Release Notes For GenBank Release 149
GBREL.TXT Genetic Sequence Data Bank
August 15 2005
NCBI-GenBank Flat File Release 149.0
Distribution Release Notes
46947388 loci, 51674486881 bases, from 46947388 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 149.0
1.2 Cutoff Date
1.3 Important Changes in Release 149.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 149.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 149.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 149.0, incorporates data available to the collaborating
databases as of August 15, 2005 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 149.0
1.3.0 GenBank Exceeds 100 Gigabases!
GenBank reaches a milestone with 149.0, exceeding 100 gigabases of sequence
data. It is interesting to note that the Whole Genome Shotgun (WGS) portion
of the database has grown to exceed the non-WGS portion in just 3.5 years.
1.3.1 Problems generating accession number and keyword indexes
Continuing software problems again prevented the generation of
the gbacc.idx and gbkey.idx 'index' files which normally accompany
GenBank releases.
A version of gbacc.idx was built manually. However, the first field
contains just an accession number rather than Accession.Version .
The gbkey.idx index could not be created without substantial
additional delays in release processing, so it is completely absent
from 149.0 .
Our apologies for any inconvenience that this may cause.
1.3.2 Organizational changes
The total number of sequence data files increased by 25 with this release:
- the EST division is now comprised of 413 files (+16)
- the GSS division is now comprised of 151 files (+7)
- the HTG division is now comprised of 68 files (+3)
- the PRI division is now comprised of 29 files (+1)
- the ROD division is now comprised of 20 files (+2)
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
twenty-seven of the GSS flatfiles in Release 149.0. Consider gbgss125.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
August 15 2005
NCBI-GenBank Flat File Release 149.0
GSS Sequences (Part 1)
87189 loci, 64730609 bases, from 87189 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "125" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
Several changes related to the Feature Table were agreed to during the
May 2005 collaborative meeting among DDBJ, EMBL, and GenBank. The descriptions
of the changes provided below are preliminary; complete definitions will appear
in future release notes.
1.4.1 New qualifiers for the source feature
A set of five new source feature qualifiers will be legal as of the
October 2005 release.
/lat_lon : GPS coordinates for the location at which a specimen,
from which the sequence was obtained, was collected.
Format: Decimal degrees (N/S, E/W).
/collected_by : Name of the person who collected the specimen.
/collection_date : Date that the specimen was collected.
Format: DD-MMM-YYYY (two-digit month, three letter
month abbreviation, 4-digit year)
/identified_by : Name of the person who identified the specimen.
/PCR_primers="fwd_name: XXX, fwd_seq: aaatttgggccc"
rev_name: YYY, rev_seq: gggcccaaattt"
Four separate primer-related qualifiers were initially proposed
(and announced), but in subsequent discussion it was decided to
combine them into a single structured /PCR_primers qualifier.
fwd_seq and rev_seq are mandatory, and their values must be from
the IUPAC nucleotide alphabet. fwd_name and rev_name are both
optional. The primer names (if present) must be a single token,
without whitespace.
The order of the elements within the /PCR_primers must always be
as shown above. Multiple /PCR_primers qualifiers may exist on a
source feature.
These qualifiers will most likely see their first use in association
with environmental sampling projects and the BarCode project.
1.4.2 : /evidence qualifer to be replaced
Two new qualifiers designed to replace /evidence will be legal as
of the October 2005 GenBank release : /experiment and /inference .
The current /evidence="not_experimental" qualifier will be replaced
by /inference . The /inference values will be from a controlled list
which is intended to capture several different classes of inferential
methods.
The current /evidence="experimental" qualifier will be replaced
by /experiment. This will be a free-text qualifier in which a brief
description of the nature of the bench experiment which supports
the associated feature can be provided by the submittor.
1.4.3 New /organelle qualifier value
As of the October 2005 GenBank release, a new value for the /organelle
qualifier will be legal : hydrogenosome
This will support the annotation of sequences from anaerobic protozoa
and fungi, for which the hydrogenosome has a role in anaerobic respiration.
1.4.4 Two new CDS qualifiers
As of the October 2005 GenBank release, two new CDS feature qualifiers
will be introduced:
/trans_splicing
/ribosomal_slippage
Coding regions involved in such processes will be more easily identified
with the addition of these qualifiers.
1.4.5 New /exception qualifier value
Coding regions for which the conceptual protein translation differs from
the supplied /translation qualifier are flagged with an /exception
qualifier. The value :
"rearrangement required for product"
will be legal for this qualifier as of the October 2005 GenBank release.
1.4.6 : /repeat_unit qualifer to be replaced
Two new qualifiers designed to replace /repeat_unit will be legal as
of the October 2005 GenBank release : /repeat_unit_seq and /repeat_unit_range .
The current qualifier accomodates both integer ranges (eg: "10..20") and
characters that represent a repeat unit pattern (eg: (AT)2(AA)5 ). Introducing
a distinct qualifier for each of these representations will make it easier
to submit and validate them.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 816 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut27.idx - Index of the entries according to accession number, part 27.
22. gbaut28.idx - Index of the entries according to accession number, part 28.
23. gbaut29.idx - Index of the entries according to accession number, part 29.
24. gbaut3.idx - Index of the entries according to accession number, part 3.
25. gbaut30.idx - Index of the entries according to accession number, part 30.
26. gbaut31.idx - Index of the entries according to accession number, part 31.
27. gbaut4.idx - Index of the entries according to accession number, part 4.
28. gbaut5.idx - Index of the entries according to accession number, part 5.
29. gbaut6.idx - Index of the entries according to accession number, part 6.
30. gbaut7.idx - Index of the entries according to accession number, part 7.
31. gbaut8.idx - Index of the entries according to accession number, part 8.
32. gbaut9.idx - Index of the entries according to accession number, part 9.
33. gbbct1.seq - Bacterial sequence entries, part 1.
34. gbbct10.seq - Bacterial sequence entries, part 10.
35. gbbct11.seq - Bacterial sequence entries, part 11.
36. gbbct2.seq - Bacterial sequence entries, part 2.
37. gbbct3.seq - Bacterial sequence entries, part 3.
38. gbbct4.seq - Bacterial sequence entries, part 4.
39. gbbct5.seq - Bacterial sequence entries, part 5.
40. gbbct6.seq - Bacterial sequence entries, part 6.
41. gbbct7.seq - Bacterial sequence entries, part 7.
42. gbbct8.seq - Bacterial sequence entries, part 8.
43. gbbct9.seq - Bacterial sequence entries, part 9.
44. gbchg.txt - Accession numbers of entries updated since the previous release.
45. gbcon.seq - Constructed sequence entries.
46. gbdel.txt - Accession numbers of entries deleted since the previous release.
47. gbenv1.seq - Environmental sampling sequence entries, part 1.
48. gbenv2.seq - Environmental sampling sequence entries, part 2.
49. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
50. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
51. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
52. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
53. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
54. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
55. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
56. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
57. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
58. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
59. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
60. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
61. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
62. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
63. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
64. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
65. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
66. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
67. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
68. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
69. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
70. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
71. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
72. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
73. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
74. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
75. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
76. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
77. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
78. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
79. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
80. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
81. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
82. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
83. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
84. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
85. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
86. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
87. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
88. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
89. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
90. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
91. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
92. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
93. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
94. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
95. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
96. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
97. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
98. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
99. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
100. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
101. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
102. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
103. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
104. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
105. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
106. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
107. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
108. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
109. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
110. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
111. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
112. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
113. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
114. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
115. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
116. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
117. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
118. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
119. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
120. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
121. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
122. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
123. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
124. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
125. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
126. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
127. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
128. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
129. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
130. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
131. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
132. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
133. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
134. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
135. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
136. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
137. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
138. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
139. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
140. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
141. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
142. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
143. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
144. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
145. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
146. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
147. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
148. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
149. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
150. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
151. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
152. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
153. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
154. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
155. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
156. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
157. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
158. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
159. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
160. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
161. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
162. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
163. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
164. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
165. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
166. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
167. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
168. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
169. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
170. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
171. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
172. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
173. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
174. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
175. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
176. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
177. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
178. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
179. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
180. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
181. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
182. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
183. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
184. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
185. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
186. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
187. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
188. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
189. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
190. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
191. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
192. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
193. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
194. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
195. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
196. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
197. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
198. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
199. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
200. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
201. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
202. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
203. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
204. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
205. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
206. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
207. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
208. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
209. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
210. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
211. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
212. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
213. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
214. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
215. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
216. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
217. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
218. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
219. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
220. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
221. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
222. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
223. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
224. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
225. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
226. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
227. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
228. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
229. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
230. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
231. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
232. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
233. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
234. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
235. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
236. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
237. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
238. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
239. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
240. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
241. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
242. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
243. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
244. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
245. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
246. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
247. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
248. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
249. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
250. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
251. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
252. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
253. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
254. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
255. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
256. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
257. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
258. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
259. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
260. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
261. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
262. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
263. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
264. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
265. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
266. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
267. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
268. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
269. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
270. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
271. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
272. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
273. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
274. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
275. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
276. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
277. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
278. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
279. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
280. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
281. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
282. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
283. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
284. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
285. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
286. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
287. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
288. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
289. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
290. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
291. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
292. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
293. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
294. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
295. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
296. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
297. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
298. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
299. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
300. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
301. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
302. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
303. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
304. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
305. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
306. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
307. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
308. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
309. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
310. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
311. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
312. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
313. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
314. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
315. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
316. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
317. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
318. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
319. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
320. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
321. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
322. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
323. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
324. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
325. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
326. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
327. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
328. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
329. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
330. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
331. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
332. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
333. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
334. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
335. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
336. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
337. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
338. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
339. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
340. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
341. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
342. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
343. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
344. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
345. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
346. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
347. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
348. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
349. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
350. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
351. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
352. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
353. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
354. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
355. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
356. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
357. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
358. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
359. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
360. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
361. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
362. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
363. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
364. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
365. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
366. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
367. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
368. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
369. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
370. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
371. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
372. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
373. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
374. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
375. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
376. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
377. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
378. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
379. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
380. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
381. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
382. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
383. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
384. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
385. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
386. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
387. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
388. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
389. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
390. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
391. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
392. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
393. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
394. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
395. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
396. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
397. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
398. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
399. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
400. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
401. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
402. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
403. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
404. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
405. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
406. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
407. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
408. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
409. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
410. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
411. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
412. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
413. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
414. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
415. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
416. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
417. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
418. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
419. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
420. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
421. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
422. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
423. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
424. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
425. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
426. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
427. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
428. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
429. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
430. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
431. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
432. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
433. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
434. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
435. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
436. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
437. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
438. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
439. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
440. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
441. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
442. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
443. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
444. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
445. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
446. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
447. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
448. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
449. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
450. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
451. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
452. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
453. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
454. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
455. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
456. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
457. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
458. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
459. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
460. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
461. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
462. gbgen.idx - Index of the entries according to gene symbols.
463. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
464. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
465. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
466. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
467. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
468. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
469. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
470. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
471. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
472. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
473. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
474. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
475. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
476. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
477. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
478. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
479. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
480. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
481. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
482. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
483. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
484. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
485. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
486. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
487. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
488. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
489. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
490. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
491. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
492. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
493. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
494. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
495. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
496. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
497. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
498. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
499. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
500. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
501. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
502. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
503. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
504. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
505. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
506. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
507. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
508. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
509. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
510. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
511. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
512. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
513. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
514. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
515. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
516. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
517. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
518. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
519. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
520. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
521. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
522. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
523. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
524. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
525. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
526. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
527. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
528. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
529. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
530. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
531. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
532. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
533. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
534. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
535. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
536. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
537. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
538. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
539. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
540. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
541. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
542. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
543. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
544. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
545. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
546. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
547. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
548. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
549. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
550. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
551. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
552. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
553. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
554. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
555. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
556. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
557. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
558. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
559. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
560. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
561. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
562. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
563. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
564. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
565. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
566. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
567. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
568. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
569. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
570. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
571. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
572. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
573. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
574. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
575. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
576. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
577. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
578. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
579. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
580. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
581. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
582. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
583. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
584. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
585. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
586. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
587. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
588. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
589. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
590. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
591. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
592. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
593. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
594. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
595. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
596. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
597. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
598. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
599. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
600. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
601. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
602. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
603. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
604. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
605. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
606. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
607. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
608. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
609. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
610. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
611. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
612. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
613. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
614. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
615. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
616. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
617. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
618. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
619. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
620. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
621. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
622. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
623. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
624. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
625. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
626. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
627. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
628. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
629. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
630. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
631. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
632. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
633. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
634. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
635. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
636. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
637. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
638. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
639. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
640. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
641. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
642. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
643. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
644. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
645. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
646. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
647. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
648. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
649. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
650. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
651. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
652. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
653. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
654. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
655. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
656. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
657. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
658. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
659. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
660. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
661. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
662. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
663. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
664. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
665. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
666. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
667. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
668. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
669. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
670. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
671. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
672. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
673. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
674. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
675. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
676. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
677. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
678. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
679. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
680. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
681. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
682. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
683. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
684. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
685. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
686. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
687. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
688. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
689. gbinv1.seq - Invertebrate sequence entries, part 1.
690. gbinv2.seq - Invertebrate sequence entries, part 2.
691. gbinv3.seq - Invertebrate sequence entries, part 3.
692. gbinv4.seq - Invertebrate sequence entries, part 4.
693. gbinv5.seq - Invertebrate sequence entries, part 5.
694. gbinv6.seq - Invertebrate sequence entries, part 6.
695. gbinv7.seq - Invertebrate sequence entries, part 7.
696. gbjou.idx - Index of the entries according to journal citation.
697. gbmam1.seq - Other mammalian sequence entries, part 1.
698. gbmam2.seq - Other mammalian sequence entries, part 2.
699. gbnew.txt - Accession numbers of entries new since the previous release.
700. gbpat1.seq - Patent sequence entries, part 1.
701. gbpat10.seq - Patent sequence entries, part 10.
702. gbpat11.seq - Patent sequence entries, part 11.
703. gbpat12.seq - Patent sequence entries, part 12.
704. gbpat13.seq - Patent sequence entries, part 13.
705. gbpat14.seq - Patent sequence entries, part 14.
706. gbpat15.seq - Patent sequence entries, part 15.
707. gbpat16.seq - Patent sequence entries, part 16.
708. gbpat17.seq - Patent sequence entries, part 17.
709. gbpat18.seq - Patent sequence entries, part 18.
710. gbpat2.seq - Patent sequence entries, part 2.
711. gbpat3.seq - Patent sequence entries, part 3.
712. gbpat4.seq - Patent sequence entries, part 4.
713. gbpat5.seq - Patent sequence entries, part 5.
714. gbpat6.seq - Patent sequence entries, part 6.
715. gbpat7.seq - Patent sequence entries, part 7.
716. gbpat8.seq - Patent sequence entries, part 8.
717. gbpat9.seq - Patent sequence entries, part 9.
718. gbphg.seq - Phage sequence entries.
719. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
720. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
721. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
722. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
723. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
724. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
725. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
726. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
727. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
728. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
729. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
730. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
731. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
732. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
733. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
734. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
735. gbpri1.seq - Primate sequence entries, part 1.
736. gbpri10.seq - Primate sequence entries, part 10.
737. gbpri11.seq - Primate sequence entries, part 11.
738. gbpri12.seq - Primate sequence entries, part 12.
739. gbpri13.seq - Primate sequence entries, part 13.
740. gbpri14.seq - Primate sequence entries, part 14.
741. gbpri15.seq - Primate sequence entries, part 15.
742. gbpri16.seq - Primate sequence entries, part 16.
743. gbpri17.seq - Primate sequence entries, part 17.
744. gbpri18.seq - Primate sequence entries, part 18.
745. gbpri19.seq - Primate sequence entries, part 19.
746. gbpri2.seq - Primate sequence entries, part 2.
747. gbpri20.seq - Primate sequence entries, part 20.
748. gbpri21.seq - Primate sequence entries, part 21.
749. gbpri22.seq - Primate sequence entries, part 22.
750. gbpri23.seq - Primate sequence entries, part 23.
751. gbpri24.seq - Primate sequence entries, part 24.
752. gbpri25.seq - Primate sequence entries, part 25.
753. gbpri26.seq - Primate sequence entries, part 26.
754. gbpri27.seq - Primate sequence entries, part 27.
755. gbpri28.seq - Primate sequence entries, part 28.
756. gbpri29.seq - Primate sequence entries, part 29.
757. gbpri3.seq - Primate sequence entries, part 3.
758. gbpri4.seq - Primate sequence entries, part 4.
759. gbpri5.seq - Primate sequence entries, part 5.
760. gbpri6.seq - Primate sequence entries, part 6.
761. gbpri7.seq - Primate sequence entries, part 7.
762. gbpri8.seq - Primate sequence entries, part 8.
