Release Notes For GenBank Release 154
GBREL.TXT Genetic Sequence Data Bank
June 15 2006
NCBI-GenBank Flat File Release 154.0
Distribution Release Notes
58890345 loci, 63412609711 bases, from 58890345 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 154.0
1.2 Cutoff Date
1.3 Important Changes in Release 154.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 154.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 154.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 154.0, incorporates data available to the collaborating
databases as of June 9, 2006 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 154.0
1.3.1 New JOURNAL type for Pre-Grant Patent Publications
Sequences associated with granted patents from the US Patent and
Trademark Office (USPTO) typically have references that look like this:
REFERENCE 1 (bases 1 to 22)
AUTHORS Stewart,L.J.
TITLE Screening methods for identifying ligands
JOURNAL Patent: US 6950757-A 2 27-SEP-2005;
The "Patent:" token indicates that the JOURNAL line pertains to a
patent document, as opposed to a published article in the scientific
literature.
But sequence data can be available well in advance of the point at which
an actual patent has been granted. As of GenBank Release 154 in June 2006,
a patent sequence associated with a "Pre-Grant Publication" is now
indicated via a slight change to the JOURNAL line:
REFERENCE 1 (bases 1 to 190)
AUTHORS Xu,M. and Humphreys,R.
TITLE Inhibition of li expression in mammalian cells
JOURNAL Pre-Grant Patent: US 20060008448A1 1 12-JAN-2006;
^^^^^^^^^^^^^^^^^
The introduction of "Pre-Grant Patent:" at the start of the JOURNAL
line distinguishes sequences associated with these two different
states in USPTO's patenting process.
Note that pre-grant identifiers from the USPTO are alphanumeric, and
lack a document-type suffix ("-A" in the granted-patent example above).
1.3.2 Organizational changes
The total number of sequence data files increased by 32 with this release:
- the BCT division is now comprised of 15 files (+1)
- the CON division is newly split into 3 pieces (+2)
- the EST division is now comprised of 528 files (+16)
- the GSS division is now comprised of 177 files (+3)
- the HTG division is now comprised of 83 files (+2)
- the INV division is now comprised of 9 files (+1)
- the PAT division is now comprised of 24 files (+4)
- the PLN division is now comprised of 18 files (+1)
- the VRL division is now comprised of 6 files (+1)
- the VRT division is now comprised of 11 files (+1)
In addition, the Short-Directory 'index' file has also been split into
three pieces:
gbsdr1.txt : non-EST and non-GSS short directory entries
gbsdr2.txt : EST short directory entries
gbsdr3.txt : EST short directory entries
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics since January 2005
seem to support this: the index files are transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also leads us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 154.0 thus contains these ten index
files, which lack all EST and most GSS content:
gbaut1.idx
gbaut2.idx
gbaut3.idx
gbaut4.idx
gbaut5.idx
gbaut6.idx
gbgen.idx
gbjou.idx
gbkey.idx
gbsec.idx
In addition, a version of gbacc.idx which encompasses the entirety of the
release was built manually, but note that the first field contains just an
accession number, rather than Accession.Version, and that the file is unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options within the next year:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
thirty-three of the GSS flatfiles in Release 154.0. Consider gbgss145.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
June 15 2006
NCBI-GenBank Flat File Release 154.0
GSS Sequences (Part 1)
86832 loci, 64420446 bases, from 86832 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "145" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New protein residue abbreviation for Pyrrolysine
Sequence databases use single-letter amino acid abbreviations to
record the primary structure (sequence) of amino acids in a polypeptide.
The table of abbreviations includes only those amino acids that are
encoded in the genetic code and directly inserted by a tRNA during the
process of protein translation. Post-translational modifications are
not represented in the sequence data itself, but may be described by
features annotated on the sequence.
The discovery of the 22nd naturally encoded amino acid, pyrrolysine,
and the recent submission of sequence records that should contain
this residue, require the adoption of a new amino acid abbreviation.
Because several letters are assigned to represent different experimental
ambiguities, the only letter still available for use is O (uppercase
letter o). Scientists working in the field have independently suggested
use of this letter, and it has a reasonable mnemonic, pyrrOlysine.
The IUPAC-IUBMB Joint Commission on Biochemical Nomenclature has agreed
that Pyl/O will be recommended for this amino acid.
The consequences for flatfile users are that O will appear in CDS
/translation qualifiers, and that Pyl (the three-letter abbreviation)
will appear in CDS /transl_except qualifiers and in the /product and
/anticodon qualifiers of tRNA features. These changes will take effect
as of the October 2006 GenBank release.
Sample records in ASN.1, FASTA, GenBank flatfile, and INSDSeq XML
formats will be made available on the NCBI ftp site for the purpose of
testing software prior to the public introduction of 'O' in protein
sequences.
For BLAST and other sequence similarity search tools, we expect to map
pyrrolysine (O) to unknown (X), as is already done with selenocysteine
(U), the 21st naturally encoded amino acid. One reason is that the PAM
and BLOSUM substitution matrices do not accommodate these more recently
discovered amino acids. The other reason is that selenocysteine and
pyrrolysine both appear to be used as active sites in certain enzymes,
and thus do not simply substitute for cysteine or lysine.
Here are a few literature references which provide more information
about pyrrolysine :
G. Srinivasan, C. M. James, J. A. Krzycki. Pyrrolysine encoded by
UAG in Archaea: charging of a UAG-decoding specialized tRNA. Science
2002, 296:1459-1462.
B. Hao, W. Gong, T.K. Ferguson, C.M. James, J.A. Krzycki, M.K.
Chan. A new UAG-encoded residue in the structure of a methanogen
methyltransferase. Science 2002, 296:1462-1466.
C. Polycarpo, A. Ambrogelly, A. Berube, S.M. Winbush, J.A.
McCloskey, P. F. Crain, J. L. Wood, D. Soll. An aminoacyl-tRNA
synthetase that specifically activates pyrrolysine. Proc. Natl. Acad.
Sci. (USA) 2004, 101:12450-12454.
C. Fenske, G.J. Palm, W. Hinrichs. How unique is the genetic code?
Agnew. Chem. Int. Ed. 2003, 42:606-610.
1.4.2 Protein residue J for leucine/isoleucine ambiguities
The residue abbreviation J is reserved for mass spectrometry experiments that
cannot distinguish leucine from isoleucine. Although this abbreviation has
been part of the IUPAC recommendations for some time, it has not previously
appeared in protein sequences in the GenBank database.
As of October 2006, abbreviation J will be legal in CDS /translation
qualifiers, and Xle (the three-letter abbreviation) will be allowed in CDS
/transl_except qualifiers and in the /product and /anticodon qualifiers of
tRNA features.
J will also be mapped to unknown (X) for the purpose of BLAST and other
sequence similarity search tools.
1.4.3 /PCR_primers and modified bases
PCR primers are sometimes constructed which utilize modified bases,
such as those listed in the table of modified bases included in the
Feature Table document:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html#7.5.2
In October 2006, it will be legal to use modified-base abbreviations
for the /PCR_primers qualifier. For example:
/PCR_primers="fwd_seq: gcagtt<i>caag<gal q>tggagtgaa, rev_seq:
gcaacgtatcctccagagtgatcgb
Here, modified bases inosine and beta,D-galactosylqueosine are included
in the forward sequence of the primer pair, and enclosed between angle
brackets ( <...> ) .
