Release Notes For GenBank Release 152
GBREL.TXT Genetic Sequence Data Bank
February 15 2006
NCBI-GenBank Flat File Release 152.0
Distribution Release Notes
54584635 loci, 59750386305 bases, from 54584635 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource from which those other
efforts draw. For information about TPA and RefSeq, please refer to:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 152.0
1.2 Cutoff Date
1.3 Important Changes in Release 152.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 152.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 152.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 152.0, incorporates data available to the collaborating
databases as of February 13, 2006 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 152.0
1.3.1 Problems generating index files
The 'index' files which accompany GenBank releases (see Section 3.3) are
considered to be largely a legacy data product by NCBI, generated mainly for
historical reasons. FTP statistics since January 2005 seem to support this:
the index files are transferred only half as frequently as the files of
sequence records. The inherent inefficiency of the index file format also
leads us to suspect that they have little serious use by the user community,
particularly for EST and GSS records.
As a result, the software that generates the index file products has received
little attention over the years, and has finally reached its limitations.
The required multi-server queries which obtain and sort many millions of
rows of terms from several different databases, with ever-growing RAM
requirements, have simply outgrown the capacity of the hardware used for
GenBank Release generation.
Our short-term solution will be to cease generating index-file content
for EST and (most) GSS sequence records. We were able to do this for the author
name index, so GenBank 152.0 contains six gbaut*.idx files (down from what
would have been 34).
In addition, a version of gbacc.idx was built manually (but note that the
first field contains just an accession number, rather than Accession.Version).
The other four index files ( gbgen.idx, gbkey.idx, gbjou.idx, and gbsec.idx)
are absent from this release. We hope to be able to provide them for
GenBank 153.0, in a manner similar to the author index files (no EST or GSS
content).
But even when we reach that point, this solution is likely to be only a
stop-gap, and we will probably pursue one of two options within the next
year:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types index data.
If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that this ongoing problem may cause.
1.3.2 Organizational changes
The total number of sequence data files increased by 41 with this release:
- the EST division is now comprised of 487 files (+23)
- the GSS division is now comprised of 172 files (+8)
- the HTG division is now comprised of 79 files (+10)
- the PAT division is now comprised of 20 files (+1)
The total number of author-name 'index' files decreased by 20 with this
release, and the gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx are
absent for reasons described in Section 1.3.1 .
1.3.3 New Linetype for Genome Project Identifier
DDBJ, EMBL, and GenBank are working to create a collaborative system that
will assign a unique numeric identifier to genome projects. The purpose of
this new identifier is to provide a link among sequence records that pertain
to a specific genome sequencing project.
At GenBank, this new identifier will be presented in the flatfile format
via a new linetype : PROJECT . With GenBank 152.0, this new linetype is now
legal (though still unimplemented). Here is a mocked-up example demonstrating
the new linetype's use:
LOCUS CH476840 1669278 bp DNA linear CON 05-OCT-2005
DEFINITION Magnaporthe grisea 70-15 supercont5.200 genomic scaffold, whole
genome shotgun sequence.
ACCESSION CH476840 AACU02000000
VERSION CH476840.1 GI:77022292
PROJECT GenomeProject:12345
The integer 12345 represents the value of a possible genome project
identifier.
These Genome Project identifiers will be searchable within NCBI's
Entrez: Genome-Project database:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
thirty-two of the GSS flatfiles in Release 152.0. Consider gbgss141.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2006
NCBI-GenBank Flat File Release 152.0
GSS Sequences (Part 1)
87168 loci, 64691174 bases, from 87168 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "141" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New JOURNAL token for Pre-Grant Patent Publications
Sequences associated with granted patents from the US Patent and
Trademark Office (USPTO) typically have references that look like this:
REFERENCE 1 (bases 1 to 22)
AUTHORS Stewart,L.J.
TITLE Screening methods for identifying ligands
JOURNAL Patent: US 6950757-A 2 27-SEP-2005;
The "Patent:" token indicates that the JOURNAL line pertains to a
patent document, as opposed to a published article in the scientific
literature.
But sequence data can be available well in advance of the point at which
an actual patent has been granted. As of GenBank Release 153 in June 2006,
we will indicate that a patent sequence is associated with a "Pre-Grant
Publication" via a slight change to the JOURNAL line:
REFERENCE 1 (bases 1 to 190)
AUTHORS Xu,M. and Humphreys,R.
TITLE Inhibition of li expression in mammalian cells
JOURNAL Pre-Grant Patent: US 20060008448A1 1 12-JAN-2006;
^^^^^^^^^^^^^^^^^
The introduction of "Pre-Grant Patent:" at the start of the JOURNAL
line will distinguish sequences associated with these two different
states in USPTO's patenting process.
Note that pre-grant identifiers from the USPTO are alphanumeric, and
lack a document-type suffix ("-A" in the granted-patent example above).
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 908 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut2.idx - Index of the entries according to accession number, part 2.
4. gbaut3.idx - Index of the entries according to accession number, part 3.
5. gbaut4.idx - Index of the entries according to accession number, part 4.
6. gbaut5.idx - Index of the entries according to accession number, part 5.
7. gbaut6.idx - Index of the entries according to accession number, part 6.
8. gbbct1.seq - Bacterial sequence entries, part 1.
9. gbbct10.seq - Bacterial sequence entries, part 10.
10. gbbct11.seq - Bacterial sequence entries, part 11.
11. gbbct12.seq - Bacterial sequence entries, part 12.
12. gbbct13.seq - Bacterial sequence entries, part 13.
13. gbbct2.seq - Bacterial sequence entries, part 2.
14. gbbct3.seq - Bacterial sequence entries, part 3.
15. gbbct4.seq - Bacterial sequence entries, part 4.
16. gbbct5.seq - Bacterial sequence entries, part 5.
17. gbbct6.seq - Bacterial sequence entries, part 6.
18. gbbct7.seq - Bacterial sequence entries, part 7.
19. gbbct8.seq - Bacterial sequence entries, part 8.
20. gbbct9.seq - Bacterial sequence entries, part 9.
21. gbchg.txt - Accession numbers of entries updated since the previous release.
22. gbcon.seq - Constructed sequence entries.
23. gbdel.txt - Accession numbers of entries deleted since the previous release.
24. gbenv1.seq - Environmental sampling sequence entries, part 1.
25. gbenv2.seq - Environmental sampling sequence entries, part 2.
26. gbenv3.seq - Environmental sampling sequence entries, part 3.
27. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
28. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
29. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
30. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
31. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
32. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
33. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
34. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
35. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
36. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
37. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
38. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
39. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
40. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
41. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
42. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
43. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
44. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
45. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
46. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
47. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
48. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
49. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
50. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
51. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
52. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
53. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
54. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
55. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
56. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
57. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
58. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
59. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
60. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
61. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
62. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
63. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
64. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
65. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
66. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
67. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
68. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
69. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
70. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
71. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
72. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
73. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
74. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
75. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
76. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
77. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
78. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
79. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
80. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
81. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
82. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
83. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
84. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
85. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
86. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
87. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
88. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
89. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
90. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
91. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
92. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
93. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
94. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
95. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
96. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
97. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
98. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
99. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
100. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
101. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
102. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
103. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
104. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
105. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
106. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
107. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
108. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
109. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
110. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
111. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
112. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
113. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
114. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
115. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
116. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
117. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
118. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
119. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
120. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
121. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
122. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
123. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
124. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
125. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
126. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
127. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
128. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
129. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
130. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
131. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
132. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
133. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
134. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
135. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
136. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
137. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
138. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
139. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
140. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
141. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
142. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
143. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
144. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
145. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
146. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
147. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
148. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
149. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
150. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
151. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
152. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
153. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
154. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
155. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
156. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
157. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
158. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
159. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
160. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
161. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
162. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
163. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
164. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
165. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
166. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
167. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
168. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
169. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
170. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
171. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
172. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
173. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
174. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
175. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
176. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
177. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
178. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
179. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
180. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
181. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
182. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
183. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
184. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
185. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
186. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
187. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
188. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
189. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
190. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
191. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
192. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
193. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
194. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
195. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
196. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
197. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
198. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
199. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
200. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
201. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
202. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
203. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
204. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
205. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
206. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
207. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
208. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
209. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
210. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
211. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
212. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
213. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
214. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
215. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
216. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
217. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
218. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
219. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
220. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
221. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
222. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
223. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
224. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
225. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
226. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
227. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
228. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
229. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
230. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
231. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
232. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
233. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
234. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
235. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
236. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
237. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
238. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
239. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
240. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
241. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
242. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
243. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
244. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
245. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
246. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
247. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
248. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
249. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
250. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
251. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
252. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
253. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
254. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
255. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
256. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
257. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
258. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
259. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
260. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
261. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
262. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
263. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
264. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
265. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
266. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
267. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
268. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
269. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
270. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
271. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
272. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
273. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
274. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
275. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
276. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
277. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
278. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
279. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
280. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
281. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
282. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
283. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
284. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
285. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
286. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
287. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
288. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
289. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
290. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
291. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
292. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
293. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
294. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
295. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
296. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
297. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
298. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
299. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
300. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
301. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
302. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
303. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
304. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
305. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
306. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
307. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
308. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
309. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
310. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
311. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
312. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
313. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
314. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
315. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
316. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
317. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
318. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
319. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
320. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
321. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
322. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
323. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
324. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
325. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
326. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
327. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
328. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
329. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
330. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
331. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
332. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
333. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
334. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
335. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
336. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
337. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
338. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
339. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
340. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
341. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
342. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
343. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
344. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
345. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
346. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
347. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
348. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
349. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
350. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
351. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
352. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
353. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
354. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
355. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
356. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
357. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
358. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
359. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
360. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
361. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
362. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
363. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
364. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
365. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
366. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
367. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
368. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
369. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
370. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
371. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
372. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
373. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
374. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
375. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
376. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
377. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
378. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
379. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
380. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
381. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
382. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
383. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
384. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
385. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
386. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
387. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
388. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
389. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
390. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
391. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
392. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
393. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
394. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
395. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
396. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
397. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
398. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
399. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
400. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
401. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
402. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
403. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
404. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
405. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
406. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
407. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
408. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
409. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
410. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
411. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
412. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
413. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
414. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
415. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
416. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
417. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
418. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
419. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
420. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
421. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
422. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
423. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
424. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
425. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
426. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
427. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
428. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
429. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
430. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
431. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
432. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
433. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
434. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
435. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
436. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
437. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
438. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
439. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
440. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
441. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
442. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
443. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
444. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
445. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
446. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
447. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
448. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
449. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
450. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
451. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
452. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
453. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
454. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
455. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
456. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
457. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
458. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
459. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
460. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
461. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
462. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
463. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
464. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
465. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
466. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
467. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
468. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
469. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
470. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
471. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
472. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
473. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
474. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
475. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
476. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
477. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
478. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
479. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
480. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
481. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
482. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
483. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
484. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
485. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
486. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
487. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
488. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
489. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
490. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
491. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
492. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
493. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
494. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
495. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
496. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
497. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
498. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
499. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
500. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
501. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
502. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
503. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
504. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
505. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
506. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
507. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
508. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
509. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
510. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
511. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
512. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
513. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
514. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
515. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
516. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
517. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
518. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
519. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
520. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
521. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
522. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
523. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
524. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
525. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
526. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
527. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
528. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
529. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
530. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
531. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
532. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
533. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
534. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
535. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
536. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
537. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
538. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
539. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
540. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
541. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
542. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
543. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
544. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
545. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
546. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
547. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
548. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
549. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
550. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
551. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
552. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
553. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
554. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
555. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
556. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
557. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
558. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
559. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
560. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
561. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
562. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
563. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
564. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
565. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
566. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
567. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
568. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
569. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
570. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
571. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
572. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
573. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
574. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
575. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
576. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
577. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
578. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
579. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
580. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
581. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
582. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
583. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
584. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
585. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
586. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
587. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
588. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
589. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
590. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
591. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
592. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
593. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
594. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
595. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
596. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
597. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
598. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
599. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
600. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
601. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
602. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
603. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
604. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
605. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
606. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
607. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
608. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
609. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
610. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
611. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
612. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
613. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
614. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
615. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
616. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
617. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
618. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
619. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
620. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
621. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
622. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
623. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
624. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
625. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
626. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
627. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
628. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
629. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
630. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
631. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
632. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
633. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
634. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
635. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
636. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
637. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
638. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
639. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
640. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
641. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
642. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
643. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
644. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
645. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
646. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
647. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
648. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
649. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
650. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
651. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
652. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
653. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
654. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
655. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
656. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
657. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
658. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
659. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
660. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
661. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
662. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
663. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
664. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
665. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
666. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
667. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
668. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
669. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
670. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
671. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
672. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
673. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
674. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
675. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
676. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
677. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
678. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
679. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
680. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
681. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
682. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
683. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
684. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
685. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
686. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
687. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
688. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
689. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
690. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
691. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
692. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
693. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
694. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
695. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
696. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
697. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
698. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
699. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
700. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
701. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
702. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
703. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
704. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
705. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
706. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
707. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
708. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
709. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
710. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
711. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
712. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
713. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
714. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
715. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
716. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
717. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
718. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
719. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
720. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
721. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
722. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
723. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
724. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
725. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
726. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
727. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
728. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
729. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
730. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
731. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
732. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
733. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
734. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
735. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
736. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
737. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
738. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
739. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
740. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
741. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
742. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
743. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
744. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
745. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
746. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
747. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
748. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
749. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
750. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
751. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
752. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
753. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
754. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
755. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
756. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
757. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
758. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
759. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
760. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
761. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
762. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
763. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
764. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
765. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
766. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
767. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
768. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
769. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
770. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
771. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
772. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
773. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
774. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
775. gbinv1.seq - Invertebrate sequence entries, part 1.
776. gbinv2.seq - Invertebrate sequence entries, part 2.
777. gbinv3.seq - Invertebrate sequence entries, part 3.
778. gbinv4.seq - Invertebrate sequence entries, part 4.
779. gbinv5.seq - Invertebrate sequence entries, part 5.
780. gbinv6.seq - Invertebrate sequence entries, part 6.
781. gbinv7.seq - Invertebrate sequence entries, part 7.
782. gbinv8.seq - Invertebrate sequence entries, part 8.
783. gbmam1.seq - Other mammalian sequence entries, part 1.
784. gbmam2.seq - Other mammalian sequence entries, part 2.
785. gbnew.txt - Accession numbers of entries new since the previous release.
786. gbpat1.seq - Patent sequence entries, part 1.
787. gbpat10.seq - Patent sequence entries, part 10.
788. gbpat11.seq - Patent sequence entries, part 11.
789. gbpat12.seq - Patent sequence entries, part 12.
790. gbpat13.seq - Patent sequence entries, part 13.
791. gbpat14.seq - Patent sequence entries, part 14.
792. gbpat15.seq - Patent sequence entries, part 15.
793. gbpat16.seq - Patent sequence entries, part 16.
794. gbpat17.seq - Patent sequence entries, part 17.
795. gbpat18.seq - Patent sequence entries, part 18.
796. gbpat19.seq - Patent sequence entries, part 19.
797. gbpat2.seq - Patent sequence entries, part 2.
798. gbpat20.seq - Patent sequence entries, part 20.
799. gbpat3.seq - Patent sequence entries, part 3.
800. gbpat4.seq - Patent sequence entries, part 4.
801. gbpat5.seq - Patent sequence entries, part 5.
802. gbpat6.seq - Patent sequence entries, part 6.
803. gbpat7.seq - Patent sequence entries, part 7.
804. gbpat8.seq - Patent sequence entries, part 8.
805. gbpat9.seq - Patent sequence entries, part 9.
806. gbphg.seq - Phage sequence entries.
807. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
808. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
809. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
810. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
811. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
812. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
813. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
814. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
815. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
816. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
817. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
818. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
819. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
820. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
821. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
822. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
823. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
824. gbpri1.seq - Primate sequence entries, part 1.
825. gbpri10.seq - Primate sequence entries, part 10.
826. gbpri11.seq - Primate sequence entries, part 11.
827. gbpri12.seq - Primate sequence entries, part 12.
828. gbpri13.seq - Primate sequence entries, part 13.
829. gbpri14.seq - Primate sequence entries, part 14.
830. gbpri15.seq - Primate sequence entries, part 15.
831. gbpri16.seq - Primate sequence entries, part 16.
832. gbpri17.seq - Primate sequence entries, part 17.
833. gbpri18.seq - Primate sequence entries, part 18.
834. gbpri19.seq - Primate sequence entries, part 19.
835. gbpri2.seq - Primate sequence entries, part 2.
836. gbpri20.seq - Primate sequence entries, part 20.
837. gbpri21.seq - Primate sequence entries, part 21.
838. gbpri22.seq - Primate sequence entries, part 22.
839. gbpri23.seq - Primate sequence entries, part 23.
840. gbpri24.seq - Primate sequence entries, part 24.
841. gbpri25.seq - Primate sequence entries, part 25.
842. gbpri26.seq - Primate sequence entries, part 26.
843. gbpri27.seq - Primate sequence entries, part 27.
844. gbpri28.seq - Primate sequence entries, part 28.
845. gbpri29.seq - Primate sequence entries, part 29.
846. gbpri3.seq - Primate sequence entries, part 3.
847. gbpri4.seq - Primate sequence entries, part 4.
848. gbpri5.seq - Primate sequence entries, part 5.
849. gbpri6.seq - Primate sequence entries, part 6.
850. gbpri7.seq - Primate sequence entries, part 7.
851. gbpri8.seq - Primate sequence entries, part 8.
852. gbpri9.seq - Primate sequence entries, part 9.
853. gbrel.txt - Release notes (this document).
854. gbrod1.seq - Rodent sequence entries, part 1.
855. gbrod10.seq - Rodent sequence entries, part 10.
856. gbrod11.seq - Rodent sequence entries, part 11.
857. gbrod12.seq - Rodent sequence entries, part 12.
858. gbrod13.seq - Rodent sequence entries, part 13.
859. gbrod14.seq - Rodent sequence entries, part 14.
860. gbrod15.seq - Rodent sequence entries, part 15.
861. gbrod16.seq - Rodent sequence entries, part 16.
862. gbrod17.seq - Rodent sequence entries, part 17.
863. gbrod18.seq - Rodent sequence entries, part 18.
864. gbrod19.seq - Rodent sequence entries, part 19.
865. gbrod2.seq - Rodent sequence entries, part 2.
866. gbrod20.seq - Rodent sequence entries, part 20.
867. gbrod21.seq - Rodent sequence entries, part 21.
868. gbrod22.seq - Rodent sequence entries, part 22.
