Release Notes For GenBank Release 151
GBREL.TXT Genetic Sequence Data Bank
December 15 2005
NCBI-GenBank Flat File Release 151.0
Distribution Release Notes
52016762 loci, 56037734462 bases, from 52016762 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource from which those other
efforts draw. For information about TPA and RefSeq, please refer to:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 151.0
1.2 Cutoff Date
1.3 Important Changes in Release 151.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 151.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 151.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 151.0, incorporates data available to the collaborating
databases as of December 9, 2005 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 151.0
1.3.1 Problems generating accession, keyword, and author-name indexes
The methods used to generate the 'index' files which accompany GenBank
releases (see Section 3.3) are no longer adequate to the task of generating
those products.
The required multi-server queries which obtain and sort many millions of
rows of terms from several different databases, with ever-growing RAM
requirements, have simply outgrown the capacity of the hardware used for
GenBank Release generation. For GenBank 151.0, the affected 'indexes' include:
gbacc.idx (accession number index)
gbaut*.idx (author name index)
gbkey.idx (keyword index)
A version of gbacc.idx was built manually (but note that the first field
contains just an accession number, rather than Accession.Version). For
the author name index, only the first 26 of an expected 34 gbaut*.idx files
could be generated. The gbkey.idx file failed completely, and is absent from
this release.
The 'index' files are considered to be largely a legacy data product by
NCBI, generated mainly for historical reasons. FTP statistics since January
2005 seem to support this: the index files are transferred only half as
frequently as the files of sequence records. The inherent inefficiency of
the index file format also leads us to suspect that they have little
serious use by the user community. For example, what value is there in a
triplet of data values for keyword "EST" in gbkey.idx, for each and every
one of the 32 *million* EST sequences in GenBank? That keyword could
simply be assumed to apply to every sequence in the gbest*.seq sequence files.
As a result, the software to generate the index file products has received
little attention over the years, and has finally reached its limitations.
Several courses are now possible:
a) Cease support of the 'index' file products altogether.
b) Segment the index files by major functional categories (EST, GSS, and
'other'), generating, for example, an EST-specific author-name index,
a GSS-specific author-name index, and an author-name index for all
other sequences.
c) Provide a new product that presents some of the most useful data from
the legacy 'index' files, and cease support for other types index data.
Our short-term choice will most likely be (b). But even that is a stop-gap,
and thus we are likely to pursue either (a) or (c) within the next year.
If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that this ongoing problem may cause.
1.3.2 Organizational changes
The total number of sequence data files increased by 41 with this release:
- the BCT division is now comprised of 13 files (+1)
- the ENV division is now comprised of 3 files (+1)
- the EST division is now comprised of 464 files (+28)
- the GSS division is now comprised of 164 files (+6)
- the HTG division is now comprised of 69 files (+1)
- the PAT division is now comprised of 19 files (+1)
- the PLN division is now comprised of 17 files (+1)
- the ROD division is now comprised of 23 files (+2)
The total number of author-name 'index' files decreased by 6 with this
release, for reasons described in Section 1.3.1 .
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
thirty-two of the GSS flatfiles in Release 151.0. Consider gbgss133.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
December 15 2005
NCBI-GenBank Flat File Release 151.0
GSS Sequences (Part 1)
87159 loci, 64705276 bases, from 87159 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "133" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New Linetype for Genome Project Identifier
DDBJ, EMBL, and GenBank are working to create a collaborative system that
will assign a unique numeric identifier to genome projects. The purpose of
this new identifier is to provide a link among sequence records that pertain
to a specific genome sequencing project.
At GenBank, this new identifier will be presented in the flatfile format
via a new linetype : PROJECT . Here is a mocked-up example demonstrating
the new linetype's use:
LOCUS CH476840 1669278 bp DNA linear CON 05-OCT-2005
DEFINITION Magnaporthe grisea 70-15 supercont5.200 genomic scaffold, whole
genome shotgun sequence.
ACCESSION CH476840 AACU02000000
VERSION CH476840.1 GI:77022292
PROJECT GENOME_PROJECT:12345
The integer 12345 represents the value of a possible genome project
identifier.
There is a possibility that the contents of the PROJECT line might change
somewhat from this example by the time the new identifier is implemented.
We will keep you posted of any such changes via these release notes and the
GenBank listserv.
These Genome Project identifiers will be searchable within NCBI's
Entrez: Genome-Project database:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
The earliest date on which this new linetype will appear in the GenBank
flatfile format is February 15 2006.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 890 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut10.idx - Index of the entries according to accession number, part 10.
4. gbaut11.idx - Index of the entries according to accession number, part 11.
5. gbaut12.idx - Index of the entries according to accession number, part 12.
6. gbaut13.idx - Index of the entries according to accession number, part 13.
7. gbaut14.idx - Index of the entries according to accession number, part 14.
8. gbaut15.idx - Index of the entries according to accession number, part 15.
9. gbaut16.idx - Index of the entries according to accession number, part 16.
10. gbaut17.idx - Index of the entries according to accession number, part 17.
11. gbaut18.idx - Index of the entries according to accession number, part 18.
12. gbaut19.idx - Index of the entries according to accession number, part 19.
13. gbaut2.idx - Index of the entries according to accession number, part 2.
14. gbaut20.idx - Index of the entries according to accession number, part 20.
15. gbaut21.idx - Index of the entries according to accession number, part 21.
16. gbaut22.idx - Index of the entries according to accession number, part 22.
17. gbaut23.idx - Index of the entries according to accession number, part 23.
18. gbaut24.idx - Index of the entries according to accession number, part 24.
19. gbaut25.idx - Index of the entries according to accession number, part 25.
20. gbaut26.idx - Index of the entries according to accession number, part 26.
21. gbaut3.idx - Index of the entries according to accession number, part 3.
22. gbaut4.idx - Index of the entries according to accession number, part 4.
23. gbaut5.idx - Index of the entries according to accession number, part 5.
24. gbaut6.idx - Index of the entries according to accession number, part 6.
25. gbaut7.idx - Index of the entries according to accession number, part 7.
26. gbaut8.idx - Index of the entries according to accession number, part 8.
27. gbaut9.idx - Index of the entries according to accession number, part 9.
28. gbbct1.seq - Bacterial sequence entries, part 1.
29. gbbct10.seq - Bacterial sequence entries, part 10.
30. gbbct11.seq - Bacterial sequence entries, part 11.
31. gbbct12.seq - Bacterial sequence entries, part 12.
32. gbbct13.seq - Bacterial sequence entries, part 13.
33. gbbct2.seq - Bacterial sequence entries, part 2.
34. gbbct3.seq - Bacterial sequence entries, part 3.
35. gbbct4.seq - Bacterial sequence entries, part 4.
36. gbbct5.seq - Bacterial sequence entries, part 5.
37. gbbct6.seq - Bacterial sequence entries, part 6.
38. gbbct7.seq - Bacterial sequence entries, part 7.
39. gbbct8.seq - Bacterial sequence entries, part 8.
40. gbbct9.seq - Bacterial sequence entries, part 9.
41. gbchg.txt - Accession numbers of entries updated since the previous release.
42. gbcon.seq - Constructed sequence entries.
43. gbdel.txt - Accession numbers of entries deleted since the previous release.
44. gbenv1.seq - Environmental sampling sequence entries, part 1.
45. gbenv2.seq - Environmental sampling sequence entries, part 2.
46. gbenv3.seq - Environmental sampling sequence entries, part 3.
47. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
48. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
49. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
50. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
51. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
52. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
53. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
54. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
55. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
56. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
57. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
58. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
59. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
60. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
61. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
62. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
63. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
64. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
65. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
66. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
67. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
68. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
69. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
70. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
71. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
72. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
73. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
74. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
75. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
76. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
77. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
78. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
79. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
80. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
81. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
82. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
83. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
84. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
85. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
86. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
87. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
88. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
89. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
90. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
91. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
92. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
93. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
94. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
95. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
96. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
97. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
98. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
99. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
100. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
101. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
102. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
103. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
104. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
105. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
106. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
107. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
108. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
109. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
110. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
111. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
112. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
113. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
114. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
115. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
116. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
117. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
118. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
119. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
120. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
121. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
122. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
123. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
124. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
125. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
126. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
127. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
128. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
129. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
130. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
131. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
132. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
133. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
134. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
135. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
136. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
137. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
138. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
139. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
140. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
141. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
142. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
143. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
144. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
145. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
146. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
147. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
148. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
149. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
150. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
151. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
152. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
153. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
154. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
155. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
156. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
157. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
158. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
159. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
160. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
161. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
162. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
163. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
164. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
165. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
166. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
167. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
168. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
169. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
170. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
171. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
172. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
173. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
174. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
175. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
176. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
177. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
178. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
179. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
180. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
181. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
182. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
183. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
184. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
185. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
186. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
187. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
188. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
189. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
190. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
191. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
192. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
193. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
194. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
195. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
196. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
197. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
198. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
199. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
200. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
201. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
202. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
203. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
204. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
205. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
206. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
207. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
208. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
209. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
210. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
211. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
212. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
213. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
214. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
215. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
216. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
217. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
218. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
219. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
220. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
221. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
222. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
223. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
224. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
225. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
226. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
227. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
228. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
229. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
230. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
231. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
232. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
233. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
234. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
235. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
236. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
237. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
238. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
239. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
240. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
241. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
242. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
243. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
244. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
245. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
246. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
247. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
248. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
249. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
250. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
251. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
252. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
253. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
254. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
255. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
256. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
257. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
258. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
259. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
260. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
261. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
262. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
263. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
264. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
265. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
266. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
267. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
268. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
269. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
270. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
271. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
272. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
273. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
274. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
275. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
276. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
277. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
278. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
279. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
280. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
281. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
282. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
283. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
284. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
285. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
286. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
287. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
288. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
289. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
290. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
291. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
292. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
293. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
294. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
295. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
296. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
297. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
298. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
299. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
300. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
301. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
302. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
303. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
304. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
305. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
306. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
307. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
308. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
309. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
310. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
311. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
312. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
313. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
314. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
315. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
316. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
317. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
318. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
319. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
320. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
321. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
322. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
323. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
324. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
325. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
326. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
327. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
328. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
329. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
330. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
331. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
332. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
333. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
334. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
335. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
336. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
337. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
338. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
339. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
340. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
341. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
342. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
343. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
344. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
345. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
346. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
347. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
348. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
349. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
350. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
351. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
352. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
353. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
354. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
355. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
356. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
357. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
358. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
359. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
360. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
361. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
362. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
363. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
364. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
365. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
366. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
367. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
368. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
369. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
370. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
371. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
372. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
373. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
374. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
375. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
376. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
377. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
378. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
379. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
380. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
381. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
382. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
383. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
384. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
385. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
386. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
387. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
388. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
389. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
390. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
391. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
392. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
393. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
394. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
395. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
396. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
397. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
398. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
399. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
400. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
401. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
402. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
403. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
404. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
405. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
406. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
407. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
408. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
409. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
410. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
411. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
412. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
413. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
414. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
415. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
416. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
417. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
418. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
419. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
420. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
421. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
422. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
423. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
424. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
425. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
426. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
427. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
428. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
429. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
430. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
431. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
432. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
433. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
434. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
435. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
436. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
437. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
438. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
439. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
440. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
441. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
442. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
443. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
444. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
445. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
446. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
447. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
448. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
449. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
450. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
451. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
452. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
453. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
454. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
455. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
456. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
457. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
458. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
459. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
460. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
461. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
462. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
463. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
464. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
465. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
466. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
467. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
468. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
469. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
470. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
471. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
472. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
473. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
474. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
475. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
476. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
477. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
478. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
479. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
480. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
481. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
482. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
483. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
484. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
485. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
486. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
487. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
488. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
489. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
490. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
491. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
492. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
493. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
494. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
495. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
496. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
497. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
498. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
499. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
500. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
501. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
502. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
503. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
504. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
505. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
506. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
507. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
508. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
509. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
510. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
511. gbgen.idx - Index of the entries according to gene symbols.
512. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
513. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
514. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
515. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
516. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
517. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
518. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
519. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
520. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
521. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
522. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
523. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
524. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
525. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
526. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
527. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
528. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
529. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
530. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
531. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
532. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
533. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
534. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
535. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
536. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
537. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
538. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
539. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
540. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
541. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
542. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
543. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
544. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
545. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
546. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
547. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
548. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
549. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
550. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
551. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
552. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
553. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
554. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
555. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
556. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
557. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
558. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
559. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
560. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
561. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
562. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
563. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
564. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
565. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
566. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
567. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
568. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
569. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
570. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
571. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
572. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
573. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
574. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
575. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
576. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
577. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
578. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
579. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
580. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
581. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
582. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
583. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
584. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
585. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
586. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
587. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
588. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
589. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
590. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
591. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
592. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
593. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
594. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
595. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
596. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
597. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
598. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
599. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
600. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
601. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
602. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
603. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
604. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
605. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
606. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
607. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
608. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
609. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
610. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
611. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
612. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
613. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
614. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
615. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
616. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
617. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
618. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
619. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
620. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
621. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
622. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
623. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
624. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
625. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
626. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
627. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
628. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
629. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
630. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
631. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
632. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
633. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
634. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
635. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
636. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
637. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
638. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
639. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
640. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
641. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
642. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
643. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
644. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
645. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
646. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
647. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
648. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
649. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
650. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
651. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
652. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
653. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
654. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
655. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
656. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
657. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
658. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
659. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
660. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
661. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
662. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
663. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
664. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
665. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
666. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
667. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
668. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
669. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
670. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
671. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
672. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
673. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
674. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
675. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
676. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
677. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
678. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
679. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
680. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
681. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
682. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
683. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
684. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
685. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
686. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
687. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
688. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
689. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
690. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
691. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
692. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
693. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
694. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
695. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
696. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
697. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
698. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
699. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
700. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
701. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
702. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
703. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
704. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
705. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
706. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
707. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
708. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
709. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
710. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
711. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
712. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
713. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
714. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
715. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
716. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
717. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
718. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
719. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
720. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
721. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
722. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
723. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
724. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
725. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
726. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
727. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
728. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
729. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
730. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
731. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
732. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
733. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
734. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
735. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
736. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
737. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
738. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
739. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
740. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
741. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
742. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
743. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
744. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
745. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
746. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
747. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
748. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
749. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
750. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
751. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
752. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
753. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
754. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
755. gbinv1.seq - Invertebrate sequence entries, part 1.
756. gbinv2.seq - Invertebrate sequence entries, part 2.
757. gbinv3.seq - Invertebrate sequence entries, part 3.
758. gbinv4.seq - Invertebrate sequence entries, part 4.
759. gbinv5.seq - Invertebrate sequence entries, part 5.
760. gbinv6.seq - Invertebrate sequence entries, part 6.
761. gbinv7.seq - Invertebrate sequence entries, part 7.
762. gbinv8.seq - Invertebrate sequence entries, part 8.
763. gbjou.idx - Index of the entries according to journal citation.
764. gbmam1.seq - Other mammalian sequence entries, part 1.
765. gbmam2.seq - Other mammalian sequence entries, part 2.
766. gbnew.txt - Accession numbers of entries new since the previous release.
767. gbpat1.seq - Patent sequence entries, part 1.
768. gbpat10.seq - Patent sequence entries, part 10.
769. gbpat11.seq - Patent sequence entries, part 11.
770. gbpat12.seq - Patent sequence entries, part 12.
771. gbpat13.seq - Patent sequence entries, part 13.
772. gbpat14.seq - Patent sequence entries, part 14.
773. gbpat15.seq - Patent sequence entries, part 15.
774. gbpat16.seq - Patent sequence entries, part 16.
775. gbpat17.seq - Patent sequence entries, part 17.
776. gbpat18.seq - Patent sequence entries, part 18.
777. gbpat19.seq - Patent sequence entries, part 19.
778. gbpat2.seq - Patent sequence entries, part 2.
779. gbpat3.seq - Patent sequence entries, part 3.
780. gbpat4.seq - Patent sequence entries, part 4.
781. gbpat5.seq - Patent sequence entries, part 5.
782. gbpat6.seq - Patent sequence entries, part 6.
783. gbpat7.seq - Patent sequence entries, part 7.
784. gbpat8.seq - Patent sequence entries, part 8.
785. gbpat9.seq - Patent sequence entries, part 9.
786. gbphg.seq - Phage sequence entries.
787. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
788. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
789. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
790. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
791. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
792. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
793. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
794. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
795. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
796. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
797. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
798. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
799. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
800. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
801. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
802. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
803. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
804. gbpri1.seq - Primate sequence entries, part 1.
805. gbpri10.seq - Primate sequence entries, part 10.
806. gbpri11.seq - Primate sequence entries, part 11.
807. gbpri12.seq - Primate sequence entries, part 12.
808. gbpri13.seq - Primate sequence entries, part 13.
809. gbpri14.seq - Primate sequence entries, part 14.
810. gbpri15.seq - Primate sequence entries, part 15.
811. gbpri16.seq - Primate sequence entries, part 16.
812. gbpri17.seq - Primate sequence entries, part 17.
813. gbpri18.seq - Primate sequence entries, part 18.
814. gbpri19.seq - Primate sequence entries, part 19.
815. gbpri2.seq - Primate sequence entries, part 2.
816. gbpri20.seq - Primate sequence entries, part 20.
817. gbpri21.seq - Primate sequence entries, part 21.
818. gbpri22.seq - Primate sequence entries, part 22.
819. gbpri23.seq - Primate sequence entries, part 23.
820. gbpri24.seq - Primate sequence entries, part 24.
821. gbpri25.seq - Primate sequence entries, part 25.
822. gbpri26.seq - Primate sequence entries, part 26.
823. gbpri27.seq - Primate sequence entries, part 27.
824. gbpri28.seq - Primate sequence entries, part 28.
825. gbpri29.seq - Primate sequence entries, part 29.
826. gbpri3.seq - Primate sequence entries, part 3.
827. gbpri4.seq - Primate sequence entries, part 4.
828. gbpri5.seq - Primate sequence entries, part 5.
829. gbpri6.seq - Primate sequence entries, part 6.
830. gbpri7.seq - Primate sequence entries, part 7.
831. gbpri8.seq - Primate sequence entries, part 8.
832. gbpri9.seq - Primate sequence entries, part 9.
833. gbrel.txt - Release notes (this document).
834. gbrod1.seq - Rodent sequence entries, part 1.