Each pair of angle brackets will include only a single modified base
abbreviation.
1.4.4 Introduction of /mobile_element qualifier
For repeat_region features, the /transposon and /insertion_seq
qualifiers can be used to describe two specific classes of mobile
elements. But not all mobile elements fall into these two categories,
so a new structured /mobile_element qualifier will be introduced
as of GenBank 155.0 in December 2006. The preliminary description
of the new qualifier is as follows:
Qualifer: /mobile_element
Description: Type, and name (or identifier), of the mobile element
which is described by the parent feature.
Value format: <mobile_element_type>:<mobile_element_id>
Where mobile element type is one of the following: transposon,
integron, insertion_sequence, other .
Example: /mobile_element="transposon:Tnp9"
Further details about this new qualifier, the domain of mobile element
types in particular, will be provided in these release notes and via the
GenBank newsgroup as they become available.
1.4.5 New /mol_type value
A new legal molecule type value for viral cRNA sequences will be
introduced as of October 2006:
/mol_type="viral cRNA"
This value will also be legal for the molecule type field on the
LOCUS line of the GenBank flatfile format. Additional details about
the usage of this new molecule type value will be provided via
these release notes and the GenBank newsgroup.
1.4.6 Feature location syntax X.Y to be discontinued
The Feature Table currently supports feature locations of the
format X.Y, to represent a base position which is greater or
equal to X, and less than or equal to Y. For example:
misc_feature 1.10..20
misc_feature join(100..150,200.210..250)
In the first example, the misc_feature starts somewhere between
bases 1 and 10 (inclusive), and ends at basepair 20. In the second,
the 51 bases from 100..150 are joined together with a second basepair
interval, which could be anywhere from 200..250 to 210..250 .
Although this syntax seems like a reasonable way to capture an
uncertain interval, it is used for features on a vanishingly small
number of sequence records, most database submission mechanisms
don't support it, and the meaning of its use in a join() context
is not entirely clear.
As of October 2006, this type of location will no longer be
supported. Those records with features which utilize X.Y locations
will be reviewed and converted to a non-uncertain format prior to
that date.
1.4.7 /operon to become legal for rRNA features
With the October 2006 GenBank release, the /operon qualifier will
be legal for use on rRNA features.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 978 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut2.idx - Index of the entries according to accession number, part 2.
4. gbaut3.idx - Index of the entries according to accession number, part 3.
5. gbaut4.idx - Index of the entries according to accession number, part 4.
6. gbaut5.idx - Index of the entries according to accession number, part 5.
7. gbaut6.idx - Index of the entries according to accession number, part 6.
8. gbbct1.seq - Bacterial sequence entries, part 1.
9. gbbct10.seq - Bacterial sequence entries, part 10.
10. gbbct11.seq - Bacterial sequence entries, part 11.
11. gbbct12.seq - Bacterial sequence entries, part 12.
12. gbbct13.seq - Bacterial sequence entries, part 13.
13. gbbct14.seq - Bacterial sequence entries, part 14.
14. gbbct15.seq - Bacterial sequence entries, part 15.
15. gbbct2.seq - Bacterial sequence entries, part 2.
16. gbbct3.seq - Bacterial sequence entries, part 3.
17. gbbct4.seq - Bacterial sequence entries, part 4.
18. gbbct5.seq - Bacterial sequence entries, part 5.
19. gbbct6.seq - Bacterial sequence entries, part 6.
20. gbbct7.seq - Bacterial sequence entries, part 7.
21. gbbct8.seq - Bacterial sequence entries, part 8.
22. gbbct9.seq - Bacterial sequence entries, part 9.
23. gbchg.txt - Accession numbers of entries updated since the previous release.
24. gbcon1.seq - Constructed sequence entries, part 1.
25. gbcon2.seq - Constructed sequence entries, part 2.
26. gbcon3.seq - Constructed sequence entries, part 3.
27. gbdel.txt - Accession numbers of entries deleted since the previous release.
28. gbenv1.seq - Environmental sampling sequence entries, part 1.
29. gbenv2.seq - Environmental sampling sequence entries, part 2.
30. gbenv3.seq - Environmental sampling sequence entries, part 3.
31. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
32. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
33. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
34. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
35. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
36. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
37. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
38. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
39. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
40. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
41. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
42. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
43. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
44. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
45. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
46. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
47. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
48. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
49. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
50. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
51. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
52. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
53. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
54. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
55. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
56. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
57. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
58. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
59. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
60. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
61. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
62. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
63. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
64. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
65. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
66. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
67. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
68. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
69. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
70. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
71. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
72. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
73. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
74. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
75. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
76. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
77. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
78. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
79. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
80. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
81. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
82. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
83. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
84. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
85. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
86. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
87. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
88. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
89. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
90. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
91. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
92. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
93. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
94. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
95. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
96. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
97. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
98. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
99. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
100. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
101. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
102. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
103. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
104. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
105. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
106. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
107. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
108. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
109. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
110. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
111. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
112. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
113. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
114. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
115. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
116. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
117. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
118. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
119. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
120. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
121. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
122. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
123. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
124. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
125. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
126. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
127. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
128. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
129. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
130. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
131. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
132. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
133. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
134. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
135. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
136. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
137. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
138. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
139. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
140. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
141. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
142. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
143. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
144. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
145. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
146. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
147. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
148. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
149. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
150. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
151. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
152. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
153. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
154. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
155. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
156. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
157. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
158. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
159. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
160. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
161. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
162. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
163. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
164. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
165. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
166. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
167. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
168. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
169. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
170. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
171. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
172. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
173. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
174. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
175. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
176. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
177. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
178. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
179. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
180. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
181. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
182. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
183. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
184. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
185. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
186. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
187. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
188. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
189. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
190. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
191. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
192. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
193. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
194. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
195. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
196. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
197. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
198. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
199. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
200. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
201. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
202. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
203. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
204. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
205. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
206. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
207. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
208. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
209. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
210. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
211. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
212. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
213. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
214. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
215. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
216. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
217. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
218. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
219. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
220. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
221. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
222. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
223. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
224. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
225. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
226. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
227. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
228. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
229. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
230. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
231. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
232. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
233. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
234. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
235. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
236. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
237. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
238. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
239. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
240. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
241. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
242. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
243. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
244. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
245. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
246. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
247. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
248. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
249. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
250. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
251. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
252. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
253. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
254. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
255. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
256. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
257. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
258. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
259. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
260. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
261. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
262. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
263. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
264. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
265. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
266. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
267. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
268. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
269. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
270. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
271. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
272. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
273. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
274. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
275. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
276. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
277. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
278. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
279. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
280. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
281. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
282. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
283. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
284. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
285. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
286. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
287. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
288. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
289. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
290. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
291. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
292. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
293. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
294. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
295. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
296. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
297. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
298. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
299. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
300. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
301. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
302. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
303. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
304. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
305. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
306. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
307. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
308. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
309. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
310. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
311. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
312. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
313. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
314. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
315. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
316. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
317. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
318. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
319. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
320. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
321. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
322. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
323. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
324. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
325. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
326. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
327. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
328. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
329. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
330. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
331. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
332. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
333. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
334. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
335. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
336. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
337. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
338. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
339. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
340. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
341. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
342. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
343. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
344. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
345. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
346. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
347. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
348. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
349. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
350. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
351. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
352. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
353. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
354. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
355. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
356. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
357. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
358. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
359. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
360. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
361. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
362. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
363. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
364. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
365. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
366. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
367. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
368. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
369. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
370. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
371. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
372. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
373. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
374. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
375. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
376. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
377. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
378. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
379. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
380. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
381. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
382. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
383. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
384. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
385. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
386. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
387. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
388. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
389. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
390. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
391. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
392. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
393. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
394. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
395. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
396. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
397. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
398. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
399. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
400. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
401. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
402. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
403. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
404. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
405. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
406. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
407. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
408. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
409. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
410. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
411. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
412. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
413. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
414. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
415. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
416. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
417. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
418. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
419. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
420. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
421. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
422. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
423. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
424. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
425. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
426. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
427. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
428. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
429. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
430. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
431. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
432. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
433. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
434. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
435. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
436. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
437. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
438. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
439. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
440. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
441. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
442. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
443. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
444. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
445. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
446. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
447. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
448. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
449. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
450. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
451. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
452. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
453. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
454. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
455. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
456. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
457. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
458. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
459. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
460. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
461. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
462. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
463. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
464. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
465. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
466. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
467. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
468. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
469. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
470. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
471. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
472. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
473. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
474. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
475. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
476. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
477. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
478. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
479. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
480. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
481. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
482. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
483. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
484. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
485. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
486. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
487. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
488. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
489. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
490. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
491. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
492. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
493. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
494. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
495. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
496. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
497. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
498. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
499. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
500. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
501. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
502. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
503. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
504. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
505. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
506. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
507. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
508. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
509. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
510. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
511. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
512. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
513. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
514. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
515. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
516. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
517. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
518. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
519. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
520. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
521. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
522. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
523. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
524. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
525. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
526. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
527. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
528. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
529. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
530. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
531. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
532. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
533. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
534. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
535. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
536. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
537. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
538. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
539. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
540. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
541. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
542. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
543. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
544. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
545. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
546. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
547. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
548. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
549. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
550. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
551. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
552. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
553. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
554. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
555. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
556. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
557. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
558. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
559. gbgen.idx - Index of the entries according to gene symbols.
560. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
561. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
562. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
563. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
564. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
565. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
566. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
567. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
568. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
569. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
570. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
571. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
572. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
573. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
574. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
575. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
576. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
577. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
578. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
579. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
580. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
581. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
582. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
583. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
584. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
585. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
586. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
587. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
588. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
589. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
590. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
591. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
592. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
593. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
594. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
595. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
596. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
597. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
598. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
599. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
600. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
601. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
602. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
603. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
604. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
605. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
606. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
607. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
608. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
609. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
610. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
611. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
612. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
613. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
614. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
615. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
616. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
617. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
618. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
619. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
620. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
621. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
622. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
623. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
624. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
625. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
626. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
627. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
628. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
629. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
630. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
631. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
632. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
633. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
634. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
635. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
636. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
637. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
638. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
639. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
640. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
641. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
642. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
643. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
644. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
645. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
646. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
647. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
648. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
649. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
650. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
651. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
652. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
653. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
654. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
655. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
656. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
657. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
658. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
659. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
660. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
661. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
662. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
663. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
664. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
665. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
666. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
667. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
668. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
669. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
670. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
671. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
672. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
673. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
674. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
675. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
676. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
677. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
678. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
679. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
680. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
681. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
682. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
683. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
684. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
685. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
686. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
687. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
688. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
689. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
690. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
691. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
692. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
693. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
694. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
695. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
696. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
697. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
698. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
699. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
700. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
701. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
702. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
703. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
704. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
705. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
706. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
707. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
708. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
709. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
710. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
711. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
712. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
713. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
714. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
715. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
716. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
717. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
718. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
719. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
720. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
721. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
722. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
723. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
724. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
725. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
726. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
727. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
728. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
729. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
730. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
731. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
732. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
733. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
734. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
735. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
736. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
737. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
738. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
739. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
740. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
741. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
742. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
743. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
744. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
745. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
746. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
747. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
748. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
749. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
750. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
751. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
752. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
753. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
754. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
755. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
756. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
757. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
758. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
759. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
760. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
761. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
762. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
763. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
764. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
765. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
766. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
767. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
768. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
769. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
770. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
771. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
772. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
773. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
774. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
775. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
776. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
777. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
778. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
779. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
780. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
781. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
782. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
783. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
784. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
785. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
786. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
787. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
788. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
789. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
790. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
791. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
792. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
793. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
794. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
795. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
796. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
797. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
798. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
799. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
800. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
801. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
802. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
803. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
804. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
805. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
806. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
807. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
808. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
809. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
810. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
811. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
812. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
813. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
814. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
815. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
816. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
817. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
818. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
819. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
820. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
821. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
822. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
823. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
824. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
825. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
826. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
827. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
828. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
829. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
830. gbinv1.seq - Invertebrate sequence entries, part 1.
831. gbinv2.seq - Invertebrate sequence entries, part 2.
832. gbinv3.seq - Invertebrate sequence entries, part 3.
833. gbinv4.seq - Invertebrate sequence entries, part 4.
834. gbinv5.seq - Invertebrate sequence entries, part 5.
835. gbinv6.seq - Invertebrate sequence entries, part 6.
836. gbinv7.seq - Invertebrate sequence entries, part 7.
837. gbinv8.seq - Invertebrate sequence entries, part 8.
838. gbinv9.seq - Invertebrate sequence entries, part 9.
839. gbjou.idx - Index of the entries according to journal citation.
840. gbkey.idx - Index of the entries according to keyword phrase.
841. gbmam1.seq - Other mammalian sequence entries, part 1.
842. gbmam2.seq - Other mammalian sequence entries, part 2.
843. gbnew.txt - Accession numbers of entries new since the previous release.
844. gbpat1.seq - Patent sequence entries, part 1.
845. gbpat10.seq - Patent sequence entries, part 10.
846. gbpat11.seq - Patent sequence entries, part 11.
847. gbpat12.seq - Patent sequence entries, part 12.
848. gbpat13.seq - Patent sequence entries, part 13.
849. gbpat14.seq - Patent sequence entries, part 14.
850. gbpat15.seq - Patent sequence entries, part 15.
851. gbpat16.seq - Patent sequence entries, part 16.
852. gbpat17.seq - Patent sequence entries, part 17.
853. gbpat18.seq - Patent sequence entries, part 18.
854. gbpat19.seq - Patent sequence entries, part 19.
855. gbpat2.seq - Patent sequence entries, part 2.
856. gbpat20.seq - Patent sequence entries, part 20.
857. gbpat21.seq - Patent sequence entries, part 21.
858. gbpat22.seq - Patent sequence entries, part 22.
859. gbpat23.seq - Patent sequence entries, part 23.
860. gbpat24.seq - Patent sequence entries, part 24.
861. gbpat3.seq - Patent sequence entries, part 3.
862. gbpat4.seq - Patent sequence entries, part 4.
863. gbpat5.seq - Patent sequence entries, part 5.
864. gbpat6.seq - Patent sequence entries, part 6.