869. gbrod23.seq - Rodent sequence entries, part 23.
870. gbrod3.seq - Rodent sequence entries, part 3.
871. gbrod4.seq - Rodent sequence entries, part 4.
872. gbrod5.seq - Rodent sequence entries, part 5.
873. gbrod6.seq - Rodent sequence entries, part 6.
874. gbrod7.seq - Rodent sequence entries, part 7.
875. gbrod8.seq - Rodent sequence entries, part 8.
876. gbrod9.seq - Rodent sequence entries, part 9.
877. gbsdr.txt - Short directory of the data bank.
878. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
879. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
880. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
881. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
882. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
883. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
884. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
885. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
886. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
887. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
888. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
889. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
890. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
891. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
892. gbsyn.seq - Synthetic and chimeric sequence entries.
893. gbuna.seq - Unannotated sequence entries.
894. gbvrl1.seq - Viral sequence entries, part 1.
895. gbvrl2.seq - Viral sequence entries, part 2.
896. gbvrl3.seq - Viral sequence entries, part 3.
897. gbvrl4.seq - Viral sequence entries, part 4.
898. gbvrl5.seq - Viral sequence entries, part 5.
899. gbvrt1.seq - Other vertebrate sequence entries, part 1.
900. gbvrt10.seq - Other vertebrate sequence entries, part 10.
901. gbvrt2.seq - Other vertebrate sequence entries, part 2.
902. gbvrt3.seq - Other vertebrate sequence entries, part 3.
903. gbvrt4.seq - Other vertebrate sequence entries, part 4.
904. gbvrt5.seq - Other vertebrate sequence entries, part 5.
905. gbvrt6.seq - Other vertebrate sequence entries, part 6.
906. gbvrt7.seq - Other vertebrate sequence entries, part 7.
907. gbvrt8.seq - Other vertebrate sequence entries, part 8.
908. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 152.0 flatfiles require roughly 207 GB (sequence
files only) or 216 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1684745405 gbacc.idx
500132933 gbaut1.idx
501540178 gbaut2.idx
502656323 gbaut3.idx
515497159 gbaut4.idx
500399949 gbaut5.idx
216671336 gbaut6.idx
250011675 gbbct1.seq
252712499 gbbct10.seq
255703726 gbbct11.seq
250003069 gbbct12.seq
241423487 gbbct13.seq
260048651 gbbct2.seq
256372264 gbbct3.seq
250002952 gbbct4.seq
255369582 gbbct5.seq
250002213 gbbct6.seq
254890469 gbbct7.seq
250942251 gbbct8.seq
255457306 gbbct9.seq
3432605 gbchg.txt
1145193472 gbcon.seq
233481 gbdel.txt
250001900 gbenv1.seq
250000037 gbenv2.seq
65045702 gbenv3.seq
230687890 gbest1.seq
230689203 gbest10.seq
230689698 gbest100.seq
230689540 gbest101.seq
230688696 gbest102.seq
230689055 gbest103.seq
230688085 gbest104.seq
230689666 gbest105.seq
230688052 gbest106.seq
230687493 gbest107.seq
230688254 gbest108.seq
230688549 gbest109.seq
230688357 gbest11.seq
230688125 gbest110.seq
230687797 gbest111.seq
230468574 gbest112.seq
230688232 gbest113.seq
230690544 gbest114.seq
230689388 gbest115.seq
230688453 gbest116.seq
230688580 gbest117.seq
230688166 gbest118.seq
230689486 gbest119.seq
230688106 gbest12.seq
230688514 gbest120.seq
230688056 gbest121.seq
230687793 gbest122.seq
230689878 gbest123.seq
230689969 gbest124.seq
230689959 gbest125.seq
230688210 gbest126.seq
230528361 gbest127.seq
230687615 gbest128.seq
230687799 gbest129.seq
230688651 gbest13.seq
230689632 gbest130.seq
230687618 gbest131.seq
230689762 gbest132.seq
230690723 gbest133.seq
230687926 gbest134.seq
230687859 gbest135.seq
230689604 gbest136.seq
230688000 gbest137.seq
230689986 gbest138.seq
230688094 gbest139.seq
230688910 gbest14.seq
230691517 gbest140.seq
230689222 gbest141.seq
230688085 gbest142.seq
230688985 gbest143.seq
230687600 gbest144.seq
230688542 gbest145.seq
230687863 gbest146.seq
230689379 gbest147.seq
230687830 gbest148.seq
230688405 gbest149.seq
230687522 gbest15.seq
230688403 gbest150.seq
230690533 gbest151.seq
230688890 gbest152.seq
230688298 gbest153.seq
230688180 gbest154.seq
230690133 gbest155.seq
230687656 gbest156.seq
230689804 gbest157.seq
230687529 gbest158.seq
230690294 gbest159.seq
230689693 gbest16.seq
230689131 gbest160.seq
230690840 gbest161.seq
230688496 gbest162.seq
230691165 gbest163.seq
230689247 gbest164.seq
230687682 gbest165.seq
230688350 gbest166.seq
230687686 gbest167.seq
230688438 gbest168.seq
230688896 gbest169.seq
230687454 gbest17.seq
230688249 gbest170.seq
230687655 gbest171.seq
224067829 gbest172.seq
230688956 gbest173.seq
230688185 gbest174.seq
230689226 gbest175.seq
230687824 gbest176.seq
230688918 gbest177.seq
230687480 gbest178.seq
230689074 gbest179.seq
230688259 gbest18.seq
230690453 gbest180.seq
230688661 gbest181.seq
230688154 gbest182.seq
230689277 gbest183.seq
230687854 gbest184.seq
230690025 gbest185.seq
230689634 gbest186.seq
230687683 gbest187.seq
230688441 gbest188.seq
230688803 gbest189.seq
230687460 gbest19.seq
230690832 gbest190.seq
230688864 gbest191.seq
230688840 gbest192.seq
230690839 gbest193.seq
230690118 gbest194.seq
230691025 gbest195.seq
230687835 gbest196.seq
230690879 gbest197.seq
230688998 gbest198.seq
230689024 gbest199.seq
230689426 gbest2.seq
230689764 gbest20.seq
230690334 gbest200.seq
230690744 gbest201.seq
230689024 gbest202.seq
230689445 gbest203.seq
230687934 gbest204.seq
230687662 gbest205.seq
230687604 gbest206.seq
230689301 gbest207.seq
230688599 gbest208.seq
230688456 gbest209.seq
230688262 gbest21.seq
230687849 gbest210.seq
230688712 gbest211.seq
230687812 gbest212.seq
230690534 gbest213.seq
230688125 gbest214.seq
230689124 gbest215.seq
230687567 gbest216.seq
230688164 gbest217.seq
230688169 gbest218.seq
230689140 gbest219.seq
230688270 gbest22.seq
230690020 gbest220.seq
230691583 gbest221.seq
163558974 gbest222.seq
162176855 gbest223.seq
167749529 gbest224.seq
167970395 gbest225.seq
169751797 gbest226.seq
164729113 gbest227.seq
164956871 gbest228.seq
164442137 gbest229.seq
230688836 gbest23.seq
164422216 gbest230.seq
164436498 gbest231.seq
164477022 gbest232.seq
163571059 gbest233.seq
165435633 gbest234.seq
165739699 gbest235.seq
161908573 gbest236.seq
164281653 gbest237.seq
168951484 gbest238.seq
166932137 gbest239.seq
230689093 gbest24.seq
165626516 gbest240.seq
165745163 gbest241.seq
165390499 gbest242.seq
164900743 gbest243.seq
164212944 gbest244.seq
164316295 gbest245.seq
165408759 gbest246.seq
169977948 gbest247.seq
178633847 gbest248.seq
171330316 gbest249.seq
230687792 gbest25.seq
217004344 gbest250.seq
230688599 gbest251.seq
230690096 gbest252.seq
230688350 gbest253.seq
230688290 gbest254.seq
230688964 gbest255.seq
230690743 gbest256.seq
230687720 gbest257.seq
230688693 gbest258.seq
230689051 gbest259.seq
230690376 gbest26.seq
230688387 gbest260.seq
230689808 gbest261.seq
230689759 gbest262.seq
230688007 gbest263.seq
230687741 gbest264.seq
230690519 gbest265.seq
230689577 gbest266.seq
230690362 gbest267.seq
230687514 gbest268.seq