763. gbpri9.seq - Primate sequence entries, part 9.
764. gbrel.txt - Release notes (this document).
765. gbrod1.seq - Rodent sequence entries, part 1.
766. gbrod10.seq - Rodent sequence entries, part 10.
767. gbrod11.seq - Rodent sequence entries, part 11.
768. gbrod12.seq - Rodent sequence entries, part 12.
769. gbrod13.seq - Rodent sequence entries, part 13.
770. gbrod14.seq - Rodent sequence entries, part 14.
771. gbrod15.seq - Rodent sequence entries, part 15.
772. gbrod16.seq - Rodent sequence entries, part 16.
773. gbrod17.seq - Rodent sequence entries, part 17.
774. gbrod18.seq - Rodent sequence entries, part 18.
775. gbrod19.seq - Rodent sequence entries, part 19.
776. gbrod2.seq - Rodent sequence entries, part 2.
777. gbrod20.seq - Rodent sequence entries, part 20.
778. gbrod3.seq - Rodent sequence entries, part 3.
779. gbrod4.seq - Rodent sequence entries, part 4.
780. gbrod5.seq - Rodent sequence entries, part 5.
781. gbrod6.seq - Rodent sequence entries, part 6.
782. gbrod7.seq - Rodent sequence entries, part 7.
783. gbrod8.seq - Rodent sequence entries, part 8.
784. gbrod9.seq - Rodent sequence entries, part 9.
785. gbsdr.txt - Short directory of the data bank.
786. gbsec.idx - Index of the entries according to secondary accession number.
787. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
788. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
789. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
790. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
791. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
792. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
793. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
794. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
795. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
796. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
797. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
798. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
799. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
800. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
801. gbsyn.seq - Synthetic and chimeric sequence entries.
802. gbuna.seq - Unannotated sequence entries.
803. gbvrl1.seq - Viral sequence entries, part 1.
804. gbvrl2.seq - Viral sequence entries, part 2.
805. gbvrl3.seq - Viral sequence entries, part 3.
806. gbvrl4.seq - Viral sequence entries, part 4.
807. gbvrl5.seq - Viral sequence entries, part 5.
808. gbvrt1.seq - Other vertebrate sequence entries, part 1.
809. gbvrt2.seq - Other vertebrate sequence entries, part 2.
810. gbvrt3.seq - Other vertebrate sequence entries, part 3.
811. gbvrt4.seq - Other vertebrate sequence entries, part 4.
812. gbvrt5.seq - Other vertebrate sequence entries, part 5.
813. gbvrt6.seq - Other vertebrate sequence entries, part 6.
814. gbvrt7.seq - Other vertebrate sequence entries, part 7.
815. gbvrt8.seq - Other vertebrate sequence entries, part 8.
816. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 149.0 flatfiles require roughly 179 GB (sequence
files only) or 195 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1447983457 gbacc.idx
500613038 gbaut1.idx
512854608 gbaut10.idx
512814334 gbaut11.idx
500643770 gbaut12.idx
500023244 gbaut13.idx
502522192 gbaut14.idx
500371670 gbaut15.idx
501686283 gbaut16.idx
504030549 gbaut17.idx
540236765 gbaut18.idx
503209163 gbaut19.idx
509020875 gbaut2.idx
511749291 gbaut20.idx
503033675 gbaut21.idx
502990526 gbaut22.idx
519443346 gbaut23.idx
501292529 gbaut24.idx
502375153 gbaut25.idx
503181942 gbaut26.idx
500575922 gbaut27.idx
500708255 gbaut28.idx
514131475 gbaut29.idx
501506608 gbaut3.idx
501241517 gbaut30.idx
128949038 gbaut31.idx
500897443 gbaut4.idx
505416878 gbaut5.idx
517402667 gbaut6.idx
506948872 gbaut7.idx
500143531 gbaut8.idx
501445577 gbaut9.idx
250904878 gbbct1.seq
250003322 gbbct10.seq
199646399 gbbct11.seq
250200479 gbbct2.seq
250166514 gbbct3.seq
250000501 gbbct4.seq
252863805 gbbct5.seq
250000698 gbbct6.seq
250430152 gbbct7.seq
262535345 gbbct8.seq
258107798 gbbct9.seq
7313576 gbchg.txt
837534463 gbcon.seq
175139 gbdel.txt
250000698 gbenv1.seq
208465584 gbenv2.seq
230688425 gbest1.seq
230687597 gbest10.seq
230689431 gbest100.seq
230690088 gbest101.seq
230690607 gbest102.seq
230688508 gbest103.seq
230688706 gbest104.seq
230691285 gbest105.seq
230689341 gbest106.seq
230687853 gbest107.seq
230689166 gbest108.seq
230690242 gbest109.seq
230687816 gbest11.seq
230689405 gbest110.seq
230038277 gbest111.seq
230688011 gbest112.seq
230689781 gbest113.seq
230687553 gbest114.seq
230688637 gbest115.seq
230689180 gbest116.seq
230690357 gbest117.seq
230688459 gbest118.seq
230690404 gbest119.seq
230687685 gbest12.seq
230690980 gbest120.seq
230689361 gbest121.seq
230688118 gbest122.seq
230690592 gbest123.seq
230688807 gbest124.seq
230688699 gbest125.seq
229578878 gbest126.seq
230688031 gbest127.seq
230688176 gbest128.seq
230690909 gbest129.seq
230688069 gbest13.seq
230688698 gbest130.seq
230687841 gbest131.seq
230687460 gbest132.seq
230690356 gbest133.seq
230690185 gbest134.seq
230691130 gbest135.seq
230687926 gbest136.seq
230688100 gbest137.seq
230688622 gbest138.seq
230687858 gbest139.seq
230689004 gbest14.seq
230689410 gbest140.seq
230688972 gbest141.seq
230689580 gbest142.seq
230689035 gbest143.seq
230688346 gbest144.seq
230689115 gbest145.seq
230689479 gbest146.seq
230689744 gbest147.seq
230688095 gbest148.seq
230689412 gbest149.seq
230688790 gbest15.seq
230689427 gbest150.seq
230687731 gbest151.seq
230687873 gbest152.seq
230688866 gbest153.seq
230688285 gbest154.seq
230688017 gbest155.seq
230688436 gbest156.seq
230689555 gbest157.seq
230690116 gbest158.seq
230687867 gbest159.seq
230690286 gbest16.seq
230687688 gbest160.seq
230687522 gbest161.seq
230689477 gbest162.seq
230687633 gbest163.seq
230690466 gbest164.seq
230687827 gbest165.seq
230689151 gbest166.seq
230689188 gbest167.seq
230688217 gbest168.seq
230687871 gbest169.seq
230689264 gbest17.seq
230689583 gbest170.seq
230688299 gbest171.seq
230688881 gbest172.seq
230689569 gbest173.seq
230688576 gbest174.seq
230688967 gbest175.seq
230687593 gbest176.seq
230688761 gbest177.seq
230688865 gbest178.seq
227848744 gbest179.seq
230690149 gbest18.seq
230690343 gbest180.seq
230689884 gbest181.seq
230688141 gbest182.seq
230687883 gbest183.seq
230689263 gbest184.seq
230688335 gbest185.seq
230690076 gbest186.seq
230688654 gbest187.seq
230688088 gbest188.seq
230690167 gbest189.seq
230689659 gbest19.seq
230688179 gbest190.seq
230689860 gbest191.seq
230688331 gbest192.seq