865. gbpat7.seq - Patent sequence entries, part 7.
866. gbpat8.seq - Patent sequence entries, part 8.
867. gbpat9.seq - Patent sequence entries, part 9.
868. gbphg.seq - Phage sequence entries.
869. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
870. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
871. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
872. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
873. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
874. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
875. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
876. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
877. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
878. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
879. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
880. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
881. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
882. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
883. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
884. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
885. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
886. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
887. gbpri1.seq - Primate sequence entries, part 1.
888. gbpri10.seq - Primate sequence entries, part 10.
889. gbpri11.seq - Primate sequence entries, part 11.
890. gbpri12.seq - Primate sequence entries, part 12.
891. gbpri13.seq - Primate sequence entries, part 13.
892. gbpri14.seq - Primate sequence entries, part 14.
893. gbpri15.seq - Primate sequence entries, part 15.
894. gbpri16.seq - Primate sequence entries, part 16.
895. gbpri17.seq - Primate sequence entries, part 17.
896. gbpri18.seq - Primate sequence entries, part 18.
897. gbpri19.seq - Primate sequence entries, part 19.
898. gbpri2.seq - Primate sequence entries, part 2.
899. gbpri20.seq - Primate sequence entries, part 20.
900. gbpri21.seq - Primate sequence entries, part 21.
901. gbpri22.seq - Primate sequence entries, part 22.
902. gbpri23.seq - Primate sequence entries, part 23.
903. gbpri24.seq - Primate sequence entries, part 24.
904. gbpri25.seq - Primate sequence entries, part 25.
905. gbpri26.seq - Primate sequence entries, part 26.
906. gbpri27.seq - Primate sequence entries, part 27.
907. gbpri28.seq - Primate sequence entries, part 28.
908. gbpri29.seq - Primate sequence entries, part 29.
909. gbpri3.seq - Primate sequence entries, part 3.
910. gbpri30.seq - Primate sequence entries, part 30.
911. gbpri4.seq - Primate sequence entries, part 4.
912. gbpri5.seq - Primate sequence entries, part 5.
913. gbpri6.seq - Primate sequence entries, part 6.
914. gbpri7.seq - Primate sequence entries, part 7.
915. gbpri8.seq - Primate sequence entries, part 8.
916. gbpri9.seq - Primate sequence entries, part 9.
917. gbrel.txt - Release notes (this document).
918. gbrod1.seq - Rodent sequence entries, part 1.
919. gbrod10.seq - Rodent sequence entries, part 10.
920. gbrod11.seq - Rodent sequence entries, part 11.
921. gbrod12.seq - Rodent sequence entries, part 12.
922. gbrod13.seq - Rodent sequence entries, part 13.
923. gbrod14.seq - Rodent sequence entries, part 14.
924. gbrod15.seq - Rodent sequence entries, part 15.
925. gbrod16.seq - Rodent sequence entries, part 16.
926. gbrod17.seq - Rodent sequence entries, part 17.
927. gbrod18.seq - Rodent sequence entries, part 18.
928. gbrod19.seq - Rodent sequence entries, part 19.
929. gbrod2.seq - Rodent sequence entries, part 2.
930. gbrod20.seq - Rodent sequence entries, part 20.
931. gbrod21.seq - Rodent sequence entries, part 21.
932. gbrod22.seq - Rodent sequence entries, part 22.
933. gbrod23.seq - Rodent sequence entries, part 23.
934. gbrod24.seq - Rodent sequence entries, part 24.
935. gbrod3.seq - Rodent sequence entries, part 3.
936. gbrod4.seq - Rodent sequence entries, part 4.
937. gbrod5.seq - Rodent sequence entries, part 5.
938. gbrod6.seq - Rodent sequence entries, part 6.
939. gbrod7.seq - Rodent sequence entries, part 7.
940. gbrod8.seq - Rodent sequence entries, part 8.
941. gbrod9.seq - Rodent sequence entries, part 9.
942. gbsdr1.txt - Short directory of the data bank, part 1.
943. gbsdr2.txt - Short directory of the data bank, part 2.
944. gbsdr3.txt - Short directory of the data bank, part 3.
945. gbsec.idx - Index of the entries according to secondary accession number.
946. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
947. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
948. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
949. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
950. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
951. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
952. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
953. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
954. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
955. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
956. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
957. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
958. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
959. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
960. gbsyn.seq - Synthetic and chimeric sequence entries.
961. gbuna.seq - Unannotated sequence entries.
962. gbvrl1.seq - Viral sequence entries, part 1.
963. gbvrl2.seq - Viral sequence entries, part 2.
964. gbvrl3.seq - Viral sequence entries, part 3.
965. gbvrl4.seq - Viral sequence entries, part 4.
966. gbvrl5.seq - Viral sequence entries, part 5.
967. gbvrl6.seq - Viral sequence entries, part 6.
968. gbvrt1.seq - Other vertebrate sequence entries, part 1.
969. gbvrt10.seq - Other vertebrate sequence entries, part 10.
970. gbvrt11.seq - Other vertebrate sequence entries, part 11.
971. gbvrt2.seq - Other vertebrate sequence entries, part 2.
972. gbvrt3.seq - Other vertebrate sequence entries, part 3.
973. gbvrt4.seq - Other vertebrate sequence entries, part 4.
974. gbvrt5.seq - Other vertebrate sequence entries, part 5.
975. gbvrt6.seq - Other vertebrate sequence entries, part 6.
976. gbvrt7.seq - Other vertebrate sequence entries, part 7.
977. gbvrt8.seq - Other vertebrate sequence entries, part 8.
978. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 154.0 flatfiles require roughly 222 GB (sequence
files only) or 232 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1818222756 gbacc.idx
502774790 gbaut1.idx
500141891 gbaut2.idx
500159960 gbaut3.idx
500993004 gbaut4.idx
500625597 gbaut5.idx
348751203 gbaut6.idx
250010682 gbbct1.seq
252470794 gbbct10.seq
251545441 gbbct11.seq
251588292 gbbct12.seq
251512721 gbbct13.seq
250005863 gbbct14.seq
169497974 gbbct15.seq
250001960 gbbct2.seq
260109262 gbbct3.seq
250040717 gbbct4.seq
262840271 gbbct5.seq
250002637 gbbct6.seq
257596370 gbbct7.seq
250718965 gbbct8.seq
251911639 gbbct9.seq
34579799 gbchg.txt
101058774 gbcon1.seq
881853922 gbcon2.seq
974469867 gbcon3.seq
497920 gbdel.txt
250001937 gbenv1.seq
250000039 gbenv2.seq
167862147 gbenv3.seq
230688413 gbest1.seq
230689410 gbest10.seq
230689149 gbest100.seq
230687934 gbest101.seq
230689866 gbest102.seq
230688060 gbest103.seq
230688144 gbest104.seq
230688092 gbest105.seq
230690672 gbest106.seq
230688828 gbest107.seq
230688042 gbest108.seq
230688123 gbest109.seq
230688482 gbest11.seq
230687768 gbest110.seq
230690278 gbest111.seq
230689423 gbest112.seq
230619040 gbest113.seq
230688012 gbest114.seq
230689086 gbest115.seq
230687806 gbest116.seq
230687983 gbest117.seq
230689076 gbest118.seq
230689895 gbest119.seq
230688289 gbest12.seq
230690893 gbest120.seq
230688120 gbest121.seq
230690050 gbest122.seq
230690412 gbest123.seq
230688361 gbest124.seq
230689165 gbest125.seq
230688388 gbest126.seq
230688475 gbest127.seq
230687722 gbest128.seq
230687479 gbest129.seq
230688229 gbest13.seq
230690208 gbest130.seq
230687492 gbest131.seq
230689916 gbest132.seq
230687728 gbest133.seq
230688534 gbest134.seq
230689127 gbest135.seq
230689330 gbest136.seq
230690200 gbest137.seq
230690649 gbest138.seq
230690581 gbest139.seq
230689237 gbest14.seq
230689998 gbest140.seq
230692315 gbest141.seq
230689621 gbest142.seq
230688939 gbest143.seq
230688579 gbest144.seq
230689350 gbest145.seq
230687476 gbest146.seq
230689677 gbest147.seq
230689502 gbest148.seq
230687940 gbest149.seq
230688827 gbest15.seq
230689607 gbest150.seq
230688243 gbest151.seq
230689078 gbest152.seq
230688019 gbest153.seq
230688112 gbest154.seq
230688358 gbest155.seq
230688958 gbest156.seq
230690509 gbest157.seq
230689540 gbest158.seq
230689587 gbest159.seq
230687714 gbest16.seq
230689029 gbest160.seq
230688731 gbest161.seq
230687446 gbest162.seq
230687598 gbest163.seq
230690062 gbest164.seq
230689679 gbest165.seq
230688851 gbest166.seq
230690946 gbest167.seq
230687826 gbest168.seq
230688598 gbest169.seq
230687948 gbest17.seq
230688159 gbest170.seq
230688891 gbest171.seq
230689042 gbest172.seq
230689273 gbest173.seq
230688050 gbest174.seq
230689776 gbest175.seq
230689784 gbest176.seq
230688550 gbest177.seq
230687925 gbest178.seq
230687451 gbest179.seq
230688971 gbest18.seq
230690474 gbest180.seq
230689289 gbest181.seq
230371466 gbest182.seq
230689501 gbest183.seq
230690048 gbest184.seq
230688473 gbest185.seq
230688378 gbest186.seq
230690036 gbest187.seq
230689543 gbest188.seq
230688110 gbest189.seq
230687794 gbest19.seq
230687524 gbest190.seq
230688045 gbest191.seq
230688690 gbest192.seq
230689651 gbest193.seq
230690579 gbest194.seq
230690101 gbest195.seq
230687980 gbest196.seq
230688292 gbest197.seq
230689936 gbest198.seq
230690051 gbest199.seq
230688569 gbest2.seq
230688151 gbest20.seq
230689014 gbest200.seq
230688025 gbest201.seq
230688586 gbest202.seq
230689582 gbest203.seq
230687659 gbest204.seq
230687747 gbest205.seq
230687519 gbest206.seq
230687936 gbest207.seq
230689330 gbest208.seq
230688871 gbest209.seq
230689908 gbest21.seq
230689355 gbest210.seq
230689076 gbest211.seq
230690124 gbest212.seq
230687480 gbest213.seq
230687671 gbest214.seq
230688451 gbest215.seq
230689212 gbest216.seq
230688203 gbest217.seq
230689004 gbest218.seq
230688757 gbest219.seq
230689529 gbest22.seq
230689734 gbest220.seq
230690435 gbest221.seq
230689060 gbest222.seq
230692888 gbest223.seq
163606954 gbest224.seq
162250519 gbest225.seq
167603319 gbest226.seq
168180186 gbest227.seq
169751379 gbest228.seq
164654135 gbest229.seq
230688319 gbest23.seq
164967563 gbest230.seq
164350416 gbest231.seq
164512776 gbest232.seq
164449218 gbest233.seq
164452229 gbest234.seq
163608123 gbest235.seq
165211402 gbest236.seq
166004144 gbest237.seq
161866734 gbest238.seq
164254682 gbest239.seq
230689451 gbest24.seq
168907065 gbest240.seq
166963482 gbest241.seq
165618395 gbest242.seq
165748103 gbest243.seq
165391243 gbest244.seq
164917678 gbest245.seq
164220557 gbest246.seq
164316476 gbest247.seq
165416723 gbest248.seq
169595955 gbest249.seq
230690778 gbest25.seq
178918221 gbest250.seq
171266004 gbest251.seq
222328265 gbest252.seq
230690081 gbest253.seq
230688982 gbest254.seq
230689570 gbest255.seq
230688334 gbest256.seq
230690157 gbest257.seq
230690714 gbest258.seq
230690910 gbest259.seq
230688129 gbest26.seq
230688205 gbest260.seq
230689563 gbest261.seq
230687670 gbest262.seq
230688637 gbest263.seq
230689659 gbest264.seq
230690914 gbest265.seq
230688378 gbest266.seq
230689088 gbest267.seq
230689519 gbest268.seq
230690713 gbest269.seq
230689540 gbest27.seq
230690134 gbest270.seq
230689428 gbest271.seq
230690824 gbest272.seq
230688503 gbest273.seq
230688760 gbest274.seq
230690388 gbest275.seq
230687954 gbest276.seq
230687722 gbest277.seq
230690967 gbest278.seq
230689154 gbest279.seq
230688442 gbest28.seq
230689022 gbest280.seq
230689230 gbest281.seq
230687576 gbest282.seq
215421219 gbest283.seq
229887646 gbest284.seq
230690853 gbest285.seq