230689021 gbest269.seq
230689451 gbest27.seq
230689265 gbest270.seq
230687658 gbest271.seq
230688618 gbest272.seq
230687533 gbest273.seq
230687629 gbest274.seq
230689072 gbest275.seq
230688266 gbest276.seq
230690528 gbest277.seq
230689317 gbest278.seq
216350061 gbest279.seq
230687804 gbest28.seq
219452850 gbest280.seq
230689831 gbest281.seq
230688546 gbest282.seq
230689349 gbest283.seq
230688417 gbest284.seq
230687971 gbest285.seq
230688756 gbest286.seq
230690201 gbest287.seq
230689427 gbest288.seq
230689488 gbest289.seq
230689053 gbest29.seq
230689152 gbest290.seq
230687860 gbest291.seq
230689639 gbest292.seq
230690660 gbest293.seq
230687884 gbest294.seq
230688199 gbest295.seq
230687678 gbest296.seq
230689715 gbest297.seq
230689054 gbest298.seq
230690078 gbest299.seq
230690269 gbest3.seq
230688247 gbest30.seq
230688396 gbest300.seq
230687975 gbest301.seq
230687466 gbest302.seq
230688884 gbest303.seq
230689914 gbest304.seq
230689398 gbest305.seq
230688187 gbest306.seq
230690547 gbest307.seq
230690677 gbest308.seq
230689317 gbest309.seq
230689710 gbest31.seq
230689051 gbest310.seq
230689463 gbest311.seq
230687514 gbest312.seq
230688509 gbest313.seq
230689549 gbest314.seq
230688244 gbest315.seq
192560294 gbest316.seq
230687600 gbest317.seq
230690358 gbest318.seq
230689705 gbest319.seq
230691172 gbest32.seq
230689080 gbest320.seq
230688033 gbest321.seq
217746835 gbest322.seq
142857555 gbest323.seq
218449833 gbest324.seq
230689930 gbest325.seq
230690344 gbest326.seq
230688618 gbest327.seq
230688263 gbest328.seq
230689094 gbest329.seq
230689877 gbest33.seq
230689449 gbest330.seq
230690023 gbest331.seq
230689223 gbest332.seq
230687731 gbest333.seq
230688819 gbest334.seq
230689138 gbest335.seq
230692010 gbest336.seq
230687744 gbest337.seq
230689226 gbest338.seq
230689142 gbest339.seq
230689475 gbest34.seq
230689795 gbest340.seq
230688088 gbest341.seq
230688585 gbest342.seq
230687762 gbest343.seq
230689516 gbest344.seq
230687687 gbest345.seq
230690392 gbest346.seq
230687703 gbest347.seq
230690705 gbest348.seq
230691528 gbest349.seq
230688685 gbest35.seq
230688262 gbest350.seq
230689067 gbest351.seq
230688191 gbest352.seq
230688540 gbest353.seq
230690664 gbest354.seq
230689608 gbest355.seq
230688596 gbest356.seq
230693040 gbest357.seq
230689602 gbest358.seq
230690351 gbest359.seq
230689389 gbest36.seq
230688189 gbest360.seq
230687669 gbest361.seq
230687995 gbest362.seq
230689569 gbest363.seq
230688040 gbest364.seq
230688700 gbest365.seq
230190975 gbest366.seq
230688378 gbest367.seq
230690071 gbest368.seq
230687938 gbest369.seq
230687693 gbest37.seq
230690527 gbest370.seq
230687870 gbest371.seq
230690365 gbest372.seq
230687870 gbest373.seq
209053584 gbest374.seq
230688776 gbest375.seq
230688414 gbest376.seq
230687653 gbest377.seq
230689413 gbest378.seq
230689767 gbest379.seq
230689112 gbest38.seq
230690440 gbest380.seq
230688952 gbest381.seq
230688941 gbest382.seq
230687445 gbest383.seq
230689406 gbest384.seq
230689061 gbest385.seq
230690230 gbest386.seq
230687658 gbest387.seq
230689948 gbest388.seq
230687804 gbest389.seq
230688227 gbest39.seq
230689832 gbest390.seq
230690027 gbest391.seq
210461602 gbest392.seq
210174040 gbest393.seq
210119491 gbest394.seq
210298616 gbest395.seq
210229056 gbest396.seq
210367799 gbest397.seq
211623870 gbest398.seq
211483569 gbest399.seq
230690637 gbest4.seq
222182469 gbest40.seq
211253962 gbest400.seq
213015575 gbest401.seq
212437523 gbest402.seq
210979603 gbest403.seq
210807612 gbest404.seq
210826063 gbest405.seq
210050118 gbest406.seq
210074005 gbest407.seq
210221237 gbest408.seq
210103221 gbest409.seq
192317273 gbest41.seq
209945168 gbest410.seq
230687685 gbest411.seq
230691351 gbest412.seq
230690550 gbest413.seq
230691043 gbest414.seq
230687553 gbest415.seq
230688671 gbest416.seq
230689813 gbest417.seq
230690525 gbest418.seq
230688743 gbest419.seq
191938096 gbest42.seq
230687592 gbest420.seq
230688547 gbest421.seq
230688207 gbest422.seq
230690609 gbest423.seq
230690371 gbest424.seq
230688851 gbest425.seq
230688718 gbest426.seq
230094803 gbest427.seq
230689301 gbest428.seq
230689528 gbest429.seq
215700740 gbest43.seq
230691225 gbest430.seq
230690466 gbest431.seq
230688288 gbest432.seq
230689538 gbest433.seq
230690006 gbest434.seq
230689345 gbest435.seq
230689347 gbest436.seq
230691122 gbest437.seq
230688189 gbest438.seq
230690132 gbest439.seq
216181920 gbest44.seq
230688932 gbest440.seq
230688588 gbest441.seq
230689122 gbest442.seq
230689565 gbest443.seq
230687793 gbest444.seq
230690167 gbest445.seq
230688579 gbest446.seq
230691229 gbest447.seq
230688684 gbest448.seq
230689941 gbest449.seq
215891515 gbest45.seq
230688317 gbest450.seq
230689982 gbest451.seq
230690191 gbest452.seq
230415069 gbest453.seq
230690534 gbest454.seq
230687790 gbest455.seq
230689831 gbest456.seq
230691267 gbest457.seq
230688181 gbest458.seq
230689766 gbest459.seq
216942613 gbest46.seq
230687483 gbest460.seq
230688326 gbest461.seq
230687484 gbest462.seq
230690041 gbest463.seq
230687614 gbest464.seq
230690355 gbest465.seq
225935445 gbest466.seq
223603703 gbest467.seq
230688573 gbest468.seq
230688536 gbest469.seq
230688853 gbest47.seq
230689825 gbest470.seq
230689892 gbest471.seq
230688658 gbest472.seq
230688677 gbest473.seq
230691739 gbest474.seq
230688327 gbest475.seq
230688880 gbest476.seq
196048875 gbest477.seq
199353010 gbest478.seq
230687898 gbest479.seq
230688778 gbest48.seq
230690379 gbest480.seq
230688953 gbest481.seq
230689295 gbest482.seq
230688900 gbest483.seq
230689464 gbest484.seq
218787189 gbest485.seq
230688147 gbest486.seq
176393246 gbest487.seq
223647071 gbest49.seq
164063504 gbest5.seq
230688931 gbest50.seq
230687892 gbest51.seq
230688990 gbest52.seq
230688213 gbest53.seq
230690861 gbest54.seq
230687919 gbest55.seq
230688389 gbest56.seq
230687508 gbest57.seq
230690286 gbest58.seq
230688395 gbest59.seq
178539313 gbest6.seq
230689313 gbest60.seq
230687448 gbest61.seq
230688049 gbest62.seq
230689256 gbest63.seq
230689299 gbest64.seq
230691034 gbest65.seq
209734479 gbest66.seq
209416905 gbest67.seq
208419388 gbest68.seq
209179432 gbest69.seq
230688112 gbest7.seq
209934219 gbest70.seq
210159087 gbest71.seq
209322029 gbest72.seq
208756078 gbest73.seq
210230099 gbest74.seq
208112933 gbest75.seq
205488023 gbest76.seq
208498937 gbest77.seq
208259707 gbest78.seq
211796028 gbest79.seq
230687894 gbest8.seq
227309051 gbest80.seq
230689272 gbest81.seq
230689520 gbest82.seq
219779039 gbest83.seq
214741349 gbest84.seq
214511865 gbest85.seq
230689006 gbest86.seq
230689475 gbest87.seq
230689835 gbest88.seq
230688041 gbest89.seq
230689448 gbest9.seq
230689705 gbest90.seq
230690198 gbest91.seq
230688266 gbest92.seq
230687559 gbest93.seq
230688478 gbest94.seq
230688484 gbest95.seq
230690158 gbest96.seq
230688834 gbest97.seq
230688716 gbest98.seq
230687912 gbest99.seq
230688406 gbgss1.seq
230689196 gbgss10.seq
227261546 gbgss100.seq
228330392 gbgss101.seq
228717954 gbgss102.seq
228640575 gbgss103.seq
227934704 gbgss104.seq
227438690 gbgss105.seq
230687826 gbgss106.seq
230687949 gbgss107.seq
230689984 gbgss108.seq
230689658 gbgss109.seq
230690514 gbgss11.seq
230689673 gbgss110.seq
230689109 gbgss111.seq
230687795 gbgss112.seq
230689353 gbgss113.seq