835. gbrod10.seq - Rodent sequence entries, part 10.
836. gbrod11.seq - Rodent sequence entries, part 11.
837. gbrod12.seq - Rodent sequence entries, part 12.
838. gbrod13.seq - Rodent sequence entries, part 13.
839. gbrod14.seq - Rodent sequence entries, part 14.
840. gbrod15.seq - Rodent sequence entries, part 15.
841. gbrod16.seq - Rodent sequence entries, part 16.
842. gbrod17.seq - Rodent sequence entries, part 17.
843. gbrod18.seq - Rodent sequence entries, part 18.
844. gbrod19.seq - Rodent sequence entries, part 19.
845. gbrod2.seq - Rodent sequence entries, part 2.
846. gbrod20.seq - Rodent sequence entries, part 20.
847. gbrod21.seq - Rodent sequence entries, part 21.
848. gbrod22.seq - Rodent sequence entries, part 22.
849. gbrod23.seq - Rodent sequence entries, part 23.
850. gbrod3.seq - Rodent sequence entries, part 3.
851. gbrod4.seq - Rodent sequence entries, part 4.
852. gbrod5.seq - Rodent sequence entries, part 5.
853. gbrod6.seq - Rodent sequence entries, part 6.
854. gbrod7.seq - Rodent sequence entries, part 7.
855. gbrod8.seq - Rodent sequence entries, part 8.
856. gbrod9.seq - Rodent sequence entries, part 9.
857. gbsdr.txt - Short directory of the data bank.
858. gbsec.idx - Index of the entries according to secondary accession number.
859. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
860. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
861. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
862. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
863. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
864. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
865. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
866. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
867. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
868. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
869. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
870. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
871. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
872. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
873. gbsyn.seq - Synthetic and chimeric sequence entries.
874. gbuna.seq - Unannotated sequence entries.
875. gbvrl1.seq - Viral sequence entries, part 1.
876. gbvrl2.seq - Viral sequence entries, part 2.
877. gbvrl3.seq - Viral sequence entries, part 3.
878. gbvrl4.seq - Viral sequence entries, part 4.
879. gbvrl5.seq - Viral sequence entries, part 5.
880. gbvrt1.seq - Other vertebrate sequence entries, part 1.
881. gbvrt10.seq - Other vertebrate sequence entries, part 10.
882. gbvrt2.seq - Other vertebrate sequence entries, part 2.
883. gbvrt3.seq - Other vertebrate sequence entries, part 3.
884. gbvrt4.seq - Other vertebrate sequence entries, part 4.
885. gbvrt5.seq - Other vertebrate sequence entries, part 5.
886. gbvrt6.seq - Other vertebrate sequence entries, part 6.
887. gbvrt7.seq - Other vertebrate sequence entries, part 7.
888. gbvrt8.seq - Other vertebrate sequence entries, part 8.
889. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 151.0 flatfiles require roughly 196 GB (sequence
files only) or 216 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1605136604 gbacc.idx
505206170 gbaut1.idx
510854603 gbaut10.idx
519305882 gbaut11.idx
506544288 gbaut12.idx
508027764 gbaut13.idx
506441395 gbaut14.idx
500917233 gbaut15.idx
500600401 gbaut16.idx
502046558 gbaut17.idx
500072332 gbaut18.idx
515897070 gbaut19.idx
504520655 gbaut2.idx
511637988 gbaut20.idx
506473770 gbaut21.idx
500577146 gbaut22.idx
504858530 gbaut23.idx
510065474 gbaut24.idx
505966027 gbaut25.idx
202997760 gbaut26.idx
511577228 gbaut3.idx
509554287 gbaut4.idx
503070067 gbaut5.idx
500429208 gbaut6.idx
515313235 gbaut7.idx
509808213 gbaut8.idx
502703583 gbaut9.idx
254876785 gbbct1.seq
253440962 gbbct10.seq
250006174 gbbct11.seq
250517149 gbbct12.seq
44711004 gbbct13.seq
250203373 gbbct2.seq
250544545 gbbct3.seq
250008314 gbbct4.seq
251370493 gbbct5.seq
250000252 gbbct6.seq
266555988 gbbct7.seq
250342159 gbbct8.seq
250123161 gbbct9.seq
7443969 gbchg.txt
837494928 gbcon.seq
28161 gbdel.txt
250001701 gbenv1.seq
250001088 gbenv2.seq
26029670 gbenv3.seq
230687890 gbest1.seq
230689203 gbest10.seq
230689269 gbest100.seq
230690253 gbest101.seq
230688333 gbest102.seq
230690304 gbest103.seq
230689203 gbest104.seq
230687445 gbest105.seq
230689655 gbest106.seq
230689765 gbest107.seq
230689442 gbest108.seq
230689794 gbest109.seq
230688357 gbest11.seq
230689205 gbest110.seq
230600484 gbest111.seq
230690472 gbest112.seq
230688866 gbest113.seq
230690281 gbest114.seq
230688160 gbest115.seq
230687553 gbest116.seq
230688416 gbest117.seq
230687459 gbest118.seq
230688629 gbest119.seq
230688106 gbest12.seq
230689571 gbest120.seq
230688588 gbest121.seq
230689977 gbest122.seq
230687880 gbest123.seq
230690091 gbest124.seq
230690176 gbest125.seq
230689184 gbest126.seq
230689844 gbest127.seq
230687982 gbest128.seq
230689086 gbest129.seq
230688579 gbest13.seq
230691210 gbest130.seq
230687788 gbest131.seq
230689096 gbest132.seq
230689050 gbest133.seq
230690685 gbest134.seq
230691373 gbest135.seq
230690101 gbest136.seq
230691337 gbest137.seq
230688885 gbest138.seq
230691821 gbest139.seq
230688169 gbest14.seq
230688910 gbest140.seq
230688792 gbest141.seq
230688060 gbest142.seq
230688819 gbest143.seq
230687465 gbest144.seq
230687664 gbest145.seq
230688918 gbest146.seq
230687917 gbest147.seq
230689285 gbest148.seq
230687969 gbest149.seq
230689465 gbest15.seq
230690293 gbest150.seq
230690530 gbest151.seq
230689116 gbest152.seq
230689354 gbest153.seq
230687863 gbest154.seq
230688598 gbest155.seq
230693331 gbest156.seq
230687807 gbest157.seq
230688153 gbest158.seq
230689379 gbest159.seq
230689693 gbest16.seq
230690633 gbest160.seq
230688239 gbest161.seq
230688878 gbest162.seq
230688647 gbest163.seq
230690029 gbest164.seq
230688440 gbest165.seq
230687726 gbest166.seq
230688796 gbest167.seq
230689530 gbest168.seq
230688026 gbest169.seq
230687454 gbest17.seq
230689562 gbest170.seq
221937708 gbest171.seq
230688186 gbest172.seq
230690058 gbest173.seq
230688462 gbest174.seq
230691025 gbest175.seq
230688332 gbest176.seq
230690925 gbest177.seq
230690144 gbest178.seq
230688303 gbest179.seq
230688261 gbest18.seq
230688028 gbest180.seq
230687940 gbest181.seq
230689243 gbest182.seq
230687660 gbest183.seq
230688387 gbest184.seq
230688920 gbest185.seq
230688700 gbest186.seq
230688801 gbest187.seq
230689546 gbest188.seq
230689823 gbest189.seq
230687460 gbest19.seq
230689575 gbest190.seq
230689066 gbest191.seq
230690764 gbest192.seq
230689937 gbest193.seq
230689449 gbest194.seq
230688431 gbest195.seq
230688043 gbest196.seq
230688668 gbest197.seq
230687729 gbest198.seq
230687450 gbest199.seq
230689426 gbest2.seq
230689632 gbest20.seq
230689640 gbest200.seq
230688197 gbest201.seq
230688225 gbest202.seq
230689507 gbest203.seq
230687511 gbest204.seq
230689591 gbest205.seq
230689200 gbest206.seq
230688257 gbest207.seq
230687638 gbest208.seq
230688530 gbest209.seq
230688262 gbest21.seq
230688639 gbest210.seq
230689675 gbest211.seq
230688100 gbest212.seq
230689379 gbest213.seq
230689273 gbest214.seq