230692070 gbest286.seq
230688816 gbest287.seq
230689701 gbest288.seq
230688349 gbest289.seq
230687481 gbest29.seq
230688977 gbest290.seq
230688022 gbest291.seq
230690159 gbest292.seq
230687457 gbest293.seq
230688956 gbest294.seq
230687824 gbest295.seq
230688075 gbest296.seq
230688873 gbest297.seq
230688752 gbest298.seq
230689528 gbest299.seq
230690160 gbest3.seq
230689275 gbest30.seq
230688066 gbest300.seq
230689848 gbest301.seq
230689005 gbest302.seq
230687611 gbest303.seq
230687454 gbest304.seq
230689125 gbest305.seq
230690796 gbest306.seq
230688762 gbest307.seq
230689385 gbest308.seq
230687910 gbest309.seq
230688958 gbest31.seq
230691632 gbest310.seq
230689086 gbest311.seq
230688264 gbest312.seq
230687586 gbest313.seq
230688673 gbest314.seq
230687744 gbest315.seq
230688143 gbest316.seq
230687739 gbest317.seq
230688741 gbest318.seq
230690683 gbest319.seq
230690430 gbest32.seq
230690674 gbest320.seq
230687503 gbest321.seq
230690048 gbest322.seq
230688895 gbest323.seq
230688908 gbest324.seq
230689057 gbest325.seq
230690608 gbest326.seq
230689249 gbest327.seq
230689284 gbest328.seq
230689772 gbest329.seq
230688390 gbest33.seq
230688002 gbest330.seq
230687902 gbest331.seq
230688721 gbest332.seq
214783619 gbest333.seq
230690876 gbest334.seq
230690268 gbest335.seq
230687705 gbest336.seq
230688229 gbest337.seq
230687519 gbest338.seq
182845061 gbest339.seq
230687598 gbest34.seq
148021073 gbest340.seq
230690654 gbest341.seq
230689331 gbest342.seq
230688528 gbest343.seq
230689801 gbest344.seq
230688359 gbest345.seq
230689207 gbest346.seq
230689061 gbest347.seq
230688790 gbest348.seq
230687983 gbest349.seq
230688356 gbest35.seq
230688256 gbest350.seq
230687447 gbest351.seq
230687481 gbest352.seq
230690316 gbest353.seq
230690163 gbest354.seq
230694728 gbest355.seq
230687771 gbest356.seq
230687843 gbest357.seq
230690752 gbest358.seq
230687843 gbest359.seq
230688105 gbest36.seq
230688666 gbest360.seq
230688848 gbest361.seq
230687938 gbest362.seq
230687764 gbest363.seq
230687460 gbest364.seq
230690348 gbest365.seq
230688900 gbest366.seq
230688612 gbest367.seq
230687580 gbest368.seq
230689781 gbest369.seq
230688273 gbest37.seq
230689452 gbest370.seq
230690420 gbest371.seq
230688843 gbest372.seq
230691838 gbest373.seq
230691126 gbest374.seq
230689235 gbest375.seq
230687856 gbest376.seq
230688317 gbest377.seq
230689906 gbest378.seq
230688861 gbest379.seq
230688497 gbest38.seq
230689524 gbest380.seq
230688793 gbest381.seq
230687709 gbest382.seq
230690343 gbest383.seq
230689814 gbest384.seq
230392616 gbest385.seq
230688570 gbest386.seq
230689492 gbest387.seq
230687464 gbest388.seq
230688608 gbest389.seq
230688313 gbest39.seq
230690457 gbest390.seq
230687999 gbest391.seq
230687795 gbest392.seq
207801255 gbest393.seq
230689052 gbest394.seq
230688599 gbest395.seq
230687755 gbest396.seq
230688062 gbest397.seq
230689874 gbest398.seq
230691123 gbest399.seq
230687668 gbest4.seq
230688286 gbest40.seq
230690359 gbest400.seq
230688571 gbest401.seq
230687544 gbest402.seq
230689801 gbest403.seq
230690333 gbest404.seq
230689287 gbest405.seq
230690249 gbest406.seq
230688576 gbest407.seq
230690101 gbest408.seq
230688983 gbest409.seq
216654260 gbest41.seq
230688057 gbest410.seq
210539302 gbest411.seq
210255706 gbest412.seq
210192387 gbest413.seq
210388643 gbest414.seq
210296543 gbest415.seq
210454162 gbest416.seq
211650386 gbest417.seq
211629493 gbest418.seq
211251786 gbest419.seq
192264121 gbest42.seq
212935402 gbest420.seq
212699686 gbest421.seq
211083899 gbest422.seq
210904943 gbest423.seq
210937170 gbest424.seq
210141402 gbest425.seq
210185209 gbest426.seq
210294257 gbest427.seq
210148855 gbest428.seq
210039788 gbest429.seq
192198718 gbest43.seq
230689211 gbest430.seq
230690238 gbest431.seq
230689001 gbest432.seq
230691224 gbest433.seq
230689032 gbest434.seq
230689467 gbest435.seq
230687993 gbest436.seq
230688742 gbest437.seq
230688636 gbest438.seq
230688852 gbest439.seq
217251396 gbest44.seq
230697343 gbest440.seq
230690918 gbest441.seq
230690192 gbest442.seq
230690141 gbest443.seq
230688010 gbest444.seq
230689811 gbest445.seq
230688025 gbest446.seq
230690429 gbest447.seq
230690712 gbest448.seq
230688704 gbest449.seq
216194286 gbest45.seq
230689318 gbest450.seq
230689101 gbest451.seq
230688497 gbest452.seq
230691053 gbest453.seq
230690501 gbest454.seq
230687553 gbest455.seq
230689889 gbest456.seq
230690028 gbest457.seq
230690309 gbest458.seq
230688987 gbest459.seq
215921298 gbest46.seq
230687515 gbest460.seq
230688776 gbest461.seq
230688386 gbest462.seq
230689095 gbest463.seq
230687615 gbest464.seq
230688628 gbest465.seq
230689493 gbest466.seq
230691534 gbest467.seq
230687760 gbest468.seq
230690369 gbest469.seq
216906019 gbest47.seq
230688623 gbest470.seq
230688249 gbest471.seq
230689163 gbest472.seq
230689059 gbest473.seq
230689008 gbest474.seq
230689926 gbest475.seq
230692530 gbest476.seq
230689956 gbest477.seq
230690026 gbest478.seq
230687983 gbest479.seq
230688143 gbest48.seq
230690842 gbest480.seq
230690081 gbest481.seq
230689657 gbest482.seq
230688835 gbest483.seq
230688696 gbest484.seq
230690118 gbest485.seq
230689958 gbest486.seq
230689376 gbest487.seq
225039754 gbest488.seq
229578681 gbest489.seq
230687637 gbest49.seq
230690302 gbest490.seq
230687757 gbest491.seq
230687531 gbest492.seq
230688406 gbest493.seq
230688254 gbest494.seq
230687729 gbest495.seq
230688704 gbest496.seq
230689577 gbest497.seq
230687813 gbest498.seq
196044075 gbest499.seq
164127827 gbest5.seq
221353322 gbest50.seq
196031700 gbest500.seq
230687904 gbest501.seq
230688498 gbest502.seq