230690565 gbgss114.seq
230689388 gbgss115.seq
230688989 gbgss116.seq
230689171 gbgss117.seq
230687639 gbgss118.seq
230689360 gbgss119.seq
230689137 gbgss12.seq
230689837 gbgss120.seq
230688390 gbgss121.seq
230687449 gbgss122.seq
230688204 gbgss123.seq
230688379 gbgss124.seq
230688993 gbgss125.seq
230688674 gbgss126.seq
230689842 gbgss127.seq
230689295 gbgss128.seq
230688906 gbgss129.seq
230687891 gbgss13.seq
230690126 gbgss130.seq
230689087 gbgss131.seq
230687537 gbgss132.seq
230687726 gbgss133.seq
230688175 gbgss134.seq
230688317 gbgss135.seq
230688695 gbgss136.seq
230687807 gbgss137.seq
230689425 gbgss138.seq
230687606 gbgss139.seq
230687969 gbgss14.seq
32555644 gbgss140.seq
250000245 gbgss141.seq
250000183 gbgss142.seq
250001518 gbgss143.seq
250001614 gbgss144.seq
250002093 gbgss145.seq
250001445 gbgss146.seq
250001433 gbgss147.seq
250003211 gbgss148.seq
250002101 gbgss149.seq
230688014 gbgss15.seq
250002462 gbgss150.seq
250000058 gbgss151.seq
250001720 gbgss152.seq
250001281 gbgss153.seq
250000219 gbgss154.seq
250003345 gbgss155.seq
250000002 gbgss156.seq
250001607 gbgss157.seq
250000995 gbgss158.seq
250000023 gbgss159.seq
230690741 gbgss16.seq
250000688 gbgss160.seq
250001694 gbgss161.seq
250001366 gbgss162.seq
250000185 gbgss163.seq
250001003 gbgss164.seq
250000107 gbgss165.seq
250001941 gbgss166.seq
250002053 gbgss167.seq
250002869 gbgss168.seq
250002001 gbgss169.seq
230690352 gbgss17.seq
250002947 gbgss170.seq
250002055 gbgss171.seq
212768138 gbgss172.seq
230689981 gbgss18.seq
230688480 gbgss19.seq
230688758 gbgss2.seq
230688314 gbgss20.seq
230690772 gbgss21.seq
230690834 gbgss22.seq
230690251 gbgss23.seq
230689970 gbgss24.seq
230689561 gbgss25.seq
230688390 gbgss26.seq
230688946 gbgss27.seq
230688103 gbgss28.seq
230688097 gbgss29.seq
230689208 gbgss3.seq
230689988 gbgss30.seq
230688532 gbgss31.seq
230687973 gbgss32.seq
230687751 gbgss33.seq
230690120 gbgss34.seq
230688339 gbgss35.seq
230688859 gbgss36.seq
230688291 gbgss37.seq
230689118 gbgss38.seq
230687948 gbgss39.seq
230688227 gbgss4.seq
230688369 gbgss40.seq
230687828 gbgss41.seq
230689499 gbgss42.seq
230688464 gbgss43.seq
230689039 gbgss44.seq
230687442 gbgss45.seq
230688782 gbgss46.seq
230690096 gbgss47.seq
230688501 gbgss48.seq
230688452 gbgss49.seq
230687514 gbgss5.seq
230689078 gbgss50.seq
230688411 gbgss51.seq
230688268 gbgss52.seq
230687836 gbgss53.seq
230688079 gbgss54.seq
230689723 gbgss55.seq
230689245 gbgss56.seq
230688723 gbgss57.seq
230689295 gbgss58.seq
230687912 gbgss59.seq
230690316 gbgss6.seq
230688178 gbgss60.seq
229353897 gbgss61.seq
230688675 gbgss62.seq
230689289 gbgss63.seq
230688377 gbgss64.seq
230688571 gbgss65.seq
230687992 gbgss66.seq
230689547 gbgss67.seq
230688398 gbgss68.seq
230688377 gbgss69.seq
230691359 gbgss7.seq
230689157 gbgss70.seq
230687627 gbgss71.seq
230688981 gbgss72.seq
230689654 gbgss73.seq
230688476 gbgss74.seq
230689009 gbgss75.seq
230688110 gbgss76.seq
230688021 gbgss77.seq
230688181 gbgss78.seq
230687976 gbgss79.seq
230688790 gbgss8.seq
230689302 gbgss80.seq
199508359 gbgss81.seq
194743199 gbgss82.seq
219707593 gbgss83.seq
230687608 gbgss84.seq
230687910 gbgss85.seq
230688166 gbgss86.seq
230688655 gbgss87.seq
230687901 gbgss88.seq
230689851 gbgss89.seq
230688957 gbgss9.seq
230690140 gbgss90.seq
230688221 gbgss91.seq
230689351 gbgss92.seq
230688960 gbgss93.seq
230687452 gbgss94.seq
230688882 gbgss95.seq
230689089 gbgss96.seq
230689314 gbgss97.seq
230687968 gbgss98.seq
230687465 gbgss99.seq
250004723 gbhtc1.seq
81398160 gbhtc10.seq
250007880 gbhtc2.seq
250005545 gbhtc3.seq
250012840 gbhtc4.seq
250001047 gbhtc5.seq
250001202 gbhtc6.seq
250000931 gbhtc7.seq
250001584 gbhtc8.seq
250003573 gbhtc9.seq
250063915 gbhtg1.seq
250115646 gbhtg10.seq
250190436 gbhtg11.seq
250231937 gbhtg12.seq
250123477 gbhtg13.seq
250181009 gbhtg14.seq
250106912 gbhtg15.seq
250155106 gbhtg16.seq
250344129 gbhtg17.seq
250074734 gbhtg18.seq
250072118 gbhtg19.seq
250132476 gbhtg2.seq
250073076 gbhtg20.seq
250157291 gbhtg21.seq
250145171 gbhtg22.seq
250236835 gbhtg23.seq
250126471 gbhtg24.seq
250127041 gbhtg25.seq
250113961 gbhtg26.seq
250169880 gbhtg27.seq
250239581 gbhtg28.seq
250040186 gbhtg29.seq
250012649 gbhtg3.seq
250224116 gbhtg30.seq
250071613 gbhtg31.seq
250007076 gbhtg32.seq
250072413 gbhtg33.seq
250047543 gbhtg34.seq
250080245 gbhtg35.seq
250199751 gbhtg36.seq
250272345 gbhtg37.seq
250208079 gbhtg38.seq
250042100 gbhtg39.seq
250192299 gbhtg4.seq
250066135 gbhtg40.seq
250154972 gbhtg41.seq
250352081 gbhtg42.seq
250100203 gbhtg43.seq
250231277 gbhtg44.seq
250093840 gbhtg45.seq
250071584 gbhtg46.seq
250056814 gbhtg47.seq
250059624 gbhtg48.seq
250198489 gbhtg49.seq
250068033 gbhtg5.seq
250089905 gbhtg50.seq
250301949 gbhtg51.seq
250069534 gbhtg52.seq
250300580 gbhtg53.seq
250227365 gbhtg54.seq
250065829 gbhtg55.seq
250025149 gbhtg56.seq
250052137 gbhtg57.seq
250204164 gbhtg58.seq
250035543 gbhtg59.seq
250084181 gbhtg6.seq
250150656 gbhtg60.seq
250073840 gbhtg61.seq
250149396 gbhtg62.seq
250094700 gbhtg63.seq
250140746 gbhtg64.seq
250219777 gbhtg65.seq
250086408 gbhtg66.seq
250274171 gbhtg67.seq
250211497 gbhtg68.seq
250212921 gbhtg69.seq
250012437 gbhtg7.seq
250019407 gbhtg70.seq
250053026 gbhtg71.seq
250196219 gbhtg72.seq
250029658 gbhtg73.seq
250229356 gbhtg74.seq
250114024 gbhtg75.seq
250177142 gbhtg76.seq
250134065 gbhtg77.seq
250057534 gbhtg78.seq
101096316 gbhtg79.seq
250174040 gbhtg8.seq
250101068 gbhtg9.seq
250155518 gbinv1.seq
250116613 gbinv2.seq
250002830 gbinv3.seq
250000533 gbinv4.seq
250000453 gbinv5.seq
250003839 gbinv6.seq
250000452 gbinv7.seq
176108890 gbinv8.seq
250002385 gbmam1.seq
167752175 gbmam2.seq
40991954 gbnew.txt
250000509 gbpat1.seq
250001671 gbpat10.seq
250004328 gbpat11.seq
250001394 gbpat12.seq
250001350 gbpat13.seq
250000848 gbpat14.seq
250001724 gbpat15.seq
250001408 gbpat16.seq
250237355 gbpat17.seq
250001248 gbpat18.seq
250000200 gbpat19.seq
250001593 gbpat2.seq
33219109 gbpat20.seq
250000558 gbpat3.seq
250000141 gbpat4.seq
250004555 gbpat5.seq
250000979 gbpat6.seq
250000422 gbpat7.seq
250003223 gbpat8.seq
250001084 gbpat9.seq
46925427 gbphg.seq
250099749 gbpln1.seq
250047840 gbpln10.seq
250011748 gbpln11.seq
250000073 gbpln12.seq
250001356 gbpln13.seq
250356370 gbpln14.seq
250019761 gbpln15.seq
250003190 gbpln16.seq
130471749 gbpln17.seq
250014704 gbpln2.seq
251107796 gbpln3.seq
250003066 gbpln4.seq
250000263 gbpln5.seq
250001882 gbpln6.seq
250032696 gbpln7.seq
256153235 gbpln8.seq
277544798 gbpln9.seq
250214297 gbpri1.seq
250220827 gbpri10.seq
250107115 gbpri11.seq
250029461 gbpri12.seq
250193046 gbpri13.seq
250062457 gbpri14.seq
250001839 gbpri15.seq
250001981 gbpri16.seq
250050397 gbpri17.seq
250014094 gbpri18.seq
250038057 gbpri19.seq
250115701 gbpri2.seq
250012467 gbpri20.seq
250058451 gbpri21.seq
250001392 gbpri22.seq
250001256 gbpri23.seq
250000529 gbpri24.seq
250130585 gbpri25.seq
250494959 gbpri26.seq
250150341 gbpri27.seq
250000684 gbpri28.seq
196696339 gbpri29.seq
250185302 gbpri3.seq
250140058 gbpri4.seq
250164647 gbpri5.seq
250079130 gbpri6.seq
250159786 gbpri7.seq
250210696 gbpri8.seq
250070629 gbpri9.seq
211074 gbrel.txt
250178846 gbrod1.seq
250285045 gbrod10.seq
250024489 gbrod11.seq
250023690 gbrod12.seq
250132761 gbrod13.seq