230688431 gbest193.seq
230690542 gbest194.seq
230690361 gbest195.seq
230689948 gbest196.seq
230689443 gbest197.seq
230689673 gbest198.seq
230687740 gbest199.seq
230689482 gbest2.seq
230689537 gbest20.seq
230687600 gbest200.seq
230688032 gbest201.seq
230687539 gbest202.seq
230689504 gbest203.seq
230687641 gbest204.seq
230688464 gbest205.seq
230688250 gbest206.seq
230687962 gbest207.seq
230689626 gbest208.seq
230687506 gbest209.seq
230689303 gbest21.seq
230688191 gbest210.seq
230689703 gbest211.seq
230689751 gbest212.seq
230690508 gbest213.seq
230689714 gbest214.seq
230689197 gbest215.seq
230690172 gbest216.seq
230688792 gbest217.seq
230688894 gbest218.seq
225709343 gbest219.seq
230688100 gbest22.seq
163048051 gbest220.seq
162117314 gbest221.seq
168883587 gbest222.seq
168115990 gbest223.seq
167914583 gbest224.seq
165340119 gbest225.seq
164904270 gbest226.seq
164506162 gbest227.seq
164344405 gbest228.seq
164313641 gbest229.seq
230690317 gbest23.seq
164442025 gbest230.seq
163438216 gbest231.seq
167035062 gbest232.seq
164200632 gbest233.seq
162064704 gbest234.seq
164941687 gbest235.seq
168693038 gbest236.seq
166759995 gbest237.seq
165586124 gbest238.seq
165878491 gbest239.seq
230689028 gbest24.seq
165187409 gbest240.seq
164736380 gbest241.seq
164239725 gbest242.seq
164516702 gbest243.seq
165189851 gbest244.seq
173115083 gbest245.seq
177059916 gbest246.seq
172875640 gbest247.seq
230422257 gbest248.seq
230689563 gbest249.seq
230689106 gbest25.seq
230689477 gbest250.seq
230690167 gbest251.seq
230690230 gbest252.seq
230689421 gbest253.seq
230691486 gbest254.seq
230689851 gbest255.seq
230690356 gbest256.seq
230689150 gbest257.seq
230688627 gbest258.seq
230690206 gbest259.seq
230689379 gbest26.seq
230687600 gbest260.seq
230688263 gbest261.seq
230689293 gbest262.seq
230688933 gbest263.seq
230688693 gbest264.seq
230688927 gbest265.seq
230689864 gbest266.seq
230690447 gbest267.seq
230687805 gbest268.seq
230689774 gbest269.seq
230688361 gbest27.seq
230690015 gbest270.seq
230689754 gbest271.seq
230687807 gbest272.seq
230688397 gbest273.seq
230689701 gbest274.seq
230691142 gbest275.seq
230689578 gbest276.seq
213043079 gbest277.seq
230689419 gbest278.seq
230688018 gbest279.seq
230689525 gbest28.seq
230687860 gbest280.seq
230689012 gbest281.seq
230688451 gbest282.seq
230690433 gbest283.seq
230689145 gbest284.seq
230690339 gbest285.seq
230689141 gbest286.seq
230689019 gbest287.seq
230688837 gbest288.seq
230687752 gbest289.seq
230688677 gbest29.seq
230689813 gbest290.seq
230689916 gbest291.seq
230688295 gbest292.seq
230688440 gbest293.seq
230687531 gbest294.seq
230687481 gbest295.seq
230693073 gbest296.seq
230689800 gbest297.seq
230689399 gbest298.seq
230690426 gbest299.seq
230687569 gbest3.seq
230690414 gbest30.seq
230689857 gbest300.seq
230688982 gbest301.seq
230689744 gbest302.seq
230688674 gbest303.seq
212985883 gbest304.seq
230690276 gbest305.seq
230691988 gbest306.seq
230689945 gbest307.seq
230689291 gbest308.seq
230688343 gbest309.seq
230687782 gbest31.seq
230690498 gbest310.seq
153058802 gbest311.seq
167292541 gbest312.seq
230688152 gbest313.seq
230689854 gbest314.seq
230690198 gbest315.seq
230688257 gbest316.seq
230690606 gbest317.seq
230690356 gbest318.seq
230690910 gbest319.seq
230690273 gbest32.seq
230688776 gbest320.seq
230690152 gbest321.seq
230688023 gbest322.seq
230688407 gbest323.seq
230689647 gbest324.seq
230690516 gbest325.seq
230688626 gbest326.seq
230690135 gbest327.seq
230689600 gbest328.seq
230690003 gbest329.seq
230688642 gbest33.seq
230687752 gbest330.seq
230688623 gbest331.seq
230688592 gbest332.seq
230687627 gbest333.seq
230688563 gbest334.seq
230690110 gbest335.seq
230689613 gbest336.seq
230689156 gbest337.seq
230691729 gbest338.seq
230687491 gbest339.seq
230688067 gbest34.seq
230687521 gbest340.seq
230688330 gbest341.seq
230689156 gbest342.seq
230688630 gbest343.seq
230689621 gbest344.seq
230687499 gbest345.seq
230687970 gbest346.seq
230688007 gbest347.seq
230688481 gbest348.seq
230687615 gbest349.seq
230690075 gbest35.seq
230687871 gbest350.seq
230691451 gbest351.seq
230688333 gbest352.seq
230689282 gbest353.seq
230689713 gbest354.seq
223853357 gbest355.seq
230690103 gbest356.seq
230688533 gbest357.seq
230689814 gbest358.seq
230691209 gbest359.seq
230688742 gbest36.seq
230688790 gbest360.seq
230479386 gbest361.seq
230687466 gbest362.seq
230691939 gbest363.seq
230689064 gbest364.seq
230687857 gbest365.seq
230688846 gbest366.seq
230688190 gbest367.seq
230690437 gbest368.seq
230690271 gbest369.seq
230688756 gbest37.seq
230689096 gbest370.seq
230693369 gbest371.seq
230689983 gbest372.seq
230688453 gbest373.seq
230689506 gbest374.seq
230687924 gbest375.seq
230689036 gbest376.seq
230691685 gbest377.seq
230691163 gbest378.seq
230689935 gbest379.seq
230688606 gbest38.seq
230689750 gbest380.seq
230687599 gbest381.seq
230687984 gbest382.seq
230688546 gbest383.seq
230688181 gbest384.seq
230689504 gbest385.seq
230691744 gbest386.seq
230689401 gbest387.seq
230689236 gbest388.seq
230694065 gbest389.seq
224237215 gbest39.seq
230689345 gbest390.seq
230688744 gbest391.seq
230691756 gbest392.seq
230687822 gbest393.seq
230691168 gbest394.seq
230690607 gbest395.seq
230690223 gbest396.seq
230688406 gbest397.seq
230689537 gbest398.seq
230689679 gbest399.seq
230687828 gbest4.seq
192376921 gbest40.seq
230689688 gbest400.seq
230690286 gbest401.seq
230689343 gbest402.seq
230688927 gbest403.seq
230688328 gbest404.seq
230690623 gbest405.seq
230690720 gbest406.seq
230688570 gbest407.seq
230689512 gbest408.seq
230688730 gbest409.seq
191780848 gbest41.seq
230689595 gbest410.seq
217255265 gbest411.seq
230689613 gbest412.seq
165099141 gbest413.seq
214826010 gbest42.seq
216207178 gbest43.seq
215842026 gbest44.seq
216969187 gbest45.seq
230688216 gbest46.seq
230688030 gbest47.seq
226202383 gbest48.seq
230689055 gbest49.seq
164950269 gbest5.seq
230687756 gbest50.seq
230688728 gbest51.seq
230689672 gbest52.seq
230688253 gbest53.seq
230691005 gbest54.seq
230687969 gbest55.seq
230688333 gbest56.seq
230690776 gbest57.seq
230690553 gbest58.seq
230688372 gbest59.seq
177138923 gbest6.seq
230689460 gbest60.seq
230690188 gbest61.seq
230691214 gbest62.seq
230688880 gbest63.seq
230689138 gbest64.seq
209877969 gbest65.seq
209438885 gbest66.seq
208755262 gbest67.seq
209111908 gbest68.seq
209544758 gbest69.seq
230689868 gbest7.seq
210716530 gbest70.seq
209572983 gbest71.seq
208452746 gbest72.seq
210239815 gbest73.seq
209303316 gbest74.seq
205126453 gbest75.seq
208215758 gbest76.seq
207426498 gbest77.seq
210022451 gbest78.seq