230690882 gbest215.seq
230690739 gbest216.seq
230690497 gbest217.seq
230688350 gbest218.seq
230689320 gbest219.seq
230688270 gbest22.seq
220198703 gbest220.seq
163043492 gbest221.seq
162245390 gbest222.seq
169249175 gbest223.seq
168194682 gbest224.seq
167346629 gbest225.seq
165490543 gbest226.seq
164894567 gbest227.seq
164476033 gbest228.seq
164385856 gbest229.seq
230688836 gbest23.seq
164278219 gbest230.seq
164382993 gbest231.seq
163424640 gbest232.seq
167026489 gbest233.seq
164399880 gbest234.seq
161959683 gbest235.seq
165171689 gbest236.seq
168559738 gbest237.seq
166700333 gbest238.seq
165643145 gbest239.seq
230689093 gbest24.seq
165861237 gbest240.seq
165116590 gbest241.seq
164727403 gbest242.seq
164238557 gbest243.seq
164591338 gbest244.seq
165127193 gbest245.seq
173854720 gbest246.seq
176757587 gbest247.seq
173791063 gbest248.seq
230689705 gbest249.seq
230687797 gbest25.seq
230687690 gbest250.seq
230690660 gbest251.seq
230689615 gbest252.seq
230690722 gbest253.seq
230689410 gbest254.seq
230688397 gbest255.seq
230690258 gbest256.seq
230691717 gbest257.seq
230688399 gbest258.seq
230689146 gbest259.seq
230690376 gbest26.seq
230689084 gbest260.seq
230688182 gbest261.seq
230687657 gbest262.seq
230691038 gbest263.seq
230688412 gbest264.seq
230690943 gbest265.seq
230689316 gbest266.seq
230691997 gbest267.seq
230688911 gbest268.seq
230689773 gbest269.seq
230687870 gbest27.seq
230688518 gbest270.seq
230690337 gbest271.seq
230688143 gbest272.seq
230688022 gbest273.seq
230689761 gbest274.seq
230688121 gbest275.seq
230687513 gbest276.seq
230687752 gbest277.seq
214374548 gbest278.seq
230690348 gbest279.seq
230688111 gbest28.seq
230688052 gbest280.seq
230687563 gbest281.seq
230689282 gbest282.seq
230688823 gbest283.seq
230690079 gbest284.seq
230687605 gbest285.seq
230690467 gbest286.seq
230688415 gbest287.seq
230688608 gbest288.seq
230688484 gbest289.seq
230688543 gbest29.seq
230687511 gbest290.seq
230689410 gbest291.seq
230688330 gbest292.seq
230689774 gbest293.seq
230688996 gbest294.seq
230687531 gbest295.seq
230691017 gbest296.seq
230690009 gbest297.seq
230687950 gbest298.seq
230688847 gbest299.seq
230690270 gbest3.seq
230688302 gbest30.seq
230688861 gbest300.seq
230690705 gbest301.seq
230689053 gbest302.seq
230687899 gbest303.seq
230688702 gbest304.seq
230689804 gbest305.seq
230688053 gbest306.seq
230687831 gbest307.seq
230690767 gbest308.seq
230688875 gbest309.seq
230690632 gbest31.seq
220669967 gbest310.seq
225083517 gbest311.seq
230688857 gbest312.seq
230687815 gbest313.seq
230690212 gbest314.seq
230689508 gbest315.seq
230689582 gbest316.seq
166781084 gbest317.seq
160185954 gbest318.seq
230689494 gbest319.seq
230690297 gbest32.seq
230687794 gbest320.seq
230693150 gbest321.seq
230688510 gbest322.seq
230688820 gbest323.seq
230690355 gbest324.seq
230689868 gbest325.seq
230688693 gbest326.seq
230687625 gbest327.seq
230689152 gbest328.seq
230688777 gbest329.seq
230690266 gbest33.seq
230689776 gbest330.seq
230690078 gbest331.seq
230688385 gbest332.seq
230688762 gbest333.seq
230691373 gbest334.seq
230690697 gbest335.seq
230688588 gbest336.seq
230688956 gbest337.seq
230688810 gbest338.seq
230689206 gbest339.seq
230689982 gbest34.seq
230690639 gbest340.seq
230690621 gbest341.seq
230689123 gbest342.seq
230687991 gbest343.seq
230691855 gbest344.seq
230689583 gbest345.seq
230688381 gbest346.seq
230689703 gbest347.seq
230689851 gbest348.seq
230689630 gbest349.seq
230688633 gbest35.seq
230689793 gbest350.seq
230692945 gbest351.seq
230689276 gbest352.seq
230687663 gbest353.seq
230687534 gbest354.seq
230687810 gbest355.seq
230690214 gbest356.seq
230688402 gbest357.seq
230689462 gbest358.seq
230689831 gbest359.seq
230687796 gbest36.seq
230689612 gbest360.seq
222358846 gbest361.seq
230689707 gbest362.seq
230690318 gbest363.seq
230690316 gbest364.seq
230690353 gbest365.seq
230688766 gbest366.seq
230689336 gbest367.seq
222113867 gbest368.seq
230688496 gbest369.seq
230688139 gbest37.seq
230688160 gbest370.seq
230689342 gbest371.seq
230687991 gbest372.seq
230690911 gbest373.seq
230688853 gbest374.seq
230687626 gbest375.seq
230688054 gbest376.seq
230688973 gbest377.seq
230687525 gbest378.seq
230689797 gbest379.seq
230687710 gbest38.seq
230688482 gbest380.seq
230690368 gbest381.seq
230690673 gbest382.seq
230687884 gbest383.seq
230687655 gbest384.seq
225925804 gbest385.seq
211948608 gbest386.seq
211615055 gbest387.seq
211860840 gbest388.seq
211720773 gbest389.seq
230688466 gbest39.seq
211972615 gbest390.seq
211985645 gbest391.seq
213598158 gbest392.seq
213017631 gbest393.seq
212562827 gbest394.seq
215672571 gbest395.seq
213201694 gbest396.seq
212161956 gbest397.seq
212189263 gbest398.seq
212332460 gbest399.seq
230690637 gbest4.seq
204449183 gbest40.seq
211728727 gbest400.seq
211804507 gbest401.seq
222022875 gbest402.seq
230688848 gbest403.seq
230690030 gbest404.seq
230689799 gbest405.seq
230689308 gbest406.seq
230688582 gbest407.seq
230687541 gbest408.seq
230690458 gbest409.seq
192034105 gbest41.seq
230689103 gbest410.seq
230690052 gbest411.seq
230689560 gbest412.seq
230689715 gbest413.seq
230689929 gbest414.seq
230689553 gbest415.seq
230688782 gbest416.seq
230691192 gbest417.seq
225395160 gbest418.seq
230689435 gbest419.seq
200044510 gbest42.seq
230688407 gbest420.seq
230687904 gbest421.seq
230688430 gbest422.seq
230688329 gbest423.seq
230689089 gbest424.seq
230688839 gbest425.seq
230690461 gbest426.seq
230689666 gbest427.seq
230688967 gbest428.seq
230688306 gbest429.seq
214974184 gbest43.seq
230689307 gbest430.seq
230689722 gbest431.seq
230689819 gbest432.seq
230690853 gbest433.seq
230687501 gbest434.seq
230691336 gbest435.seq
230690222 gbest436.seq
230691073 gbest437.seq
230690449 gbest438.seq
230689103 gbest439.seq
216232330 gbest44.seq
230687972 gbest440.seq
230687867 gbest441.seq
230689875 gbest442.seq
230691379 gbest443.seq
230690573 gbest444.seq
230689090 gbest445.seq
230687447 gbest446.seq
230687894 gbest447.seq
230688716 gbest448.seq
230689993 gbest449.seq
216248122 gbest45.seq
230689550 gbest450.seq
230690197 gbest451.seq
230689311 gbest452.seq
230687753 gbest453.seq
230690307 gbest454.seq
224617856 gbest455.seq
228804614 gbest456.seq
230688606 gbest457.seq
230688195 gbest458.seq
230689924 gbest459.seq
216663421 gbest46.seq
230687624 gbest460.seq
230687536 gbest461.seq
220205631 gbest462.seq
230688087 gbest463.seq
213404887 gbest464.seq
230688689 gbest47.seq
230689730 gbest48.seq
223475887 gbest49.seq
164063504 gbest5.seq
230687975 gbest50.seq
230690032 gbest51.seq
230690201 gbest52.seq
230689572 gbest53.seq
230690914 gbest54.seq
230687524 gbest55.seq
230689686 gbest56.seq
230689999 gbest57.seq
230688944 gbest58.seq
230689839 gbest59.seq
178539313 gbest6.seq
230687944 gbest60.seq
230688843 gbest61.seq
230688669 gbest62.seq
230687955 gbest63.seq
230688415 gbest64.seq
230688767 gbest65.seq
209676303 gbest66.seq
209195309 gbest67.seq
208803319 gbest68.seq
209093427 gbest69.seq
230688112 gbest7.seq
210352828 gbest70.seq
209752424 gbest71.seq
208552019 gbest72.seq
209469022 gbest73.seq
210522632 gbest74.seq
206250363 gbest75.seq
206851300 gbest76.seq
208134647 gbest77.seq
208505425 gbest78.seq
215975491 gbest79.seq