250232118 gbrod14.seq
250116533 gbrod15.seq
250140724 gbrod16.seq
250200124 gbrod17.seq
250099187 gbrod18.seq
250206685 gbrod19.seq
250129118 gbrod2.seq
250001599 gbrod20.seq
250002193 gbrod21.seq
250193408 gbrod22.seq
219075021 gbrod23.seq
250164784 gbrod3.seq
250154172 gbrod4.seq
250235277 gbrod5.seq
250025432 gbrod6.seq
250133033 gbrod7.seq
250022534 gbrod8.seq
250189399 gbrod9.seq
4366829595 gbsdr.txt
250002409 gbsts1.seq
250003620 gbsts10.seq
250000227 gbsts11.seq
250000530 gbsts12.seq
250001423 gbsts13.seq
32261185 gbsts14.seq
250002317 gbsts2.seq
250001882 gbsts3.seq
250001847 gbsts4.seq
250001228 gbsts5.seq
250003757 gbsts6.seq
250002788 gbsts7.seq
250003791 gbsts8.seq
250000187 gbsts9.seq
113960023 gbsyn.seq
794005 gbuna.seq
250000414 gbvrl1.seq
250002008 gbvrl2.seq
250004172 gbvrl3.seq
250002899 gbvrl4.seq
193645877 gbvrl5.seq
250001491 gbvrt1.seq
160175505 gbvrt10.seq
250099220 gbvrt2.seq
250002262 gbvrt3.seq
250002105 gbvrt4.seq
250099843 gbvrt5.seq
250121821 gbvrt6.seq
250115616 gbvrt7.seq
250068038 gbvrt8.seq
250011999 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 24642 102214568
BCT10 53 113565653
BCT11 451 113445378
BCT12 36938 93356752
BCT13 28588 90842287
BCT2 4853 111786593
BCT3 78 114589727
BCT4 34404 100277939
BCT5 26600 99773564
BCT6 47306 94114778
BCT7 21927 107951501
BCT8 6493 97086449
BCT9 2236 107424642
ENV1 95908 71382143
ENV2 93082 78657177
ENV3 24596 20306616
EST1 68272 26345057
EST10 76608 29877691
EST100 71728 36256896
EST101 72623 38104533
EST102 73246 43870191
EST103 67105 44708179
EST104 75275 44404108
EST105 70345 28586865
EST106 70932 31987613
EST107 64617 34683450
EST108 66218 38922118
EST109 72461 48179124
EST11 75489 28839244
EST110 76075 28614934
EST111 74836 34193007
EST112 74923 27026173
EST113 73927 35657877
EST114 68007 35159498
EST115 74572 41924418
EST116 79562 44445098
EST117 73942 47874468
EST118 67639 40993591
EST119 70489 47153235
EST12 77657 30904890
EST120 72204 45591131
EST121 70751 44566189
EST122 75419 41876649
EST123 74926 47154508
EST124 74075 49979577
EST125 70647 48516304
EST126 80303 42215843
EST127 75661 26549298
EST128 82006 44755904
EST129 75414 42546738
EST13 77681 29353177
EST130 74554 44678257
EST131 64168 31264098
EST132 69638 38639020
EST133 67535 37030689
EST134 68072 38610207
EST135 71288 42607576
EST136 73421 47784453
EST137 66538 38177775
EST138 72966 41510131
EST139 68923 40019896
EST14 79368 32313485
EST140 61134 37887735
EST141 85264 46377947
EST142 99028 56096984
EST143 65582 34291923
EST144 98137 52128708
EST145 110082 58572789
EST146 99661 55565855
EST147 79380 47264139
EST148 92102 51176634
EST149 97009 60388202
EST15 74082 31332606
EST150 98445 58630981
EST151 74600 42960482
EST152 69170 37292529
EST153 66324 30072493
EST154 59081 27243438
EST155 57493 28159957
EST156 62312 31025700
EST157 60071 31312411
EST158 78323 56004815
EST159 66992 39238703
EST16 75674 33292874
EST160 75806 48687602
EST161 67599 37062720
EST162 61988 30683986
EST163 64314 40350486
EST164 65797 30616749
EST165 62702 47349092
EST166 75044 41244419
EST167 100981 45623909
EST168 88525 52791299
EST169 99948 57960588
EST17 83306 34219503
EST170 102425 55591351
EST171 96597 51099542
EST172 90087 37815458
EST173 93190 47945341
EST174 92294 40714893
EST175 92399 39190543
EST176 79776 38828780
EST177 64466 44157564
EST178 70189 39134469
EST179 61051 42295270
EST18 80517 32335336
EST180 69174 32962758
EST181 75209 28141223
EST182 71197 45463815
EST183 81092 40639816
EST184 64812 33501878
EST185 67107 42637551
EST186 68088 51208243
EST187 70310 36872993
EST188 67243 39806158
EST189 70483 57319356
EST19 79349 32658101
EST190 68237 35940867
EST191 72814 36589158
EST192 69906 58031088
EST193 68197 52893602
EST194 64529 47238471
EST195 64309 47394011
EST196 65774 46884381
EST197 64487 44125802
EST198 64048 50363045
EST199 63230 39355259
EST2 74829 28715325
EST20 74072 29916822
EST200 64984 34324076
EST201 63910 37588357
EST202 82915 44540439
EST203 84938 55198263
EST204 66069 40029546
EST205 102274 64142971
EST206 107924 65562225
EST207 109221 64613070
EST208 104593 66124508
EST209 105233 63190185
EST21 73753 34240766
EST210 107802 52039608
EST211 91408 54217722
EST212 98959 43374906
EST213 86854 50190628
EST214 68774 39369486
EST215 69701 48457961
EST216 68365 59273195
EST217 76301 51943237
EST218 79299 38937424
EST219 77647 50617120
EST22 75977 30474854
EST220 71868 51395138
EST221 68573 42461831
EST222 27725 10475121
EST223 27851 10435545
EST224 26936 9879078
EST225 26910 9585631
EST226 26653 9117631
EST227 27363 10157532
EST228 27198 9646450
EST229 27234 9925629
EST23 77634 32429367
EST230 27217 11369226
EST231 27163 11650971
EST232 27211 10755724
EST233 27498 9646807
EST234 27249 8840683
EST235 27297 10758044
EST236 27892 10938809
EST237 27560 10976220
EST238 26653 11554723
EST239 26797 12066892
EST24 76038 34156616
EST240 27127 10639930
EST241 27002 11152481
EST242 27042 11943562
EST243 27219 11415021
EST244 27277 10725785
EST245 27253 10928270
EST246 27144 10322238
EST247 26307 14162615
EST248 24790 16949792
EST249 25897 17598322
EST25 72331 30679012
EST250 84859 30426495
EST251 88929 39434879
EST252 69847 44292500
EST253 69188 44647819
EST254 69128 44207114
EST255 67373 41568666
EST256 74793 43896833
EST257 65647 38768616
EST258 69784 50016149
EST259 56396 27655861
EST26 76029 31571940
EST260 96727 46182415
EST261 93543 46098366
EST262 71459 40389496
EST263 61654 29261620
EST264 70800 39099809
EST265 72213 39210259
EST266 72165 33544810
EST267 70751 40736740
EST268 72855 43129212
EST269 64821 38121077
EST27 76834 33259667
EST270 69542 33633102
EST271 87108 46480615
EST272 71990 45179664
EST273 79701 53838715
EST274 91077 52186777
EST275 101392 46148048
EST276 79624 45677635
EST277 68794 42779018
EST278 75629 37294827
EST279 68758 32765345
EST28 109254 52815929
EST280 71705 31062568
EST281 67635 39629971
EST282 60099 36447356
EST283 67440 41228381
EST284 69304 40804678
EST285 61022 41947173
EST286 81897 41419396
EST287 78843 42085531
EST288 72816 42431595
EST289 93666 54905884
EST29 97858 46423654
EST290 116313 49512502
EST291 100838 44412551
EST292 66296 36063625
EST293 69965 41064250
EST294 77541 45237561
EST295 75934 38398723
EST296 71290 45545432
EST297 69328 37375810
EST298 60416 37150483
EST299 50461 26040933
EST3 73902 29987952
EST30 93707 52641977
EST300 72440 51807997
EST301 68686 40468743
EST302 76083 46199440
EST303 65080 37004913
EST304 70835 36784443
EST305 52822 28413302
EST306 52976 28386026
EST307 54168 25965422
EST308 60136 29671210
EST309 76784 41328164
EST31 78314 41027493
EST310 74163 34024173
EST311 76905 31797901
EST312 75238 31819734
EST313 92921 57429488
EST314 71077 55715492
EST315 80318 53052300
EST316 70603 34817855
EST317 68056 48763424
EST318 66459 50816344
EST319 61240 46783698
EST32 66964 56763246
EST320 65483 39277120
EST321 66959 41495139
EST322 68496 43574515
EST323 48036 23830579
EST324 65238 33905961
EST325 68801 37398471
EST326 58781 28977407
EST327 66369 42322154
EST328 74109 43409238
EST329 78532 40719165
EST33 77429 51423126
EST330 63594 36996590
EST331 75675 45434510
EST332 66325 44154711
EST333 74835 44519945
EST334 85091 49698843
EST335 91156 49816323
EST336 62657 33038261