222451254 gbest79.seq
230690240 gbest8.seq
230690513 gbest80.seq
230692454 gbest81.seq
224145001 gbest82.seq
215852406 gbest83.seq
213771000 gbest84.seq
227292664 gbest85.seq
230688823 gbest86.seq
230690359 gbest87.seq
230688275 gbest88.seq
230688026 gbest89.seq
230689340 gbest9.seq
230687766 gbest90.seq
230690136 gbest91.seq
230687990 gbest92.seq
230689512 gbest93.seq
230689142 gbest94.seq
230687888 gbest95.seq
230690179 gbest96.seq
230690708 gbest97.seq
230689653 gbest98.seq
230689496 gbest99.seq
48222731 gbgen.idx
230689539 gbgss1.seq
230687499 gbgss10.seq
227152373 gbgss100.seq
228508251 gbgss101.seq
228733056 gbgss102.seq
228616567 gbgss103.seq
227899677 gbgss104.seq
227421937 gbgss105.seq
230688530 gbgss106.seq
230688097 gbgss107.seq
230688308 gbgss108.seq
230690167 gbgss109.seq
230691316 gbgss11.seq
230688976 gbgss110.seq
230687567 gbgss111.seq
230689704 gbgss112.seq
230688743 gbgss113.seq
230687767 gbgss114.seq
230688844 gbgss115.seq
230689836 gbgss116.seq
230688014 gbgss117.seq
230688965 gbgss118.seq
230687876 gbgss119.seq
230688172 gbgss12.seq
230688703 gbgss120.seq
230688308 gbgss121.seq
230688898 gbgss122.seq
230688365 gbgss123.seq
113228653 gbgss124.seq
250001108 gbgss125.seq
250000539 gbgss126.seq
250002531 gbgss127.seq
250001647 gbgss128.seq
250003748 gbgss129.seq
230688583 gbgss13.seq
250001626 gbgss130.seq
250000398 gbgss131.seq
250000981 gbgss132.seq
250000560 gbgss133.seq
250000466 gbgss134.seq
250001745 gbgss135.seq
250000977 gbgss136.seq
250001470 gbgss137.seq
250002479 gbgss138.seq
250003175 gbgss139.seq
230689806 gbgss14.seq
250001657 gbgss140.seq
250004137 gbgss141.seq
250000539 gbgss142.seq
250000004 gbgss143.seq
250000816 gbgss144.seq
250002150 gbgss145.seq
250000950 gbgss146.seq
250000365 gbgss147.seq
250001441 gbgss148.seq
250000359 gbgss149.seq
230687747 gbgss15.seq
250002344 gbgss150.seq
93172196 gbgss151.seq
230688886 gbgss16.seq
230689013 gbgss17.seq
230690153 gbgss18.seq
230687966 gbgss19.seq
230689883 gbgss2.seq
230689352 gbgss20.seq
230688687 gbgss21.seq
230689885 gbgss22.seq
230689578 gbgss23.seq
230688192 gbgss24.seq
230689705 gbgss25.seq
230689250 gbgss26.seq
230687894 gbgss27.seq
230690186 gbgss28.seq
230689619 gbgss29.seq
230688931 gbgss3.seq
230687910 gbgss30.seq
230689592 gbgss31.seq
230689547 gbgss32.seq
230689976 gbgss33.seq
230689284 gbgss34.seq
230688552 gbgss35.seq
230689696 gbgss36.seq
230689247 gbgss37.seq
230688531 gbgss38.seq
230687465 gbgss39.seq
230689635 gbgss4.seq
230688188 gbgss40.seq
230687849 gbgss41.seq
230689966 gbgss42.seq
230688523 gbgss43.seq
230688935 gbgss44.seq
230690360 gbgss45.seq
230689807 gbgss46.seq
230690232 gbgss47.seq
230688899 gbgss48.seq
230690507 gbgss49.seq
230689060 gbgss5.seq
230688252 gbgss50.seq
230687651 gbgss51.seq
230690526 gbgss52.seq
230689363 gbgss53.seq
230689525 gbgss54.seq
230689516 gbgss55.seq
230688846 gbgss56.seq
230687892 gbgss57.seq
230690101 gbgss58.seq
230689534 gbgss59.seq
230690103 gbgss6.seq
230690641 gbgss60.seq
229393941 gbgss61.seq
230688508 gbgss62.seq
230687757 gbgss63.seq
230687737 gbgss64.seq
230689108 gbgss65.seq
230687463 gbgss66.seq
230688698 gbgss67.seq
230689392 gbgss68.seq
230688119 gbgss69.seq
230688253 gbgss7.seq
230689096 gbgss70.seq
230688451 gbgss71.seq
230689398 gbgss72.seq
230688133 gbgss73.seq
230687770 gbgss74.seq
230687476 gbgss75.seq
230687704 gbgss76.seq
230689609 gbgss77.seq
230689327 gbgss78.seq
230689218 gbgss79.seq
230688823 gbgss8.seq
230688320 gbgss80.seq
197964465 gbgss81.seq
194762549 gbgss82.seq
221685584 gbgss83.seq
230688320 gbgss84.seq
230689904 gbgss85.seq
230687591 gbgss86.seq
230689970 gbgss87.seq
230688660 gbgss88.seq
230689589 gbgss89.seq
230690336 gbgss9.seq
230689791 gbgss90.seq
230689802 gbgss91.seq
230687510 gbgss92.seq
230688176 gbgss93.seq
230687595 gbgss94.seq
230687975 gbgss95.seq
230689668 gbgss96.seq
230688138 gbgss97.seq
230688229 gbgss98.seq
230689837 gbgss99.seq
250005376 gbhtc1.seq
250000866 gbhtc2.seq
250003853 gbhtc3.seq
250002695 gbhtc4.seq
250003329 gbhtc5.seq
250001858 gbhtc6.seq
133348561 gbhtc7.seq
250063914 gbhtg1.seq
250019536 gbhtg10.seq
250024110 gbhtg11.seq
250012719 gbhtg12.seq
250041897 gbhtg13.seq
250299934 gbhtg14.seq
250314905 gbhtg15.seq
250267778 gbhtg16.seq
250045541 gbhtg17.seq
250138830 gbhtg18.seq
250002541 gbhtg19.seq
250005030 gbhtg2.seq
250016110 gbhtg20.seq
250273887 gbhtg21.seq
250283293 gbhtg22.seq
250086593 gbhtg23.seq
250041270 gbhtg24.seq
250096183 gbhtg25.seq
250148018 gbhtg26.seq
250186228 gbhtg27.seq
250168277 gbhtg28.seq
250158229 gbhtg29.seq
250071408 gbhtg3.seq
250014134 gbhtg30.seq
250312562 gbhtg31.seq
250080558 gbhtg32.seq
250151230 gbhtg33.seq
250036885 gbhtg34.seq
250223822 gbhtg35.seq
250241528 gbhtg36.seq
250156045 gbhtg37.seq
250096076 gbhtg38.seq
250201712 gbhtg39.seq
250077931 gbhtg4.seq
250141386 gbhtg40.seq
250056907 gbhtg41.seq
250021086 gbhtg42.seq
250102786 gbhtg43.seq
250352212 gbhtg44.seq
250216325 gbhtg45.seq
250035703 gbhtg46.seq
250156340 gbhtg47.seq
250143222 gbhtg48.seq
250050358 gbhtg49.seq
250084487 gbhtg5.seq
250003229 gbhtg50.seq
250617941 gbhtg51.seq
250125926 gbhtg52.seq
250052516 gbhtg53.seq
250231599 gbhtg54.seq
250163142 gbhtg55.seq
250022983 gbhtg56.seq
250105117 gbhtg57.seq
250292331 gbhtg58.seq
250083887 gbhtg59.seq
250211487 gbhtg6.seq
250056908 gbhtg60.seq
250043757 gbhtg61.seq
250006494 gbhtg62.seq
250391528 gbhtg63.seq
250260684 gbhtg64.seq
250141488 gbhtg65.seq
250022760 gbhtg66.seq
250084325 gbhtg67.seq
118259505 gbhtg68.seq
250150851 gbhtg7.seq
250119872 gbhtg8.seq
250038777 gbhtg9.seq
250048074 gbinv1.seq
250313705 gbinv2.seq
250007633 gbinv3.seq
250005261 gbinv4.seq
250018063 gbinv5.seq
250228201 gbinv6.seq
244683053 gbinv7.seq
1206882022 gbjou.idx
250000575 gbmam1.seq
94040508 gbmam2.seq
27343273 gbnew.txt
250000603 gbpat1.seq
250002509 gbpat10.seq
250001599 gbpat11.seq
250000866 gbpat12.seq
250000791 gbpat13.seq
250003365 gbpat14.seq
250001184 gbpat15.seq
250001623 gbpat16.seq
250000785 gbpat17.seq
133968349 gbpat18.seq
250000020 gbpat2.seq
250000343 gbpat3.seq
250010087 gbpat4.seq
250000523 gbpat5.seq
250000863 gbpat6.seq
250000787 gbpat7.seq
250005046 gbpat8.seq
250001321 gbpat9.seq
40991080 gbphg.seq
250127424 gbpln1.seq
250001065 gbpln10.seq
250004402 gbpln11.seq
250000216 gbpln12.seq
250002252 gbpln13.seq
250011138 gbpln14.seq
250000421 gbpln15.seq
203552675 gbpln16.seq
250058361 gbpln2.seq
250000536 gbpln3.seq
250001904 gbpln4.seq
250003459 gbpln5.seq
250037141 gbpln6.seq
250095747 gbpln7.seq
258565371 gbpln8.seq
250570165 gbpln9.seq
