513 63443689
PLN7 1261 165354355
PLN8 1018 205657850
PLN9 7 212935788
PRI1 18634 149385103
PRI10 1414 180883745
PRI11 1294 178380473
PRI12 1562 179683036
PRI13 1628 178784975
PRI14 1429 187447022
PRI15 23855 151800300
PRI16 43658 94626270
PRI17 15591 144147638
PRI18 1602 184080977
PRI19 1749 183151062
PRI2 1448 174545815
PRI20 2097 181376655
PRI21 1618 185719152
PRI22 31680 137489468
PRI23 45028 78209667
PRI24 19361 129099550
PRI25 14944 166169746
PRI26 35823 137765011
PRI27 35128 133297064
PRI28 51101 83417564
PRI3 1277 185784885
PRI4 1338 184728398
PRI5 1183 180181225
PRI6 1226 180152200
PRI7 1220 179417165
PRI8 1372 175005827
PRI9 1257 178793503
ROD1 8638 170482033
ROD10 1029 185328237
ROD11 986 185138517
ROD12 11257 170902699
ROD13 17578 161164555
ROD14 1208 191541995
ROD15 1236 193985625
ROD16 30603 129212136
ROD17 22822 105143746
ROD18 45994 99144023
ROD2 922 174109587
ROD3 900 174295122
ROD4 914 174875480
ROD5 954 175675737
ROD6 964 180169922
ROD7 980 181034156
ROD8 1001 182095155
ROD9 990 182269276
STS1 82037 35577071
STS10 58200 44465512
STS11 57993 43684355
STS12 77653 37939409
STS13 88694 38900528
STS14 4211 2331244
STS2 83808 43759687
STS3 78693 32136181
STS4 64147 33083130
STS5 54894 31906223
STS6 54698 32307628
STS7 54687 32221872
STS8 56532 39200433
STS9 58082 44557841
SYN 23186 31916065
UNA 258 133962
VRL1 72482 65503098
VRL2 72073 66421912
VRL3 72197 68573507
VRL4 74381 65935823
VRL5 2904 5176705
VRT1 57543 106015479
VRT2 15694 167026053
VRT3 74364 79962371
VRT4 30044 89981467
VRT5 1211 193460577
VRT6 1275 193122912
VRT7 11851 176724512
VRT8 18697 167370893
VRT9 24005 24364266
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 148.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
8537604 11153242715 Homo sapiens
6217008 7313249665 Mus musculus
1006680 5664433977 Rattus norvegicus
819469 2095578811 Danio rerio
2483113 1648296285 Zea mays
1106194 1217825580 Bos taurus
354166 1165697523 Oryza sativa (japonica cultivar-group)
1027667 834732630 Xenopus tropicalis
1407457 804586343 Canis familiaris
530176 780868928 Drosophila melanogaster
975659 643918429 Arabidopsis thaliana
728072 634736291 Gallus gallus
207582 521015600 Pan troglodytes
784408 462499524 Sorghum bicolor
693241 418469565 Ciona intestinalis
604016 404725937 Sus scrofa
596254 404126997 Brassica oleracea
387679 394376871 Medicago truncatula
58519 378392579 Macaca mulatta
598460 335827355 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 14 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2005
NCBI-GenBank Flat File Release 148.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.14.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each base
code in the sequence. Mandatory keyword/exactly one record.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5 to 3 direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5 to 3.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5 to 3 direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 148.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Medha Bhagwat, Peter Cooper, Susan Dombrowski, Andrei Gabrielian
Renata Geer, Chuong Huynh, Scott McGinnis, Donna Messersmith, Rana Morris,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