230687894 gbest8.seq
230692360 gbest80.seq
230688587 gbest81.seq
230689887 gbest82.seq
215214582 gbest83.seq
214828627 gbest84.seq
218083541 gbest85.seq
230691152 gbest86.seq
230688014 gbest87.seq
230688103 gbest88.seq
230688974 gbest89.seq
230689448 gbest9.seq
230689843 gbest90.seq
230689697 gbest91.seq
230687546 gbest92.seq
230689573 gbest93.seq
230687620 gbest94.seq
230690203 gbest95.seq
230689029 gbest96.seq
230688747 gbest97.seq
230689794 gbest98.seq
230690213 gbest99.seq
50716047 gbgen.idx
230688405 gbgss1.seq
230689196 gbgss10.seq
227335406 gbgss100.seq
228266855 gbgss101.seq
228745231 gbgss102.seq
228629796 gbgss103.seq
227929435 gbgss104.seq
227460004 gbgss105.seq
230689107 gbgss106.seq
230687585 gbgss107.seq
230688878 gbgss108.seq
230687676 gbgss109.seq
230690514 gbgss11.seq
230689199 gbgss110.seq
230688583 gbgss111.seq
230688212 gbgss112.seq
230688444 gbgss113.seq
230690487 gbgss114.seq
230688651 gbgss115.seq
230687977 gbgss116.seq
230691596 gbgss117.seq
230689691 gbgss118.seq
230688060 gbgss119.seq
230689137 gbgss12.seq
230687519 gbgss120.seq
230688214 gbgss121.seq
230689058 gbgss122.seq
230687754 gbgss123.seq
230687888 gbgss124.seq
230688991 gbgss125.seq
230690145 gbgss126.seq
230689381 gbgss127.seq
230688293 gbgss128.seq
230688957 gbgss129.seq
230570202 gbgss13.seq
230689496 gbgss130.seq
230687903 gbgss131.seq
103550149 gbgss132.seq
250000499 gbgss133.seq
250002682 gbgss134.seq
250001784 gbgss135.seq
250001696 gbgss136.seq
250002421 gbgss137.seq
250002602 gbgss138.seq
250001620 gbgss139.seq
230689027 gbgss14.seq
250002661 gbgss140.seq
250002251 gbgss141.seq
250000353 gbgss142.seq
250001393 gbgss143.seq
250001149 gbgss144.seq
250001632 gbgss145.seq
250000686 gbgss146.seq
250001156 gbgss147.seq
250001363 gbgss148.seq
250001916 gbgss149.seq
230688679 gbgss15.seq
250001317 gbgss150.seq
250000675 gbgss151.seq
250001038 gbgss152.seq
250001201 gbgss153.seq
250000799 gbgss154.seq
250000881 gbgss155.seq
250000022 gbgss156.seq
250002406 gbgss157.seq
250001695 gbgss158.seq
250002082 gbgss159.seq
230689266 gbgss16.seq
250000999 gbgss160.seq
250000164 gbgss161.seq
250001715 gbgss162.seq
250000274 gbgss163.seq
80209741 gbgss164.seq
230687595 gbgss17.seq
230690627 gbgss18.seq
230687933 gbgss19.seq
230688758 gbgss2.seq
230687645 gbgss20.seq
230688129 gbgss21.seq
230688525 gbgss22.seq
230690250 gbgss23.seq
230687922 gbgss24.seq
230688166 gbgss25.seq
230690235 gbgss26.seq
230690056 gbgss27.seq
230688184 gbgss28.seq
230687468 gbgss29.seq
230689208 gbgss3.seq
230688387 gbgss30.seq
230689822 gbgss31.seq
230690365 gbgss32.seq
230690283 gbgss33.seq
230689732 gbgss34.seq
230688787 gbgss35.seq
230688200 gbgss36.seq
230687829 gbgss37.seq
230687631 gbgss38.seq
230689789 gbgss39.seq
230688227 gbgss4.seq
230689244 gbgss40.seq
230689924 gbgss41.seq
230688535 gbgss42.seq
230688054 gbgss43.seq
230690772 gbgss44.seq
230689116 gbgss45.seq
230690357 gbgss46.seq
230688683 gbgss47.seq
230688632 gbgss48.seq
230689362 gbgss49.seq
230687514 gbgss5.seq
230688842 gbgss50.seq
230688052 gbgss51.seq
230689858 gbgss52.seq
230689130 gbgss53.seq
230687639 gbgss54.seq
230689843 gbgss55.seq
230689411 gbgss56.seq
230689307 gbgss57.seq
230689492 gbgss58.seq
230687466 gbgss59.seq
230690316 gbgss6.seq
230687881 gbgss60.seq
229354423 gbgss61.seq
230689693 gbgss62.seq
230689372 gbgss63.seq
230688983 gbgss64.seq
230689536 gbgss65.seq
230689591 gbgss66.seq
230688340 gbgss67.seq
230689162 gbgss68.seq
230688947 gbgss69.seq
230691359 gbgss7.seq
230689554 gbgss70.seq
230689370 gbgss71.seq
230688797 gbgss72.seq
230687950 gbgss73.seq
230689534 gbgss74.seq
230687557 gbgss75.seq
230689881 gbgss76.seq
230689598 gbgss77.seq
230687781 gbgss78.seq
230689200 gbgss79.seq
230688790 gbgss8.seq
230689003 gbgss80.seq
199279494 gbgss81.seq
194742536 gbgss82.seq
219954193 gbgss83.seq
230688991 gbgss84.seq
230690205 gbgss85.seq
230688904 gbgss86.seq
230689337 gbgss87.seq
230688253 gbgss88.seq
230687483 gbgss89.seq
230688957 gbgss9.seq
230689897 gbgss90.seq
230690158 gbgss91.seq
230688193 gbgss92.seq
230688751 gbgss93.seq
230688595 gbgss94.seq
230688510 gbgss95.seq
230687476 gbgss96.seq
230687619 gbgss97.seq
230689029 gbgss98.seq
230689480 gbgss99.seq
250002194 gbhtc1.seq
60466769 gbhtc10.seq
250003823 gbhtc2.seq
250014377 gbhtc3.seq
250007673 gbhtc4.seq
250001305 gbhtc5.seq
250002347 gbhtc6.seq
250001291 gbhtc7.seq
250003059 gbhtc8.seq
250002500 gbhtc9.seq
250063915 gbhtg1.seq
250148884 gbhtg10.seq
250075771 gbhtg11.seq
250133576 gbhtg12.seq
250462116 gbhtg13.seq
250023369 gbhtg14.seq
250223295 gbhtg15.seq
250377741 gbhtg16.seq
250503909 gbhtg17.seq
250137427 gbhtg18.seq
250066765 gbhtg19.seq
250132476 gbhtg2.seq
250264406 gbhtg20.seq
250237613 gbhtg21.seq
250281911 gbhtg22.seq
250124630 gbhtg23.seq
250026503 gbhtg24.seq
250230814 gbhtg25.seq
250217977 gbhtg26.seq
250279040 gbhtg27.seq
250204235 gbhtg28.seq
250198752 gbhtg29.seq
250131815 gbhtg3.seq
250154689 gbhtg30.seq
250321747 gbhtg31.seq
250145306 gbhtg32.seq
250123624 gbhtg33.seq
250159801 gbhtg34.seq
250271981 gbhtg35.seq
250213998 gbhtg36.seq
250215327 gbhtg37.seq
250346681 gbhtg38.seq
250147876 gbhtg39.seq
250101071 gbhtg4.seq
250242868 gbhtg40.seq
250001782 gbhtg41.seq
250147445 gbhtg42.seq
250236285 gbhtg43.seq
250043036 gbhtg44.seq
250109030 gbhtg45.seq
250055773 gbhtg46.seq
250170310 gbhtg47.seq
250267364 gbhtg48.seq
250214823 gbhtg49.seq
250181202 gbhtg5.seq
250158074 gbhtg50.seq
250102784 gbhtg51.seq
250054162 gbhtg52.seq
250102048 gbhtg53.seq
250131438 gbhtg54.seq
250267424 gbhtg55.seq
250099546 gbhtg56.seq
250186376 gbhtg57.seq
250175238 gbhtg58.seq
250083789 gbhtg59.seq
250203910 gbhtg6.seq
250013612 gbhtg60.seq
250242158 gbhtg61.seq
250369380 gbhtg62.seq
250033213 gbhtg63.seq
250312437 gbhtg64.seq
250030216 gbhtg65.seq
250008084 gbhtg66.seq
250869173 gbhtg67.seq
250217424 gbhtg68.seq
152999622 gbhtg69.seq
250012437 gbhtg7.seq
250174040 gbhtg8.seq
250101068 gbhtg9.seq
250114621 gbinv1.seq
250076862 gbinv2.seq
250003308 gbinv3.seq
250000314 gbinv4.seq
250012493 gbinv5.seq
250005905 gbinv6.seq
250400869 gbinv7.seq
97731994 gbinv8.seq
1334027974 gbjou.idx
250001755 gbmam1.seq
142765097 gbmam2.seq
45552701 gbnew.txt
250000409 gbpat1.seq
250000859 gbpat10.seq
250001835 gbpat11.seq
250001030 gbpat12.seq
250000338 gbpat13.seq
250000038 gbpat14.seq
250000941 gbpat15.seq
250000755 gbpat16.seq
250243023 gbpat17.seq
250001185 gbpat18.seq
94302750 gbpat19.seq
250002254 gbpat2.seq
250000558 gbpat3.seq
250000141 gbpat4.seq
250004690 gbpat5.seq
250001033 gbpat6.seq
250000468 gbpat7.seq
250002725 gbpat8.seq
250000901 gbpat9.seq
44614623 gbphg.seq
250036891 gbpln1.seq
250001063 gbpln10.seq
250002688 gbpln11.seq
250002704 gbpln12.seq
250000359 gbpln13.seq
250027891 gbpln14.seq
250026925 gbpln15.seq
250002452 gbpln16.seq
35131217 gbpln17.seq
250138910 gbpln2.seq
250006183 gbpln3.seq
250002923 gbpln4.seq
250003445 gbpln5.seq
250001556 gbpln6.seq
250137854 gbpln7.seq
296942363 gbpln8.seq
250570232 gbpln9.seq
250109519 gbpri1.seq
250003261 gbpri10.seq
250093919 gbpri11.seq
250196454 gbpri12.seq
250019982 gbpri13.seq
250121968 gbpri14.seq
250002060 gbpri15.seq
250001652 gbpri16.seq