250082933 gbpri1.seq
250272893 gbpri10.seq
250244127 gbpri11.seq
250023879 gbpri12.seq
250086229 gbpri13.seq
250064540 gbpri14.seq
250103447 gbpri15.seq
250004989 gbpri16.seq
250062970 gbpri17.seq
250145477 gbpri18.seq
250149724 gbpri19.seq
250127198 gbpri2.seq
250098641 gbpri20.seq
250119728 gbpri21.seq
250027726 gbpri22.seq
250000893 gbpri23.seq
250151467 gbpri24.seq
250001206 gbpri25.seq
250005684 gbpri26.seq
250084717 gbpri27.seq
250000242 gbpri28.seq
40439311 gbpri29.seq
250043993 gbpri3.seq
250012952 gbpri4.seq
250151866 gbpri5.seq
250200111 gbpri6.seq
250062749 gbpri7.seq
250086546 gbpri8.seq
250167634 gbpri9.seq
196340 gbrel.txt
250021812 gbrod1.seq
250011379 gbrod10.seq
250062136 gbrod11.seq
250106566 gbrod12.seq
250164476 gbrod13.seq
250047578 gbrod14.seq
250105598 gbrod15.seq
250090172 gbrod16.seq
250001064 gbrod17.seq
250000803 gbrod18.seq
250066893 gbrod19.seq
250209318 gbrod2.seq
119688237 gbrod20.seq
250155610 gbrod3.seq
250164443 gbrod4.seq
250009999 gbrod5.seq
250186151 gbrod6.seq
250134519 gbrod7.seq
250083875 gbrod8.seq
250252884 gbrod9.seq
3755841797 gbsdr.txt
1563739 gbsec.idx
250002224 gbsts1.seq
250000488 gbsts10.seq
250004141 gbsts11.seq
250002207 gbsts12.seq
250001763 gbsts13.seq
14123992 gbsts14.seq
250000838 gbsts2.seq
250000517 gbsts3.seq
250000048 gbsts4.seq
250001168 gbsts5.seq
250000738 gbsts6.seq
250002573 gbsts7.seq
250001086 gbsts8.seq
250002868 gbsts9.seq
102451677 gbsyn.seq
416265 gbuna.seq
250002795 gbvrl1.seq
250001686 gbvrl2.seq
250000995 gbvrl3.seq
250002744 gbvrl4.seq
60232698 gbvrl5.seq
250000875 gbvrt1.seq
250237833 gbvrt2.seq
250000215 gbvrt3.seq
250053723 gbvrt4.seq
250024974 gbvrt5.seq
250144183 gbvrt6.seq
250000802 gbvrt7.seq
250043627 gbvrt8.seq
194018932 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 24178 102385489
BCT10 24732 99733479
BCT11 25846 72882800
BCT2 7477 107448276
BCT3 297 114527223
BCT4 28078 103290660
BCT5 29125 98262105
BCT6 64424 85233641
BCT7 6321 114735921
BCT8 664 98640047
BCT9 2194 115416062
ENV1 96941 71366664
ENV2 77937 66628936
EST1 68034 26258363
EST10 76493 29723216
EST100 73824 44049389
EST101 71798 43057367
EST102 70073 44735908
EST103 74383 36698498
EST104 69852 31133723
EST105 65196 31111523
EST106 66871 40104586
EST107 70422 36527708
EST108 69801 45534787
EST109 75910 34468867
EST11 74698 28608637
EST110 74488 27738339
EST111 75675 25952974
EST112 73420 40107286
EST113 63837 31083361
EST114 78570 47302196
EST115 79182 44966931
EST116 72496 45237784
EST117 68421 43364912
EST118 73106 47053943
EST119 67665 44923009
EST12 77211 30612340
EST120 73830 43811396
EST121 75342 44907957
EST122 73000 48061879
EST123 75391 48431121
EST124 72962 46772737
EST125 78255 37666394
EST126 78089 26440409
EST127 80296 48717674
EST128 74799 43674319
EST129 66653 37413205
EST13 76235 29134866
EST130 70869 35181357
EST131 67170 37819020
EST132 66640 36214297
EST133 69543 42578969
EST134 72971 41824812
EST135 68583 43021823
EST136 69196 41625596
EST137 73928 42504761
EST138 68500 41647351
EST139 58516 33402747
EST14 77983 31413784
EST140 96311 52226110
EST141 88941 51170012
EST142 78986 40667090
EST143 107359 58031849
EST144 108294 57938594
EST145 98546 54331141
EST146 73480 45116763
EST147 94382 55478877
EST148 99608 59590670
EST149 90515 51954405
EST15 74272 31341755
EST150 72154 43593260
EST151 68336 33788088
EST152 64120 29275779
EST153 54776 24940338
EST154 64461 31275788
EST155 61640 31276270
EST156 66627 35767588
EST157 72583 51625277
EST158 64936 44365065
EST159 82703 48868456
EST16 75803 33403926
EST160 58287 29715231
EST161 62402 31767812
EST162 67093 40383354
EST163 65263 37445491
EST164 63096 42549470
EST165 88313 44511613
EST166 91978 45616284
EST167 96762 57348837
EST168 102616 59531905
EST169 95617 53123833
EST17 80848 33051568
EST170 94510 40936127
EST171 92439 45441241
EST172 93315 43575347
EST173 90270 37114505
EST174 85641 41299562
EST175 65195 44632407
EST176 70698 38417501
EST177 57987 37457677
EST178 70100 38595514
EST179 73980 26349464
EST18 81510 32879782
EST180 74071 47067228
EST181 76814 38733829
EST182 66987 33263412
EST183 69106 40880062
EST184 69450 54419961
EST185 67604 36830218
EST186 68895 34681246
EST187 70102 57138611
EST188 67883 41914996
EST189 72328 36311227
EST19 78262 31520557
EST190 69757 52026485
EST191 69604 55699263
EST192 64621 47731024
EST193 64481 47103364
EST194 65110 47645777
EST195 64926 45573255
EST196 64145 48298596
EST197 64501 41127279
EST198 63717 34665249
EST199 63415 36681500
EST2 74718 28667916
EST20 74204 30887609
EST200 76928 41948302
EST201 88270 54794572
EST202 69369 44549117
EST203 97606 59861190
EST204 107335 66515004
EST205 109001 64122456
EST206 106255 65470202
EST207 103390 66486829
EST208 110756 50996925
EST209 90969 54906334
EST21 74911 34225358
EST210 109888 49020731
EST211 91917 52711377
EST212 67881 37173118
EST213 69906 52415454
EST214 68675 58767931
EST215 76132 48360786
EST216 80986 40180554
EST217 76420 51905039
EST218 71480 50881710
EST219 62411 36740306
EST22 73177 29510851
EST220 27793 10457982
EST221 27863 10451790
EST222 26737 9811173
EST223 26892 9455364
EST224 26972 9223617
EST225 27225 10198511
EST226 27181 9688414
EST227 27227 10157218
EST228 27213 11539959
EST229 27189 11441373
EST23 77453 32919525
EST230 27236 10552452
EST231 27538 9538875
EST232 26999 8860128
EST233 27550 11198465
EST234 27880 10750305
EST235 27440 11063389
EST236 26629 11740960
EST237 26869 11778906
EST238 27118 10575470
EST239 26961 11486940
EST24 74075 31991301
EST240 27097 11758417
EST241 27239 11301811
EST242 27270 10779993
EST243 27236 10765352
EST244 27172 10545170
EST245 25749 15488933
EST246 25051 16641646
EST247 28671 18091177
EST248 101145 34542629
EST249 80668 41232413
EST25 75075 32928853
EST250 68808 44316226
EST251 69183 44957002
EST252 69099 44312476
EST253 64471 40028417
EST254 80494 44600995
EST255 62166 43168916
EST256 68625 42422626
EST257 61613 30941824
EST258 102723 48009091
EST259 84086 44535073
EST26 73678 29979037
EST260 72188 38281534
EST261 65216 31383595
EST262 67197 40330310
EST263 72141 34903678
EST264 71003 33500930
EST265 75171 46187587
EST266 64172 36067021
EST267 67876 39318249
EST268 76779 37711417
EST269 82139 45491356
EST27 75034 32413096
EST270 73970 49243351
EST271 78099 53679016
EST272 101033 49725627
EST273 93634 45156776
EST274 76909 43836067
EST275 70342 46344210
EST276 75648 33520853
EST277 69912 30485034
EST278 72177 37621364
EST279 64245 37628657
EST28 106370 50117310
EST280 60125 38717914
EST281 73655 43147910
EST282 62448 43290519