230689529 gbest503.seq
230689757 gbest504.seq
230688714 gbest505.seq
230687452 gbest506.seq
230688708 gbest507.seq
230689224 gbest508.seq
230688000 gbest509.seq
230689169 gbest51.seq
230689499 gbest510.seq
230687564 gbest511.seq
230688695 gbest512.seq
230690643 gbest513.seq
230690083 gbest514.seq
230687538 gbest515.seq
230688642 gbest516.seq
228148414 gbest517.seq
220119634 gbest518.seq
230688181 gbest519.seq
230687954 gbest52.seq
230687822 gbest520.seq
230687732 gbest521.seq
230690305 gbest522.seq
230689373 gbest523.seq
230688440 gbest524.seq
230688933 gbest525.seq
230687566 gbest526.seq
230689758 gbest527.seq
104761794 gbest528.seq
230689535 gbest53.seq
230690606 gbest54.seq
230689048 gbest55.seq
230688545 gbest56.seq
230689210 gbest57.seq
230689986 gbest58.seq
230689212 gbest59.seq
177450586 gbest6.seq
230689585 gbest60.seq
230688240 gbest61.seq
230688367 gbest62.seq
230687992 gbest63.seq
230689464 gbest64.seq
230689803 gbest65.seq
230691138 gbest66.seq
209767711 gbest67.seq
209435931 gbest68.seq
208376809 gbest69.seq
230687876 gbest7.seq
209170936 gbest70.seq
209978957 gbest71.seq
210097730 gbest72.seq
209012797 gbest73.seq
209073356 gbest74.seq
210252965 gbest75.seq
207886006 gbest76.seq
205630845 gbest77.seq
208360895 gbest78.seq
208448624 gbest79.seq
230687875 gbest8.seq
212380187 gbest80.seq
228422649 gbest81.seq
230689370 gbest82.seq
230690957 gbest83.seq
218857292 gbest84.seq
214784537 gbest85.seq
215401393 gbest86.seq
230687445 gbest87.seq
230687811 gbest88.seq
230689392 gbest89.seq
230688341 gbest9.seq
230690012 gbest90.seq
230688164 gbest91.seq
230688780 gbest92.seq
230688886 gbest93.seq
230689526 gbest94.seq
230687540 gbest95.seq
230689324 gbest96.seq
230690472 gbest97.seq
230691832 gbest98.seq
230687980 gbest99.seq
7476568 gbgen.idx
230688077 gbgss1.seq
230690432 gbgss10.seq
227886345 gbgss100.seq
227990727 gbgss101.seq
228595175 gbgss102.seq
228613321 gbgss103.seq
228208193 gbgss104.seq
227703768 gbgss105.seq
230687696 gbgss106.seq
230689915 gbgss107.seq
230690280 gbgss108.seq
230687785 gbgss109.seq
230689992 gbgss11.seq
230688889 gbgss110.seq
230690367 gbgss111.seq
230688015 gbgss112.seq
230689162 gbgss113.seq
230689035 gbgss114.seq
230689678 gbgss115.seq
230687999 gbgss116.seq
230688230 gbgss117.seq
230687616 gbgss118.seq
230688001 gbgss119.seq
230689920 gbgss12.seq
230690011 gbgss120.seq
230689907 gbgss121.seq
230689204 gbgss122.seq
230688413 gbgss123.seq
230689271 gbgss124.seq
230689921 gbgss125.seq
230688035 gbgss126.seq
230689066 gbgss127.seq
230690343 gbgss128.seq
230690024 gbgss129.seq
230689812 gbgss13.seq
230690365 gbgss130.seq
230689633 gbgss131.seq
230688559 gbgss132.seq
230689850 gbgss133.seq
230688289 gbgss134.seq
230688979 gbgss135.seq
230687896 gbgss136.seq
230688215 gbgss137.seq
230689830 gbgss138.seq
230687781 gbgss139.seq
230687451 gbgss14.seq
230688529 gbgss140.seq
230688900 gbgss141.seq
230688277 gbgss142.seq
224593337 gbgss143.seq
189354545 gbgss144.seq
250001930 gbgss145.seq
250000785 gbgss146.seq
250001678 gbgss147.seq
250001556 gbgss148.seq
250000623 gbgss149.seq
230688404 gbgss15.seq
250001984 gbgss150.seq
250003345 gbgss151.seq
250002313 gbgss152.seq
250000914 gbgss153.seq
250001403 gbgss154.seq
250002115 gbgss155.seq
250001459 gbgss156.seq
250001530 gbgss157.seq
250001528 gbgss158.seq
250000535 gbgss159.seq
230687864 gbgss16.seq
250000909 gbgss160.seq
250003011 gbgss161.seq
250002696 gbgss162.seq
250001093 gbgss163.seq
250001329 gbgss164.seq
250001116 gbgss165.seq
250000965 gbgss166.seq
250000320 gbgss167.seq
250000974 gbgss168.seq
250000798 gbgss169.seq
230688034 gbgss17.seq
250000215 gbgss170.seq
250000185 gbgss171.seq
250001504 gbgss172.seq
250003268 gbgss173.seq
250001824 gbgss174.seq
250001854 gbgss175.seq
250000079 gbgss176.seq
61387367 gbgss177.seq
230689215 gbgss18.seq
230687763 gbgss19.seq
230687684 gbgss2.seq
230688996 gbgss20.seq
230690281 gbgss21.seq
230688104 gbgss22.seq
230688067 gbgss23.seq
230687458 gbgss24.seq
230688206 gbgss25.seq
230687767 gbgss26.seq
230687881 gbgss27.seq
230689823 gbgss28.seq
230688048 gbgss29.seq
230690835 gbgss3.seq
230690495 gbgss30.seq
230689418 gbgss31.seq
230690646 gbgss32.seq
230690018 gbgss33.seq
230688763 gbgss34.seq
230688859 gbgss35.seq
230689149 gbgss36.seq
230688915 gbgss37.seq
230687484 gbgss38.seq
230689801 gbgss39.seq
230689817 gbgss4.seq
230687764 gbgss40.seq
230689526 gbgss41.seq
230688831 gbgss42.seq
230689014 gbgss43.seq
230688130 gbgss44.seq
230688856 gbgss45.seq
230687926 gbgss46.seq
230688026 gbgss47.seq
230689263 gbgss48.seq
230689341 gbgss49.seq
230687574 gbgss5.seq
230688340 gbgss50.seq
230689780 gbgss51.seq
230688844 gbgss52.seq
230688894 gbgss53.seq
230689804 gbgss54.seq
230689188 gbgss55.seq
230689588 gbgss56.seq
230689631 gbgss57.seq
230688299 gbgss58.seq
230689130 gbgss59.seq
230688137 gbgss6.seq
230688641 gbgss60.seq
229157095 gbgss61.seq
230688532 gbgss62.seq
230688018 gbgss63.seq
230688408 gbgss64.seq
230689529 gbgss65.seq
230688991 gbgss66.seq
230687583 gbgss67.seq
230688053 gbgss68.seq
230687549 gbgss69.seq
230690545 gbgss7.seq
230687676 gbgss70.seq
230688291 gbgss71.seq
230689326 gbgss72.seq
230687868 gbgss73.seq
230688327 gbgss74.seq
230688578 gbgss75.seq
230687622 gbgss76.seq
230687742 gbgss77.seq
230689652 gbgss78.seq
230687816 gbgss79.seq
230689401 gbgss8.seq
230689974 gbgss80.seq
207670583 gbgss81.seq
194700445 gbgss82.seq
212585205 gbgss83.seq
230688152 gbgss84.seq
230689496 gbgss85.seq
230688782 gbgss86.seq
230689271 gbgss87.seq
230688445 gbgss88.seq
230687501 gbgss89.seq
230687534 gbgss9.seq
230687644 gbgss90.seq
230688548 gbgss91.seq