250086176 gbpri17.seq
250043536 gbpri18.seq
250073662 gbpri19.seq
250049731 gbpri2.seq
250072596 gbpri20.seq
250083550 gbpri21.seq
250001778 gbpri22.seq
250004647 gbpri23.seq
250116829 gbpri24.seq
250059899 gbpri25.seq
250000195 gbpri26.seq
250096472 gbpri27.seq
250067091 gbpri28.seq
114200869 gbpri29.seq
250045508 gbpri3.seq
250004209 gbpri4.seq
250189507 gbpri5.seq
250157484 gbpri6.seq
250100961 gbpri7.seq
250132149 gbpri8.seq
250018531 gbpri9.seq
207108 gbrel.txt
250189629 gbrod1.seq
250030487 gbrod10.seq
250012120 gbrod11.seq
250172707 gbrod12.seq
250278170 gbrod13.seq
250239961 gbrod14.seq
250143753 gbrod15.seq
250001322 gbrod16.seq
250134246 gbrod17.seq
250035755 gbrod18.seq
250084927 gbrod19.seq
250229320 gbrod2.seq
250003433 gbrod20.seq
250167160 gbrod21.seq
250000564 gbrod22.seq
99945165 gbrod23.seq
250152112 gbrod3.seq
250219253 gbrod4.seq
250159809 gbrod5.seq
250048340 gbrod6.seq
250152007 gbrod7.seq
250015912 gbrod8.seq
250145507 gbrod9.seq
4161396768 gbsdr.txt
1565356 gbsec.idx
250001655 gbsts1.seq
250001489 gbsts10.seq
250002724 gbsts11.seq
250001345 gbsts12.seq
250000881 gbsts13.seq
27424122 gbsts14.seq
250000995 gbsts2.seq
250000633 gbsts3.seq
250004419 gbsts4.seq
250000963 gbsts5.seq
250004581 gbsts6.seq
250001855 gbsts7.seq
250001611 gbsts8.seq
250000223 gbsts9.seq
103809857 gbsyn.seq
407383 gbuna.seq
250001080 gbvrl1.seq
250002759 gbvrl2.seq
250001723 gbvrl3.seq
250001788 gbvrl4.seq
136379518 gbvrl5.seq
250003090 gbvrt1.seq
98412680 gbvrt10.seq
250048832 gbvrt2.seq
250000776 gbvrt3.seq
250001820 gbvrt4.seq
250110351 gbvrt5.seq
250178633 gbvrt6.seq
250089837 gbvrt7.seq
250017567 gbvrt8.seq
250002127 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 25679 103291878
BCT10 50 113503858
BCT11 16933 101967672
BCT12 37591 90244334
BCT13 4830 17381756
BCT2 7477 107448276
BCT3 296 114226177
BCT4 27804 103087836
BCT5 31796 95734476
BCT6 48031 92949745
BCT7 20225 114423516
BCT8 6512 94114098
BCT9 2218 107567408
ENV1 96100 71329258
ENV2 93608 78940654
ENV3 10271 7181748
EST1 68272 26345057
EST10 76608 29877691
EST100 73482 36739019
EST101 72333 45486886
EST102 72370 45784991
EST103 70215 43318501
EST104 73104 33244405
EST105 69753 29572505
EST106 67546 38050114
EST107 68388 36450709
EST108 68581 41938268
EST109 72852 36488048
EST11 75489 28839244
EST110 75340 34709200
EST111 74883 27324314
EST112 73921 35662615
EST113 74681 34871226
EST114 64725 37593349
EST115 80911 44685897
EST116 77939 43924188
EST117 68592 47110350
EST118 67858 40680304
EST119 74695 50663189
EST12 77657 30904890
EST120 69406 41800452
EST121 75509 45002368
EST122 73889 46050242
EST123 71838 49345202
EST124 72771 48261256
EST125 78867 43107435
EST126 76163 31080052
EST127 79122 36835388
EST128 78141 44668650
EST129 75954 45666574
EST13 77681 29353177
EST130 62802 30938498
EST131 71389 37870457
EST132 68956 39589906
EST133 65658 36476674
EST134 72120 42549179
EST135 72202 45732031
EST136 68498 39813897
EST137 72362 39344519
EST138 70463 43848606
EST139 65670 39908212
EST14 79367 32313201
EST140 70093 39251368
EST141 99506 54024292
EST142 73218 41637498
EST143 96980 50730410
EST144 109611 57987759
EST145 102336 56432127
EST146 88872 52080454
EST147 84262 48643900
EST148 95008 56782099
EST149 98547 60013054
EST15 74083 31332890
EST150 81869 45575855
EST151 69570 39905328
EST152 66126 31227997
EST153 61938 28234545
EST154 56701 27164279
EST155 63208 31228508
EST156 54681 27527557
EST157 79244 52278698
EST158 68393 38132570
EST159 72301 52456970
EST16 75674 33292874
EST160 72841 41514758
EST161 60755 30534464
EST162 64537 38158451
EST163 66462 33102931
EST164 63482 45941176
EST165 64408 37031988
EST166 102154 45057000
EST167 87371 51851216
EST168 102211 59219620
EST169 105247 58428962
EST17 83306 34219503
EST170 90064 48175451
EST171 90334 36927329
EST172 94852 49348432
EST173 89790 38887811
EST174 94266 41027574
EST175 73752 37641853
EST176 67904 45029742
EST177 65992 37850639
EST178 64837 42557754
EST179 68196 31243160
EST18 80517 32335336
EST180 76240 31167578
EST181 70220 44436585
EST182 82867 41270951
EST183 61617 31975647
EST184 68677 48202924
EST185 70297 46346140
EST186 67767 36797984
EST187 67425 44752447
EST188 70611 54570792
EST189 69416 33344494
EST19 79349 32658101
EST190 72269 40666848
EST191 69959 59612763
EST192 66709 50282796
EST193 64627 46993548
EST194 64130 47553918
EST195 66054 46139862
EST196 65724 47456965
EST197 64139 47327645
EST198 62052 37605503
EST199 64201 34079405
EST2 74829 28715325
EST20 74072 29916822
EST200 63214 36961696
EST201 84928 47799297
EST202 83993 54824860
EST203 73005 43000583
EST204 106333 66540228
EST205 108539 65400670
EST206 108944 64430350
EST207 103347 66865519
EST208 107292 58859349
EST209 102893 54330222
EST21 73753 34240766
EST210 93969 50632733
EST211 97650 45116316
EST212 81876 49957188
EST213 68186 36850610
EST214 69862 53225673
EST215 68450 59133410
EST216 76299 47097281
EST217 81954 41054359
EST218 76219 52145035
EST219 71494 50820418
EST22 75977 30474854
EST220 59550 34494414
EST221 27785 10501180
EST222 27846 10384667
EST223 26671 9825929
EST224 26883 9373299
EST225 27070 9264570
EST226 27185 10213193
EST227 27180 9697030
EST228 27237 10166020
EST229 27198 11657579
EST23 77634 32429367
EST230 27196 11382221
EST231 27251 10491047
EST232 27542 9514867
EST233 27005 8993118
EST234 27518 11142541
EST235 27899 10759069
EST236 27399 11083113
EST237 26635 11766191
EST238 26890 11692977
EST239 27104 10663216
EST24 76038 34156616
EST240 26962 11482799
EST241 27115 11714749
EST242 27240 11281497
EST243 27270 10781508
EST244 27227 10756065
EST245 27181 10575387
EST246 25617 15803108
EST247 25098 16574968
EST248 30166 18313330
EST249 102617 35675031
EST25 72331 30679012
EST250 80804 41237475
EST251 68821 44378018
EST252 69202 44914042
EST253 69104 44290349
EST254 64525 40213065
EST255 80505 44459494
EST256 62059 42915329
EST257 68883 42865448
EST258 60979 30687187
EST259 102130 47834596
EST26 76029 31571940
EST260 84522 44043906
EST261 72316 38833755
EST262 64270 31049427
EST263 68112 40627938
EST264 71961 34940383
EST265 71398 33631566
EST266 74598 45952844
EST267 65028 36287078
EST268 67681 39389652
EST269 76422 37441693
EST27 76811 33254044
EST270 82388 45539203
EST271 74062 49212768
EST272 77817 53418244
EST273 100101 49815164
EST274 94243 45235524
EST275 77149 43656991
EST276 70290 46372559
EST277 75691 33431810
EST278 70176 31133244
EST279 72248 37119514
EST28 109249 52808593
EST280 64442 38110879
EST281 59642 38233217
EST282 73805 43573740
EST283 62652 42978759
EST284 61861 34212341
EST285 84183 44064753
EST286 83653 40884601
EST287 71781 46254332
EST288 103705 58458464
EST289 121218 47899356
EST29 97886 46436595
EST290 84036 38752907
EST291 65591 35518288
EST292 71717 45567248
EST293 80916 41107814
EST294 70921 42100892
EST295 70535 40855204
EST296 63716 35603238
EST297 61433 37276636
EST298 53194 30002297
EST299 71817 52022171
EST3 73902 29987952
EST30 94496 53110970
EST300 74468 44277659
EST301 71179 41694228
EST302 68623 36221789
EST303 76543 46978680
EST304 76422 34320079
EST305 74643 32477226
EST306 77397 33127039
EST307 81311 38479909
EST308 87955 60769425