EST283 61400 33791025
EST284 84476 44106316
EST285 83632 40778711
EST286 71967 46503943
EST287 104006 58580132
EST288 121550 47797797
EST289 83266 38744849
EST29 97903 45867154
EST290 65894 35397962
EST291 71631 45887358
EST292 80879 41111842
EST293 71229 42051174
EST294 70563 40686705
EST295 63114 35348347
EST296 61305 37305320
EST297 54171 30868846
EST298 72005 51794159
EST299 73676 43971191
EST3 73590 29860872
EST30 99107 53271438
EST300 71149 41650632
EST301 69143 36211301
EST302 77724 48089524
EST303 94110 61600526
EST304 71144 40917019
EST305 77967 43665829
EST306 64156 55609759
EST307 64244 46665835
EST308 65231 41968418
EST309 62038 35147744
EST31 75765 39042340
EST310 73114 50974876
EST311 49968 26991508
EST312 52959 26284652
EST313 71859 39120346
EST314 60343 32458681
EST315 62212 31548596
EST316 64864 41760286
EST317 85764 43581198
EST318 71791 42391644
EST319 67949 43629244
EST32 66727 61911354
EST320 66252 37697379
EST321 67696 44255276
EST322 88762 49992996
EST323 84867 50644508
EST324 75469 41681079
EST325 63213 36591335
EST326 67843 34930725
EST327 69311 38636066
EST328 47238 24161605
EST329 68791 39800853
EST33 80323 48570533
EST330 74554 42465092
EST331 98572 46385232
EST332 72653 50118178
EST333 74589 47944011
EST334 70738 43650584
EST335 61204 34114280
EST336 88433 38243011
EST337 68433 40720794
EST338 51682 36585688
EST339 63159 37139945
EST34 91639 44852446
EST340 68989 44731836
EST341 100942 55384274
EST342 72388 37226232
EST343 80438 44419304
EST344 61013 37843415
EST345 42469 22577388
EST346 57000 34279942
EST347 85207 46155861
EST348 77522 46219157
EST349 72637 44964250
EST35 85023 46131514
EST350 72941 39319921
EST351 61362 39810035
EST352 72996 40263199
EST353 57392 35339695
EST354 75958 31429946
EST355 80049 26432341
EST356 70047 41447550
EST357 66539 36989028
EST358 69924 38836351
EST359 81270 48917671
EST36 99045 51467534
EST360 63342 43601708
EST361 74188 43907342
EST362 60684 34253635
EST363 67564 41098021
EST364 79934 51321725
EST365 82790 48715038
EST366 69327 41343734
EST367 59416 42013020
EST368 57540 41432257
EST369 57330 41014166
EST37 97977 49109135
EST370 66849 40561438
EST371 68445 41342564
EST372 58969 37142827
EST373 58301 38889661
EST374 59277 40737662
EST375 60567 41736246
EST376 56043 42106401
EST377 46205 33080514
EST378 83310 38976556
EST379 52349 40858478
EST38 100289 48671542
EST380 67511 45522344
EST381 66275 37751607
EST382 69162 40531867
EST383 121392 60834961
EST384 74872 46669728
EST385 79278 57895929
EST386 39326 21790726
EST387 50800 55023208
EST388 46852 58191065
EST389 67291 46518190
EST39 92829 35930195
EST390 71712 42112449
EST391 69976 44346343
EST392 66817 43893566
EST393 66858 42853831
EST394 58801 49362214
EST395 60483 39730897
EST396 56137 40840614
EST397 55766 37974688
EST398 66450 47739547
EST399 67367 47534339
EST4 73953 28155396
EST40 68625 18213698
EST400 60772 44978818
EST401 52124 37716642
EST402 52693 38639486
EST403 59742 42606740
EST404 61134 36465591
EST405 68030 44290464
EST406 71100 30863255
EST407 69738 25503185
EST408 73127 27355610
EST409 73953 26008459
EST41 68571 18332216
EST410 77446 27363749
EST411 71114 24840435
EST412 70857 29369982
EST413 55018 20110904
EST42 63818 19559428
EST43 43335 11801739
EST44 43053 11912554
EST45 42854 11374871
EST46 74517 29590770
EST47 96513 44266651
EST48 92531 46180172
EST49 89529 42636250
EST5 48552 15462195
EST50 102012 51711431
EST51 101988 52118113
EST52 75825 32673831
EST53 66286 28740252
EST54 73246 32539213
EST55 70612 29761701
EST56 80145 32673221
EST57 75426 29674971
EST58 70847 28606339
EST59 64970 29785511
EST6 55001 17440741
EST60 73504 32964443
EST61 78668 35010515
EST62 73533 29364583
EST63 75184 25456996
EST64 87102 42165342
EST65 41338 11596994
EST66 40036 11015959
EST67 40050 12274199
EST68 40384 12475751
EST69 40447 12063051
EST7 74090 29152490
EST70 40341 13083220
EST71 40307 12594129
EST72 40316 12297306
EST73 39953 11871555
EST74 40661 12779122
EST75 41341 11642291
EST76 41024 13175949
EST77 40897 12680974
EST78 41474 13259494
EST79 45327 12970218
EST8 75313 30469369
EST80 39759 25208291
EST81 42040 21413185
EST82 46384 18746216
EST83 50008 22810516
EST84 51384 21339916
EST85 58216 23996625
EST86 75973 31735272
EST87 75430 28517845
EST88 72942 36011126
EST89 77071 44840196
EST9 77448 29829010
EST90 77267 42899903
EST91 76078 36758282
EST92 76024 43097547
EST93 72725 38088939
EST94 73141 29999448
EST95 74774 46931078
EST96 70192 30012833
EST97 77232 49090218
EST98 64797 35332837
EST99 71811 36873360
GSS1 90825 38838374
GSS10 75205 43833923
GSS100 75306 40823369
GSS101 73732 44781763
GSS102 73471 45439590
GSS103 73601 45109294
GSS104 73207 45084917
GSS105 73612 43942445
GSS106 79969 52598358
GSS107 85771 58476444
GSS108 81501 53730881
GSS109 84481 52656059
GSS11 69998 35693198
GSS110 84194 49571606
GSS111 81202 66229335
GSS112 88144 46327712
GSS113 92496 55610317
GSS114 74642 48789051
GSS115 87689 62378256
GSS116 82530 61393627
GSS117 78321 44275723
GSS118 86221 51035778
GSS119 92119 54251476
GSS12 73548 38676139
GSS120 85323 54951919
GSS121 84677 56154774
GSS122 77201 64532837
GSS123 76624 68996277
GSS124 38201 32283960
GSS125 87189 64730609
GSS126 83935 63019542
GSS127 101312 46889474
GSS128 68991 58743647
GSS129 68487 58900293
GSS13 76489 38776094
GSS130 69543 56768164
GSS131 69807 56256304
GSS132 70565 55587938
GSS133 86110 73189295
GSS134 85143 41078693
GSS135 70890 47208187
GSS136 110589 72587266
GSS137 85505 35974685
GSS138 90317 68090200
GSS139 72983 60685566
GSS14 71399 32053200
GSS140 70268 59091050
GSS141 66045 63246089
GSS142 76546 56958716
GSS143 120678 73151584
GSS144 118120 75833491
GSS145 104470 58807190
GSS146 87785 55611458
GSS147 93584 57308817
GSS148 84855 45789306
GSS149 89457 61585540
GSS15 70902 35386698
GSS150 107826 53936602
GSS151 36002 16069131
GSS16 77588 45718653
GSS17 70917 33380301
GSS18 58098 27809721
GSS19 56846 28928903
GSS2 89386 39537205
GSS20 57739 26520778
GSS21 61874 30956779
GSS22 64594 36359309
GSS23 57554 27013298
GSS24 67323 42717207
GSS25 67065 27611124
GSS26 58099 25563057
GSS27 66921 32502872
GSS28 63807 32259711
GSS29 79745 40297235
GSS3 87699 41940144
GSS30 81858 39884690
GSS31 74231 40338257
GSS32 70483 48496351
GSS33 80018 37638203
GSS34 75905 40292108
GSS35 74680 39228957
GSS36 87602 58164580
GSS37 87588 58187598
GSS38 85666 44866144
GSS39 85576 49293006
GSS4 79303 41207047
GSS40 87563 38537051
GSS41 82644 34586485
GSS42 81262 56910251
GSS43 79484 57507202
GSS44 72038 47481719