EST337 62357 39561192
EST338 76700 37169664
EST339 51358 28517188
EST34 91062 47147773
EST340 57711 31363668
EST341 70238 40894953
EST342 89166 47111304
EST343 84594 42492277
EST344 71116 48457286
EST345 78872 53280817
EST346 64731 36943920
EST347 68814 35102520
EST348 84431 38649341
EST349 61030 40232933
EST35 85624 44603131
EST350 53502 37508397
EST351 64886 37100611
EST352 86981 52656591
EST353 89868 49049323
EST354 67951 42760790
EST355 79690 42111827
EST356 53746 34390895
EST357 44309 23259598
EST358 67900 41839990
EST359 81802 41948554
EST36 91007 55827682
EST360 79956 47589225
EST361 71321 42337616
EST362 65525 38120862
EST363 63194 41520394
EST364 74339 39445888
EST365 56714 36477120
EST366 82413 27377807
EST367 81803 36203433
EST368 66814 39642271
EST369 66380 37025777
EST37 93797 54849926
EST370 69178 38545437
EST371 81406 48643804
EST372 63151 43419580
EST373 62658 39769668
EST374 78290 45661993
EST375 59990 34690147
EST376 64316 41829393
EST377 78768 49049685
EST378 85284 48648199
EST379 68767 41112375
EST38 90198 45900153
EST380 58864 41178200
EST381 57129 40725444
EST382 57071 40726028
EST383 68325 41372786
EST384 66402 39995679
EST385 58950 37288047
EST386 59803 39498304
EST387 59268 40740135
EST388 60569 41718352
EST389 55785 41955870
EST39 99671 48167128
EST390 50971 36294480
EST391 93931 39956059
EST392 69834 38653946
EST393 69978 38556982
EST394 70071 38608971
EST395 69820 38805366
EST396 69888 38607104
EST397 69777 38879983
EST398 69184 38380317
EST399 69119 39513065
EST4 74688 28363417
EST40 91591 34843560
EST400 69268 38655011
EST401 67970 36930473
EST402 68717 39225151
EST403 69678 39511401
EST404 69496 38349453
EST405 69666 38176280
EST406 70099 38217253
EST407 70140 38294002
EST408 69888 38711449
EST409 70062 38314593
EST41 68728 18308939
EST410 70346 37341541
EST411 62138 40545140
EST412 52031 40816224
EST413 69976 45007644
EST414 63995 37323901
EST415 70203 41779297
EST416 113142 57231363
EST417 81611 50181899
EST418 82972 57989403
EST419 51213 30305663
EST42 68671 18395588
EST420 47726 44142517
EST421 46382 58953614
EST422 72981 55641868
EST423 64962 38279225
EST424 72586 43336186
EST425 67865 42632459
EST426 70382 43295712
EST427 61637 52192948
EST428 82966 44328319
EST429 110220 48450098
EST43 63184 19298717
EST430 82283 45511560
EST431 60190 40356770
EST432 57425 41125220
EST433 58863 39008386
EST434 66151 51350155
EST435 63265 45584390
EST436 59625 40606543
EST437 51726 38515474
EST438 57084 38876483
EST439 55527 41233461
EST44 43711 11922841
EST440 69538 37682929
EST441 64705 43727637
EST442 57074 38162944
EST443 58949 41999444
EST444 58417 45744792
EST445 59823 45663144
EST446 56041 40292531
EST447 57833 41495378
EST448 53465 35651452
EST449 57272 40814850
EST45 43314 11987487
EST450 56274 35563408
EST451 74003 46262107
EST452 68073 57672236
EST453 69807 50951544
EST454 75833 50049431
EST455 45768 59623062
EST456 55996 49127794
EST457 66490 47790996
EST458 60797 40733968
EST459 77755 44659120
EST46 43197 11448121
EST460 83323 53503532
EST461 82688 52428778
EST462 68771 43229933
EST463 64256 42220898
EST464 79319 52453768
EST465 79474 59176038
EST466 71452 51241866
EST467 71421 51498655
EST468 68158 45176109
EST469 62804 50439340
EST47 79268 32292901
EST470 65901 47698411
EST471 81196 45246107
EST472 84249 40423495
EST473 120089 42775809
EST474 84589 50751650
EST475 50565 50023152
EST476 68081 47726661
EST477 86993 31680169
EST478 87298 32596174
EST479 76888 44870462
EST48 96147 43821006
EST480 88654 42179292
EST481 69807 25550118
EST482 73200 27304654
EST483 73957 26186842
EST484 76159 27164460
EST485 72872 25201873
EST486 71186 29295179
EST487 58475 21536901
EST49 91069 46460055
EST5 48411 15354346
EST50 89329 41547890
EST51 103250 53165139
EST52 98879 49917114
EST53 78339 34007985
EST54 65696 28520233
EST55 72901 32223034
EST56 71080 29903534
EST57 82011 33125512
EST58 74212 29531011
EST59 70740 28465619
EST6 55463 17768277
EST60 64020 29328270
EST61 76659 34718397
EST62 75687 33589031
EST63 74557 29264740
EST64 77119 27287976
EST65 84377 39533550
EST66 40577 11612964
EST67 40430 11036759
EST68 40365 12500200
EST69 40812 12647560
EST7 74724 29408352
EST70 40825 12296913
EST71 40750 12972010
EST72 40540 12891149
EST73 40522 12096520
EST74 40163 12042081
EST75 40946 12713135
EST76 41388 11847558
EST77 41009 13083117
EST78 40864 12944253
EST79 42464 12902721
EST8 76223 30692191
EST80 46025 16862927
EST81 42729 26834941
EST82 42280 19473830
EST83 48335 19699977
EST84 50689 22129332
EST85 50937 21780843
EST86 83599 48127042
EST87 75088 32442205
EST88 74144 29217449
EST89 72942 30967218
EST9 77666 29936459
EST90 76708 44764604
EST91 77604 41008333
EST92 76160 40223598
EST93 78273 38014736
EST94 69517 40339358
EST95 74715 35746558
EST96 74986 38151447
EST97 70066 36773371
EST98 77332 49809094
EST99 67801 35781748
GSS1 90815 38834663
GSS10 75203 43827189
GSS100 75181 41146344
GSS101 73938 44262047
GSS102 73486 45400361
GSS103 73574 45177562
GSS104 73239 45064302
GSS105 73595 43987134
GSS106 79096 51925286
GSS107 85800 58074656
GSS108 81552 53591830
GSS109 82896 51639029
GSS11 70001 35690271
GSS110 86145 51279436
GSS111 79064 65299570
GSS112 86236 47014835
GSS113 93959 55550828
GSS114 76328 47699010
GSS115 86008 59433505
GSS116 85339 66895171
GSS117 74001 36326970
GSS118 82247 56273690
GSS119 93597 51349366
GSS12 73486 38640542
GSS120 86721 54806573
GSS121 85323 54211539
GSS122 85468 53011152
GSS123 76512 68776337
GSS124 76666 68474350
GSS125 79729 59160118
GSS126 78488 54505819
GSS127 78717 54621032
GSS128 79412 53597272
GSS129 78492 55002226
GSS13 76824 38753829
GSS130 80267 54957255
GSS131 84097 59763824
GSS132 76445 54690565
GSS133 65895 55331554
GSS134 77271 64564221
GSS135 76546 68703067
GSS136 77481 52406114
GSS137 86703 55967138
GSS138 94691 58076439
GSS139 93211 60013326
GSS14 71339 32037962
GSS140 11683 6937758
GSS141 87168 64691174
GSS142 83933 63024181
GSS143 101256 46855300
GSS144 68836 58616003
GSS145 68297 58743814
GSS146 69348 56614445
GSS147 69623 56079934
GSS148 70272 55426733
GSS149 85751 73232317
GSS15 70635 35231532
GSS150 85330 39449164
GSS151 74778 32588673
GSS152 99328 75430073
GSS153 89068 41408464
GSS154 92330 63367911
GSS155 79082 63996268
GSS156 70311 59004636
GSS157 68330 63033580
GSS158 62579 54742043
GSS159 117232 70691589
GSS16 77869 45864629
GSS160 119056 74820523
GSS161 114649 72707731
GSS162 87560 48965523
GSS163 89986 55139679
GSS164 103016 71752564
GSS165 108129 77728066
GSS166 106287 79795926
GSS167 105854 80268112
GSS168 100036 64217264
GSS169 82079 45309656
GSS17 70878 33347857
GSS170 95432 48597700
GSS171 96101 63952557
GSS172 86569 40812952
GSS18 58435 27835472
GSS19 56830 28972475
GSS2 89365 39527628
GSS20 57704 26614018
GSS21 61770 30373835
GSS22 64718 36890847
GSS23 57518 27110799
GSS24 67011 42443489
GSS25 67389 27853592
GSS26 58134 25468277
GSS27 66144 32317187
GSS28 64609 32380107
GSS29 79049 40128562
GSS3 87680 41929125
GSS30 82221 39877244
GSS31 74217 40361454
GSS32 70485 48485415
GSS33 79985 37649039
GSS34 75904 40293694
GSS35 74344 39408511
GSS36 87711 57664781
GSS37 87595 58177361
GSS38 85648 44902408
GSS39 85916 49620976
GSS4 79245 41177405
GSS40 87213 38944622
GSS41 82792 33835141