EST309 74336 54600673
EST31 78219 40902226
EST310 75372 44702548
EST311 77625 41908706
EST312 65924 54837173
EST313 63669 47907487
EST314 64828 43728229
EST315 59067 31236353
EST316 75180 52310449
EST317 52673 30450090
EST318 53067 26210890
EST319 68261 37355699
EST32 67884 57845231
EST320 62809 33701556
EST321 64049 32250862
EST322 62923 40171408
EST323 85645 43637927
EST324 70669 42208545
EST325 68381 44109732
EST326 67587 37753007
EST327 65254 42767628
EST328 87752 50093408
EST329 84872 50429293
EST33 77656 51013803
EST330 78047 42438661
EST331 63167 37214850
EST332 65043 33507883
EST333 73609 40654843
EST334 47159 24158922
EST335 67389 38239605
EST336 71180 42805380
EST337 98795 46111726
EST338 74216 47934671
EST339 74581 48903491
EST34 91671 47084784
EST340 70344 45175414
EST341 63828 34704127
EST342 85074 37468733
EST343 71583 40210787
EST344 52779 37351855
EST345 62887 37901871
EST346 63619 41827219
EST347 100942 55425180
EST348 73990 40505293
EST349 77518 47919673
EST35 85567 44729458
EST350 67528 35149106
EST351 43630 26862325
EST352 50080 27557143
EST353 82020 53270524
EST354 82183 42982145
EST355 76051 44783991
EST356 70623 39568607
EST357 64185 40075895
EST358 69069 40403659
EST359 65141 38217465
EST36 90835 54876020
EST360 66880 33198786
EST361 79986 25691355
EST362 75184 40440938
EST363 67677 40005367
EST364 65307 32745150
EST365 75765 47035504
EST366 73144 49012551
EST367 66931 42276721
EST368 75209 45509508
EST369 59267 32990400
EST37 99136 45991857
EST370 67047 42403328
EST371 80077 50673874
EST372 85760 49452176
EST373 66020 40366226
EST374 58848 41207843
EST375 57177 40642470
EST376 57048 40782079
EST377 71446 43367101
EST378 62349 37093324
EST379 58870 37583797
EST38 95884 49686960
EST380 61930 39916206
EST381 57771 41071686
EST382 60601 41546076
EST383 57138 41490004
EST384 48033 32845670
EST385 93241 40390670
EST386 71326 39485972
EST387 71552 39066612
EST388 71348 39815783
EST389 71422 39214677
EST39 105432 47510694
EST390 71173 39898625
EST391 71040 39374155
EST392 70641 39383307
EST393 70520 39889458
EST394 70694 39558437
EST395 68729 38941821
EST396 70835 38767634
EST397 71140 40215911
EST398 71154 39499972
EST399 71107 38719747
EST4 74688 28363417
EST40 75239 25871701
EST400 71524 39319068
EST401 71349 39513048
EST402 70919 39498366
EST403 52272 40369343
EST404 59772 45123873
EST405 74067 40853349
EST406 53558 32413182
EST407 114601 58016270
EST408 83481 51559713
EST409 84733 56465818
EST41 68773 18332736
EST410 51287 32934534
EST411 49307 42168179
EST412 46667 58995840
EST413 68563 55845208
EST414 62506 37996048
EST415 71174 43755570
EST416 66577 41617694
EST417 69927 43291038
EST418 60513 52598374
EST419 64506 40943173
EST42 77634 22144086
EST420 55264 37814260
EST421 57526 41113383
EST422 59095 39150255
EST423 65929 51328037
EST424 63660 45503205
EST425 58398 40360832
EST426 51631 38562751
EST427 57639 39384336
EST428 57350 39933576
EST429 67472 37809256
EST43 46664 13354812
EST430 63444 43625432
EST431 57010 38290053
EST432 59137 42962355
EST433 58432 45675847
EST434 64477 45420997
EST435 50362 39860457
EST436 58822 41343864
EST437 52256 35467507
EST438 57958 40217173
EST439 57610 38453262
EST44 43620 11830225
EST440 73005 44824861
EST441 69908 59338715
EST442 69387 49683292
EST443 73198 51827851
EST444 46284 58267226
EST445 56904 49736015
EST446 66152 45641558
EST447 65191 40793210
EST448 77392 46273934
EST449 82501 53664845
EST45 43252 12134418
EST450 83666 51177449
EST451 63713 42185573
EST452 65853 43861200
EST453 81315 53459399
EST454 78982 61610883
EST455 70657 47248524
EST456 72729 51779328
EST457 68702 36432070
EST458 71644 25690088
EST459 72437 27062516
EST46 43232 11278737
EST460 73702 26232950
EST461 72341 26199933
EST462 77566 26117895
EST463 71633 29018293
EST464 69477 26136550
EST47 92858 40566912
EST48 95002 43811492
EST49 91747 47463127
EST5 48411 15354346
EST50 84561 39177009
EST51 107248 56805843
EST52 93924 45345491
EST53 75471 31964465
EST54 68796 30469295
EST55 71134 30902179
EST56 72224 30175231
EST57 83011 33618036
EST58 74386 28851109
EST59 64024 27774534
EST6 55463 17768277
EST60 71162 30950175
EST61 76724 36370113
EST62 72978 31853863
EST63 75506 27401994
EST64 79233 30255428
EST65 74223 32878516
EST66 40510 11549921
EST67 40346 11346822
EST68 40519 12712691
EST69 40763 12330501
EST7 74724 29408352
EST70 40868 12591207
EST71 40683 12964287
EST72 40619 12533326
EST73 40364 12160216
EST74 40258 12333268
EST75 41210 12227654
EST76 41162 12418277
EST77 41082 13059918
EST78 40930 12954248
EST79 43558 12403916
EST8 76223 30692191
EST80 46011 21970531
EST81 42296 24596775
EST82 43050 17848913
EST83 50224 22788732
EST84 50923 21064817
EST85 51014 22041756
EST86 82098 45858705
EST87 72743 27434329
EST88 74607 29391993
EST89 74819 40754179
EST9 77666 29936459
EST90 77835 40901436
EST91 77074 44135310
EST92 75245 35029578
EST93 75424 43078568
EST94 71020 36516655
EST95 74712 36763311
EST96 73209 40753593
EST97 74572 39354268
EST98 70727 39887423
EST99 68798 36921061
GSS1 90815 38834663
GSS10 75203 43827189
GSS100 75097 41360065
GSS101 74011 44077617
GSS102 73453 45482645
GSS103 73586 45146820
GSS104 73280 44990547
GSS105 73569 44051965
GSS106 78689 51613017
GSS107 85847 58043070
GSS108 81608 54440761
GSS109 82722 51681022
GSS11 70001 35690271
GSS110 87320 51684566
GSS111 79132 64666251
GSS112 84415 47755395
GSS113 94317 53662068
GSS114 78234 49174549
GSS115 83454 57173140
GSS116 85858 67688438
GSS117 74471 37418347
GSS118 81518 57287844
GSS119 93922 51631799
GSS12 73486 38640542
GSS120 86157 54738297
GSS121 85348 54173763
GSS122 84882 52968696
GSS123 76753 69554863
GSS124 76615 68364264
GSS125 79737 58748423
GSS126 78431 54495301
GSS127 78811 54475498
GSS128 79495 53457800
GSS129 78353 55223456
GSS13 76788 38737192
GSS130 80636 55110382
GSS131 85135 58507941
GSS132 41546 24211501
GSS133 87159 64705276
GSS134 83935 63021989
GSS135 101264 46857353
GSS136 68820 58611305
GSS137 68297 58744118
GSS138 69349 56613345
GSS139 69622 56082101
GSS14 71339 32038748
GSS140 70275 55423182
GSS141 85756 73227682
GSS142 85363 40231217
GSS143 71321 48764564
GSS144 109544 71260820
GSS145 85329 35937976
GSS146 91089 68083070
GSS147 73401 61030292
GSS148 70211 59202630
GSS149 66279 63207327
GSS15 70629 35225433
GSS150 74013 55848041
GSS151 120676 73154340
GSS152 118206 75695230
GSS153 104450 58972150
GSS154 88387 56126399
GSS155 93591 57404650
GSS156 106004 76932364
GSS157 108240 77633934
GSS158 106364 79712143
GSS159 105408 80736341
GSS16 77875 45870001
GSS160 91682 53766271
GSS161 90309 49809426
GSS162 79774 60053697
GSS163 106403 52903831
GSS164 31056 13805942
GSS17 70876 33350089
GSS18 58444 27834159
GSS19 56829 28974747
GSS2 89365 39527628
GSS20 57703 26616142
GSS21 61767 30355219
GSS22 64720 36908304
GSS23 57519 27108088
GSS24 67000 42438433
GSS25 67400 27855882
GSS26 58134 25469787
GSS27 66131 32318178
GSS28 64623 32377424
GSS29 79025 40128727
GSS3 87680 41929125
GSS30 82235 39870991
GSS31 74217 40362139
GSS32 70487 48483310
GSS33 79983 37653673
GSS34 75905 40291382
GSS35 74340 39417502
GSS36 87708 57647887
GSS37 87595 58177014
GSS38 85646 44903219