GSS45 72039 47425921
GSS46 77903 45328444
GSS47 78067 39654289
GSS48 83666 58381510
GSS49 86562 66336101
GSS5 79041 40731282
GSS50 82870 53037723
GSS51 93465 59769305
GSS52 88505 58833581
GSS53 75140 39946971
GSS54 74721 43056824
GSS55 86001 45533102
GSS56 88387 58835734
GSS57 76126 67457297
GSS58 72027 79237914
GSS59 88526 68371381
GSS6 78255 38895462
GSS60 86528 57613619
GSS61 63554 45301219
GSS62 69612 47963729
GSS63 89663 67257209
GSS64 86239 57970521
GSS65 87443 53960643
GSS66 87639 56716628
GSS67 97285 57999342
GSS68 100603 54541239
GSS69 100689 54430819
GSS7 77539 39418357
GSS70 101342 53604611
GSS71 102376 52291710
GSS72 102372 52297240
GSS73 102698 51883085
GSS74 102115 52621929
GSS75 98275 57526639
GSS76 90158 69774444
GSS77 89834 70780761
GSS78 88016 69598605
GSS79 87824 69678345
GSS8 76330 38105833
GSS80 88777 62604882
GSS81 80874 23716207
GSS82 77788 24527825
GSS83 88355 36460139
GSS84 84331 50966209
GSS85 80712 49105320
GSS86 89514 64699622
GSS87 78425 62241475
GSS88 78225 79463030
GSS89 76581 56011726
GSS9 72576 37287728
GSS90 94927 50984059
GSS91 75757 40496969
GSS92 85431 50782635
GSS93 70486 60652216
GSS94 85643 52902404
GSS95 82610 61003156
GSS96 87349 57520670
GSS97 83304 57006537
GSS98 89868 55793604
GSS99 80412 66365103
HTC1 32151 55611690
HTC2 31639 66256003
HTC3 75274 40529673
HTC4 78751 70885966
HTC5 65519 62777201
HTC6 67755 70959762
HTC7 29110 54604072
HTG1 1315 188873586
HTG10 1239 186540769
HTG11 1427 184142515
HTG12 880 191849995
HTG13 751 192251270
HTG14 741 192399127
HTG15 776 192381500
HTG16 803 192172812
HTG17 764 192209605
HTG18 2009 171976103
HTG19 1030 188145586
HTG2 2562 185987793
HTG20 1070 188102921
HTG21 778 192106674
HTG22 925 190500494
HTG23 880 190905963
HTG24 830 191140525
HTG25 772 192114442
HTG26 843 191432407
HTG27 851 191581690
HTG28 964 189868196
HTG29 919 190713006
HTG3 2450 185370355
HTG30 943 190424142
HTG31 867 191521230
HTG32 957 189832466
HTG33 898 190949533
HTG34 845 191596013
HTG35 833 191899949
HTG36 864 191353870
HTG37 929 190544493
HTG38 968 190396243
HTG39 932 190741139
HTG4 2527 188428356
HTG40 1115 188374887
HTG41 1112 188261954
HTG42 1380 186505114
HTG43 1139 188941560
HTG44 1131 188742320
HTG45 1144 191560408
HTG46 1275 190671410
HTG47 1181 191521698
HTG48 1167 191358793
HTG49 1075 191138880
HTG5 1281 185666662
HTG50 937 189485804
HTG51 997 190703476
HTG52 1026 189987121
HTG53 989 189943966
HTG54 1038 190573242
HTG55 945 190180674
HTG56 1021 190606797
HTG57 968 189447378
HTG58 956 189876028
HTG59 1267 188754233
HTG6 1274 185376276
HTG60 1715 185821991
HTG61 1184 192127291
HTG62 1172 190720629
HTG63 1487 189008132
HTG64 1040 194127227
HTG65 1030 194041439
HTG66 1039 193769647
HTG67 831 182248760
HTG68 472 83647771
HTG7 1247 185590985
HTG8 1288 185020375
HTG9 1183 187103109
INV1 16967 162393862
INV2 1581 165923317
INV3 36312 113475369
INV4 74536 75532490
INV5 78385 73625712
INV6 43999 103961193
INV7 46323 99864729
MAM1 54570 112505471
MAM2 22989 36403099
PAT1 222684 70173292
PAT10 120554 49027493
PAT11 95749 59861177
PAT12 140683 55749253
PAT13 145625 60098102
PAT14 140442 92611565
PAT15 115549 113135050
PAT16 109093 113203901
PAT17 133099 89625935
PAT18 101340 32714762
PAT2 194376 84713809
PAT3 172017 95883630
PAT4 149101 105539595
PAT5 142101 87656121
PAT6 113035 112366763
PAT7 142044 93702514
PAT8 132580 95531649
PAT9 135150 83335936
PHG 2671 16358873
PLN1 34379 122796967
PLN10 3442 173930019
PLN11 60873 63498301
PLN12 77379 78475276
PLN13 72843 77438163
PLN14 27465 125853960
PLN15 45143 113259657
PLN16 38333 79422393
PLN2 1373 176711614
PLN3 10555 155914143
PLN4 77563 77933470
PLN5 66824 65852757
PLN6 32157 57531572
PLN7 1276 164417819
PLN8 1407 182032896
PLN9 6 197759100
PRI1 21107 141783161
PRI10 1438 181584991
PRI11 1297 179103986
PRI12 1540 178279456
PRI13 1604 179607466
PRI14 1483 186451691
PRI15 20624 157857392
PRI16 43770 101131296
PRI17 18746 132623458
PRI18 1608 183755654
PRI19 1721 183432183
PRI2 1461 173265669
PRI20 2086 181633278
PRI21 1993 183846481
PRI22 22439 146214995
PRI23 49662 81060983
PRI24 25590 103496042
PRI25 9551 171193402
PRI26 20712 154881998
PRI27 51453 116005781
PRI28 48816 112932240
PRI29 10661 15212562
PRI3 1278 186100680
PRI4 1330 184316729
PRI5 1193 181067963
PRI6 1204 179442596
PRI7 1233 180072893
PRI8 1370 174608747
PRI9 1232 177946047
ROD1 8865 170006573
ROD10 1004 183299455
ROD11 964 183756659
ROD12 1040 187391858
ROD13 970 181926136
ROD14 27773 143100191
ROD15 1159 190071161
ROD16 1212 193286217
ROD17 4088 189208228
ROD18 42985 72767659
ROD19 24552 131618989
ROD2 925 174159213
ROD20 31558 41816586
ROD3 902 174453768
ROD4 908 174104148
ROD5 930 175114001
ROD6 980 180477162
ROD7 979 180572821
ROD8 991 181593783
ROD9 1012 183609098
STS1 82071 35434098
STS10 58209 44439069
STS11 57991 43708087
STS12 77107 37977210
STS13 88391 38933928
STS14 6303 3090630
STS2 83575 43817876
STS3 78138 31777979
STS4 64795 33318894
STS5 54886 31928904
STS6 54705 32286995
STS7 54689 32212962
STS8 56491 39089600
STS9 58083 44556609
SYN 23702 32276700
UNA 213 114659
VRL1 72431 65643269
VRL2 72034 65678979
VRL3 71763 68845127
VRL4 75546 63646019
VRL5 14009 20511323
VRT1 55730 108726857
VRT2 18203 163184657
VRT3 71269 83953381
VRT4 38173 76225145
VRT5 1187 193516089
VRT6 1283 193176113
VRT7 8196 182306744
VRT8 16951 169328344
VRT9 32905 100281003
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 149.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
8589480 11201918270 Homo sapiens
6217605 7490526361 Mus musculus
1015248 5668751953 Rattus norvegicus
840452 2101785993 Danio rerio
1129487 1947985221 Bos taurus
2565244 1703766839 Zea mays
354924 1166526669 Oryza sativa (japonica cultivar-group)
1102903 891062906 Xenopus tropicalis
1407513 805167252 Canis familiaris
530740 782116888 Drosophila melanogaster
752090 650155377 Gallus gallus
979323 647137057 Arabidopsis thaliana
207699 527756706 Pan troglodytes
784574 462578028 Sorghum bicolor
627530 423993557 Sus scrofa
693814 419652405 Ciona intestinalis
596261 404130458 Brassica oleracea
387807 403249617 Medicago truncatula
65232 383498886 Macaca mulatta
609078 346620305 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 August 2005
NCBI-GenBank Flat File Release 149.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above). The NID is obsolete and was removed
from the GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: Obsolete as of release ????
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 149.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