GSS42 81263 56908479
GSS43 79656 57690870
GSS44 72039 47483566
GSS45 72041 47419628
GSS46 77815 45492417
GSS47 78031 39343534
GSS48 83547 58275343
GSS49 86679 65828881
GSS5 79026 40721861
GSS50 82541 53571929
GSS51 93590 59658569
GSS52 88622 59013972
GSS53 75380 40304513
GSS54 74173 42375172
GSS55 86024 45673903
GSS56 88487 59150693
GSS57 76424 66786050
GSS58 72040 79219162
GSS59 88100 68605961
GSS6 78265 38902627
GSS60 87120 58031679
GSS61 63466 45265611
GSS62 68991 47479571
GSS63 89660 67262202
GSS64 86178 58171742
GSS65 87490 53906168
GSS66 87645 56804581
GSS67 97007 58010512
GSS68 100572 54579713
GSS69 100677 54446472
GSS7 77553 39404543
GSS70 101389 53545184
GSS71 102319 52363022
GSS72 102446 52203263
GSS73 102681 51905710
GSS74 102099 52642815
GSS75 98509 57227406
GSS76 90185 69685169
GSS77 89826 70789685
GSS78 88068 69609477
GSS79 87825 69675214
GSS8 76296 38105941
GSS80 89292 63517953
GSS81 80820 24008887
GSS82 77804 24485925
GSS83 87839 36258829
GSS84 84084 50129051
GSS85 80780 48947055
GSS86 89482 64530910
GSS87 78828 61901982
GSS88 78013 79500122
GSS89 76524 56277812
GSS9 72530 37270623
GSS90 95037 51063472
GSS91 76126 41284021
GSS92 85930 49579125
GSS93 69300 61802849
GSS94 85808 51581929
GSS95 82321 61218051
GSS96 85360 56094595
GSS97 82871 57387921
GSS98 90411 53725675
GSS99 80330 68174545
HTC1 37151 54058079
HTC10 17094 31379836
HTC2 28559 64622132
HTC3 18491 42903167
HTC4 16114 39710099
HTC5 36455 32063867
HTC6 66442 56801318
HTC7 81604 68033127
HTC8 67515 60489698
HTC9 66809 82313718
HTG1 1315 188873586
HTG10 1241 186625803
HTG11 1431 184273146
HTG12 875 192006999
HTG13 749 192328770
HTG14 742 192292811
HTG15 780 192242473
HTG16 800 192095333
HTG17 765 192432322
HTG18 2037 171427726
HTG19 1042 188114461
HTG2 2563 186100623
HTG20 1018 188805952
HTG21 776 192002065
HTG22 926 190402873
HTG23 879 191024210
HTG24 827 191214615
HTG25 775 192106089
HTG26 844 191410000
HTG27 854 191511332
HTG28 978 189652917
HTG29 908 190857143
HTG3 2458 185319770
HTG30 924 190530530
HTG31 871 191331594
HTG32 971 189562244
HTG33 870 191213250
HTG34 851 191500834
HTG35 828 191836345
HTG36 879 191149416
HTG37 976 190260086
HTG38 930 190494662
HTG39 1009 189771553
HTG4 2519 188482648
HTG40 1182 187177582
HTG41 1228 187709177
HTG42 1219 188653926
HTG43 1159 187262402
HTG44 1107 191241349
HTG45 1219 190907667
HTG46 1240 191088505
HTG47 1132 191254091
HTG48 1086 191024108
HTG49 1024 190323008
HTG5 1281 185650087
HTG50 998 189412508
HTG51 999 189963690
HTG52 981 189660545
HTG53 1007 189867897
HTG54 984 189858552
HTG55 970 189055249
HTG56 923 189105860
HTG57 1045 188762855
HTG58 1076 189151357
HTG59 1011 188980105
HTG6 1273 185296258
HTG60 1137 186163262
HTG61 1030 188721226
HTG62 1037 189498571
HTG63 1015 188949937
HTG64 1067 188603235
HTG65 1352 188174434
HTG66 1350 185030015
HTG67 1250 185737190
HTG68 1244 184638795
HTG69 1269 184711142
HTG7 1247 185472319
HTG70 1253 184725690
HTG71 1272 190066695
HTG72 1129 191855030
HTG73 1323 190416763
HTG74 1260 190315082
HTG75 1073 193985719
HTG76 1037 194162935
HTG77 826 182062754
HTG78 1153 193549849
HTG79 427 69494989
HTG8 1287 185088399
HTG9 1182 187153099
INV1 18219 160305555
INV2 1649 167356288
INV3 32057 117399088
INV4 79552 74293045
INV5 73414 73926301
INV6 65258 84253800
INV7 45814 104960633
INV8 35547 68204637
MAM1 51230 116662663
MAM2 40475 62891159
PAT1 222670 70172584
PAT10 140467 56018332
PAT11 102696 62156801
PAT12 111691 51360216
PAT13 146607 54652682
PAT14 153387 75552455
PAT15 104812 117876631
PAT16 142211 91826065
PAT17 111966 109361593
PAT18 129768 102892344
PAT19 127434 67447434
PAT2 194384 84711889
PAT20 34228 8328520
PAT3 172019 95882664
PAT4 153753 106055882
PAT5 153745 92495265
PAT6 146783 86027426
PAT7 113978 113621441
PAT8 133783 96905873
PAT9 130285 94222216
PHG 2895 19014490
PLN1 37976 117680689
PLN10 1719 194166079
PLN11 39029 90539601
PLN12 75014 76220260
PLN13 77072 78569461
PLN14 50786 104315814
PLN15 41565 111049149
PLN16 42710 111396545
PLN17 22530 52456166
PLN2 1366 175249490
PLN3 2182 169849575
PLN4 74609 81268145
PLN5 70875 71980259
PLN6 30549 53097221
PLN7 7747 153685669
PLN8 1530 170810474
PLN9 64 208691296
PRI1 21721 140600158
PRI10 1451 181812107
PRI11 1298 178937712
PRI12 1531 178022828
PRI13 1609 179825787
PRI14 1487 186178961
PRI15 12418 172268664
PRI16 43358 111897314
PRI17 27590 108097903
PRI18 1635 182768935
PRI19 1689 183867522
PRI2 1476 172896399
PRI20 1925 182929716
PRI21 2656 183028208
PRI22 7231 166936357
PRI23 56525 90273008
PRI24 34440 66216702
PRI25 7100 172745273
PRI26 23530 145198514
PRI27 41680 132120380
PRI28 32866 135013429
PRI29 47122 76942328
PRI3 1279 186479438
PRI4 1327 184314992
PRI5 1195 181167238
PRI6 1206 179073526
PRI7 1231 180359741
PRI8 1365 174795118
PRI9 1225 177713135
ROD1 9850 168472348
ROD10 979 182534090
ROD11 1020 186982278
ROD12 970 183507132
ROD13 1017 185682252
ROD14 950 181513030
ROD15 965 183043629
ROD16 1055 186423088
ROD17 27872 143510266
ROD18 1176 191154873
ROD19 1226 193426305
ROD2 926 173989791
ROD20 13924 172380630
ROD21 38285 70868425
ROD22 9016 164437586
ROD23 46995 92441856
ROD3 903 173928369
ROD4 906 174005893
ROD5 929 174089744
ROD6 985 181451822
ROD7 971 179780886
ROD8 985 181652898
ROD9 1016 183476106
STS1 82035 35187236
STS10 58191 44487209
STS11 58022 43668250
STS12 74822 38647920
STS13 87116 38674961
STS14 14391 5613454
STS2 84071 44767584
STS3 76437 30859319
STS4 66854 33906936
STS5 54867 31982572
STS6 54730 32221608
STS7 54692 32192339
STS8 56389 38737333
STS9 58081 44559544
SYN 25769 37059762
UNA 323 228899
VRL1 72358 65698750
VRL2 72397 64750102
VRL3 69699 70965793
VRL4 68026 67902613
VRL5 56839 52204752
VRT1 45302 124376173
VRT10 40654 61018525
VRT2 31880 142171468
VRT3 58223 104594158
VRT4 53919 66249925
VRT5 9589 161289680
VRT6 1290 193038811
VRT7 1304 193035024
VRT8 14352 173142906
VRT9 15298 172376508
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 152.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
10131340 12087609861 Homo sapiens
6641378 7984449276 Mus musculus
1181504 5740259164 Rattus norvegicus
1545042 3336538259 Bos taurus
882075 2291148858 Danio rerio
2704851 1825310176 Zea mays
582050 1283970693 Oryza sativa (japonica cultivar-group)
214830 1135181407 Strongylocentrotus purpuratus
1179169 959066085 Xenopus tropicalis
1419118 812962095 Canis familiaris
1146414 801534575 Sus scrofa
535593 793739793 Drosophila melanogaster
1184927 739371356 Arabidopsis thaliana
788150 689714568 Gallus gallus
208059 553603341 Pan troglodytes
784737 463990929 Sorghum bicolor
392593 440786122 Medicago truncatula
68720 436065231 Macaca mulatta
696003 420710099 Ciona intestinalis
596257 404133348 Brassica oleracea
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, gbcon.seq, and the lists of new,
changed, and deleted accession numbers, each of the files of a GenBank
release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 December 2006
NCBI-GenBank Flat File Release 152.0
Bacterial Sequences (Part 1)
37811 loci, 97585608 bases, from 37811 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 152.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, Jane Weisemann, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