GSS39 85927 49630884
GSS4 79245 41177405
GSS40 87203 38956504
GSS41 82797 33814766
GSS42 81263 56907754
GSS43 79662 57693256
GSS44 72039 47484885
GSS45 72042 47419069
GSS46 77811 45501098
GSS47 78031 39332517
GSS48 83544 58272574
GSS49 86679 65820113
GSS5 79026 40721861
GSS50 82534 53583853
GSS51 93568 59637908
GSS52 88623 59010729
GSS53 75459 40364933
GSS54 74238 42424806
GSS55 86017 45654714
GSS56 88489 59152817
GSS57 76413 66811866
GSS58 72041 79217805
GSS59 88117 68596327
GSS6 78265 38902627
GSS60 87106 58023122
GSS61 63520 45303983
GSS62 69101 47565338
GSS63 89659 67263122
GSS64 86192 58170269
GSS65 87488 53899015
GSS66 87677 56809346
GSS67 97041 58012120
GSS68 100578 54572655
GSS69 100680 54443147
GSS7 77553 39404543
GSS70 101377 53560637
GSS71 102335 52344159
GSS72 102431 52222098
GSS73 102691 51891752
GSS74 102093 52651176
GSS75 98478 57266115
GSS76 90183 69696654
GSS77 89830 70785947
GSS78 88057 69611747
GSS79 87828 69672392
GSS8 76296 38105941
GSS80 89179 63409425
GSS81 80855 23963909
GSS82 77803 24487121
GSS83 87900 36287620
GSS84 84105 50245988
GSS85 80788 48954331
GSS86 89491 64547217
GSS87 78800 61945205
GSS88 78040 79495154
GSS89 76521 56256083
GSS9 72530 37270623
GSS90 94925 50985367
GSS91 76076 41193978
GSS92 85960 49622536
GSS93 69325 61701475
GSS94 85905 51766863
GSS95 82249 61153026
GSS96 85398 56126189
GSS97 82860 57409506
GSS98 90543 53378702
GSS99 80612 68811602
HTC1 31500 54333090
HTC10 13742 22639945
HTC2 28724 63888728
HTC3 17511 41047686
HTC4 16141 39813846
HTC5 40806 30691362
HTC6 68180 60336501
HTC7 79358 67445864
HTC8 67882 59739592
HTC9 63966 86882370
HTG1 1315 188873586
HTG10 1241 186655188
HTG11 1430 184186755
HTG12 876 191942874
HTG13 751 192581971
HTG14 741 192177383
HTG15 776 192310755
HTG16 803 192258670
HTG17 764 192565245
HTG18 2026 171661543
HTG19 1047 188018220
HTG2 2563 186100623
HTG20 1025 188850494
HTG21 775 192061902
HTG22 926 190515050
HTG23 878 190943046
HTG24 826 191129879
HTG25 772 192213127
HTG26 846 191454508
HTG27 852 191658232
HTG28 979 189575716
HTG29 909 190996110
HTG3 2453 185415926
HTG30 923 190509388
HTG31 877 191462035
HTG32 972 189663633
HTG33 870 191253555
HTG34 845 191603185
HTG35 835 191930960
HTG36 875 191186535
HTG37 978 190243776
HTG38 923 190693462
HTG39 996 190009121
HTG4 2524 188411486
HTG40 1158 187745376
HTG41 1227 187428628
HTG42 1261 188048137
HTG43 1147 187519437
HTG44 1103 190870586
HTG45 1214 190856016
HTG46 1239 191122603
HTG47 1164 191588556
HTG48 1092 191211261
HTG49 1040 190455526
HTG5 1281 185748619
HTG50 986 189540954
HTG51 1014 189655214
HTG52 952 189598511
HTG53 1059 189688650
HTG54 961 189980376
HTG55 994 189426796
HTG56 951 189079261
HTG57 1569 185625214
HTG58 1770 185205537
HTG59 1529 183625946
HTG6 1274 185374425
HTG60 2027 183806904
HTG61 2084 183060303
HTG62 1185 192243797
HTG63 1168 190734813
HTG64 1484 188924883
HTG65 1045 193930736
HTG66 1025 193974604
HTG67 1002 193714372
HTG68 909 182694787
HTG69 644 110520336
HTG7 1247 185472319
HTG8 1287 185088399
HTG9 1182 187153099
INV1 17762 161080728
INV2 1624 166901490
INV3 33413 116128677
INV4 78317 74508915
INV5 74670 73820555
INV6 58635 89937494
INV7 50844 99740374
INV8 13615 43460831
MAM1 52488 115017765
MAM2 33906 53225552
PAT1 222669 70172534
PAT10 140467 56018524
PAT11 102696 62154827
PAT12 111689 51361107
PAT13 146606 54653138
PAT14 153386 75551630
PAT15 104813 117875235
PAT16 142210 91826277
PAT17 111971 109364513
PAT18 125865 93490493
PAT19 82814 23628836
PAT2 194385 84711939
PAT3 172019 95882664
PAT4 153753 106055882
PAT5 153745 92495265
PAT6 146783 86027426
PAT7 113978 113621441
PAT8 133783 96905873
PAT9 130284 94221740
PHG 2812 17755472
PLN1 36662 119344805
PLN10 3186 174302807
PLN11 60657 63376943
PLN12 77264 78287499
PLN13 76039 79320396
PLN14 34146 116681070
PLN15 53005 99888017
PLN16 36856 113940968
PLN17 7264 13812970
PLN2 1377 175638183
PLN3 2678 166725027
PLN4 77145 78910138
PLN5 72880 69075734
PLN6 30494 52662016
PLN7 7906 152012572
PLN8 1575 207124589
PLN9 6 197759100
PRI1 21425 141150682
PRI10 1442 181514499
PRI11 1297 178964356
PRI12 1532 178200257
PRI13 1610 179647185
PRI14 1484 186407172
PRI15 17367 162746389
PRI16 43916 104726314
PRI17 22068 123533182
PRI18 1630 183464671
PRI19 1706 183537515
PRI2 1464 173041335
PRI20 2050 182481731
PRI21 2168 181559087
PRI22 15671 155132932
PRI23 53263 84315595
PRI24 31155 79712658
PRI25 5995 180571477
PRI26 21862 148798038
PRI27 50871 117804773
PRI28 37284 129052657
PRI29 28916 43027777
PRI3 1278 186256268
PRI4 1329 184239148
PRI5 1193 181228346
PRI6 1205 179199796
PRI7 1232 180205602
PRI8 1368 174688572
PRI9 1229 177773829
ROD1 9162 169560212
ROD10 978 182428889
ROD11 1016 187269376
ROD12 976 183805291
ROD13 1012 184682982
ROD14 955 182453468
ROD15 964 182555346
ROD16 6746 177642531
ROD17 22214 152826232
ROD18 1201 191364555
ROD19 1234 193893869
ROD2 925 174150862
ROD20 28286 141852055
ROD21 29609 77386875
ROD22 21290 157009936
ROD23 27098 33945103
ROD3 901 174176248
ROD4 906 174280563
ROD5 928 174016482
ROD6 981 181262085
ROD7 975 180093515
ROD8 984 181524905
ROD9 1018 183668708
STS1 82030 35188895
STS10 58191 44485563
STS11 58022 43669473
STS12 75307 38356946
STS13 87751 39064327
STS14 11935 4746633
STS2 84061 44752685
STS3 76460 30868762
STS4 66822 33901612
STS5 54867 31982409
STS6 54730 32222123
STS7 54692 32191782
STS8 56390 38743125
STS9 58081 44559565
SYN 23382 32944865
UNA 205 111605
VRL1 72334 65685832
VRL2 72349 65087207
VRL3 70407 70266210
VRL4 71413 66331336
VRL5 39265 37876436
VRT1 52706 113207473
VRT10 30540 28157263
VRT2 23701 154593115
VRT3 66460 91575303
VRT4 47644 65419796
VRT5 5113 179623036
VRT6 1291 193212946
VRT7 1336 192958549
VRT8 17119 168960985
VRT9 17642 168584689
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 151.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
9899176 11953879540 Homo sapiens
6625240 7917536708 Mus musculus
1035223 5682651636 Rattus norvegicus
1356047 2424040780 Bos taurus
881280 2215171371 Danio rerio
2678230 1780527217 Zea mays
357923 1171720224 Oryza sativa (japonica cultivar-group)
1179107 954916818 Xenopus tropicalis
1409440 805877955 Canis familiaris
534811 785832602 Drosophila melanogaster
1120673 785475842 Sus scrofa
787971 684548519 Gallus gallus
981930 648235477 Arabidopsis thaliana
207825 533669351 Pan troglodytes
784734 463997658 Sorghum bicolor
68350 434454818 Macaca mulatta
695995 420688666 Ciona intestinalis
387953 420276295 Medicago truncatula
596255 404132383 Brassica oleracea
612712 349010415 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 December 2005
NCBI-GenBank Flat File Release 151.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson D.A., Karsch-Mizrachi I., Lipman D.J., Ostell J., Rapp B.A.,
Wheeler D.L. GenBank. Nucl. Acids Res. 28(1):15-18 (2000)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al. Nucl. Acids Res. 28(1):15-18 (2000)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 151.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Christina Couldrey, Irene Fang, Linda Frisse, Michael Fetchko,
Anjanette Johnston, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