230687577 gbgss92.seq
230689579 gbgss93.seq
230688392 gbgss94.seq
230687771 gbgss95.seq
230687749 gbgss96.seq
230689967 gbgss97.seq
230688194 gbgss98.seq
230689583 gbgss99.seq
250002720 gbhtc1.seq
109661558 gbhtc10.seq
250004729 gbhtc2.seq
250001020 gbhtc3.seq
250010590 gbhtc4.seq
250001817 gbhtc5.seq
250006494 gbhtc6.seq
250003169 gbhtc7.seq
250001129 gbhtc8.seq
250002827 gbhtc9.seq
250077774 gbhtg1.seq
250170849 gbhtg10.seq
250074897 gbhtg11.seq
250181876 gbhtg12.seq
250261908 gbhtg13.seq
250104477 gbhtg14.seq
250082071 gbhtg15.seq
250021199 gbhtg16.seq
250238784 gbhtg17.seq
250244382 gbhtg18.seq
250206454 gbhtg19.seq
250145747 gbhtg2.seq
250062581 gbhtg20.seq
250240248 gbhtg21.seq
250030871 gbhtg22.seq
250120281 gbhtg23.seq
250057894 gbhtg24.seq
250180229 gbhtg25.seq
250179328 gbhtg26.seq
250094585 gbhtg27.seq
250048560 gbhtg28.seq
250100692 gbhtg29.seq
250025205 gbhtg3.seq
250304792 gbhtg30.seq
250246489 gbhtg31.seq
250286947 gbhtg32.seq
250109199 gbhtg33.seq
250176654 gbhtg34.seq
250191386 gbhtg35.seq
250155883 gbhtg36.seq
250061521 gbhtg37.seq
250074409 gbhtg38.seq
250077721 gbhtg39.seq
250202359 gbhtg4.seq
250146781 gbhtg40.seq
250061803 gbhtg41.seq
250237302 gbhtg42.seq
250278071 gbhtg43.seq
250223355 gbhtg44.seq
250040911 gbhtg45.seq
250062437 gbhtg46.seq
250029526 gbhtg47.seq
250060649 gbhtg48.seq
250059844 gbhtg49.seq
250083748 gbhtg5.seq
250200966 gbhtg50.seq
250021589 gbhtg51.seq
250122252 gbhtg52.seq
250160143 gbhtg53.seq
250088998 gbhtg54.seq
250219796 gbhtg55.seq
250081270 gbhtg56.seq
250291160 gbhtg57.seq
250003005 gbhtg58.seq
250108648 gbhtg59.seq
250099103 gbhtg6.seq
250001870 gbhtg60.seq
250144369 gbhtg61.seq
250060600 gbhtg62.seq
250150641 gbhtg63.seq
250000866 gbhtg64.seq
250273921 gbhtg65.seq
250137500 gbhtg66.seq
250215569 gbhtg67.seq
250304585 gbhtg68.seq
250077305 gbhtg69.seq
250027749 gbhtg7.seq
250108428 gbhtg70.seq
250052652 gbhtg71.seq
250021281 gbhtg72.seq
250094920 gbhtg73.seq
250005764 gbhtg74.seq
250068310 gbhtg75.seq
250291502 gbhtg76.seq
250278695 gbhtg77.seq
250074554 gbhtg78.seq
250149186 gbhtg79.seq
250189742 gbhtg8.seq
250224834 gbhtg80.seq
250234286 gbhtg81.seq
251177945 gbhtg82.seq
43713913 gbhtg83.seq
250112662 gbhtg9.seq
250035877 gbinv1.seq
250056305 gbinv2.seq
250001303 gbinv3.seq
250001660 gbinv4.seq
250002297 gbinv5.seq
250007507 gbinv6.seq
250159247 gbinv7.seq
250037715 gbinv8.seq
12748559 gbinv9.seq
253601663 gbjou.idx
21420654 gbkey.idx
250002069 gbmam1.seq
202991131 gbmam2.seq
36195464 gbnew.txt
250000644 gbpat1.seq
250000260 gbpat10.seq
250004977 gbpat11.seq
250002522 gbpat12.seq
250000568 gbpat13.seq
250000325 gbpat14.seq
250000470 gbpat15.seq
250001269 gbpat16.seq
250000258 gbpat17.seq
250000779 gbpat18.seq
250000951 gbpat19.seq
250000950 gbpat2.seq
250000778 gbpat20.seq
250003228 gbpat21.seq
250005726 gbpat22.seq
250000655 gbpat23.seq
136744630 gbpat24.seq
250000793 gbpat3.seq
250003224 gbpat4.seq
250002402 gbpat5.seq
250000747 gbpat6.seq
250000042 gbpat7.seq
250001364 gbpat8.seq
250000295 gbpat9.seq
48835241 gbphg.seq
250106624 gbpln1.seq
278637250 gbpln10.seq
250001414 gbpln11.seq
250000602 gbpln12.seq
250000232 gbpln13.seq
250021193 gbpln14.seq
250001267 gbpln15.seq
250088885 gbpln16.seq
250001988 gbpln17.seq
34136822 gbpln18.seq
250023205 gbpln2.seq
283068951 gbpln3.seq
250000797 gbpln4.seq
250002815 gbpln5.seq
250000841 gbpln6.seq
250061281 gbpln7.seq
250089537 gbpln8.seq
294534612 gbpln9.seq
250118639 gbpri1.seq
250036073 gbpri10.seq
250205534 gbpri11.seq
250196460 gbpri12.seq
250123106 gbpri13.seq
250084047 gbpri14.seq
250150938 gbpri15.seq
250003120 gbpri16.seq
250001652 gbpri17.seq
250108797 gbpri18.seq
250117689 gbpri19.seq
250041680 gbpri2.seq
250016265 gbpri20.seq
250045674 gbpri21.seq
250121934 gbpri22.seq
250001212 gbpri23.seq
250000908 gbpri24.seq
250007502 gbpri25.seq
250000559 gbpri26.seq
250142844 gbpri27.seq
250014650 gbpri28.seq
250056592 gbpri29.seq
250049049 gbpri3.seq
112080151 gbpri30.seq
250116904 gbpri4.seq
250089310 gbpri5.seq
250001894 gbpri6.seq
250240640 gbpri7.seq
250015521 gbpri8.seq
250137154 gbpri9.seq
226522 gbrel.txt
250126733 gbrod1.seq
250037580 gbrod10.seq
250081067 gbrod11.seq
250015479 gbrod12.seq
250112932 gbrod13.seq
250212294 gbrod14.seq
250170324 gbrod15.seq
250041336 gbrod16.seq
250139326 gbrod17.seq
250150052 gbrod18.seq
250200766 gbrod19.seq
250170965 gbrod2.seq
250086205 gbrod20.seq
250006328 gbrod21.seq
250124662 gbrod22.seq
250004383 gbrod23.seq
105921381 gbrod24.seq
250003578 gbrod3.seq
250266411 gbrod4.seq
250153418 gbrod5.seq
250298197 gbrod6.seq
250041064 gbrod7.seq
250284195 gbrod8.seq
250115143 gbrod9.seq
600134815 gbsdr1.txt
2946764562 gbsdr2.txt
1164391525 gbsdr3.txt
404816 gbsec.idx
250001804 gbsts1.seq
250003891 gbsts10.seq
250003443 gbsts11.seq
250002327 gbsts12.seq
250000936 gbsts13.seq
39747254 gbsts14.seq
250000188 gbsts2.seq
250000419 gbsts3.seq
250002178 gbsts4.seq
250001253 gbsts5.seq
250004085 gbsts6.seq
250002618 gbsts7.seq
250002956 gbsts8.seq
250000551 gbsts9.seq
115667142 gbsyn.seq
419034 gbuna.seq
250004044 gbvrl1.seq
250001470 gbvrl2.seq
250002672 gbvrl3.seq
250001995 gbvrl4.seq
250000802 gbvrl5.seq
51127624 gbvrl6.seq
250000125 gbvrt1.seq
250003604 gbvrt10.seq
74348070 gbvrt11.seq
250046021 gbvrt2.seq
250001334 gbvrt3.seq
250009382 gbvrt4.seq
250110637 gbvrt5.seq
250081063 gbvrt6.seq
250079721 gbvrt7.seq
250001042 gbvrt8.seq
250207435 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 25389 102437874
BCT10 58 114535366
BCT11 55 112058430
BCT12 53 116039858
BCT13 1030 107119114
BCT14 57168 87428344
BCT15 21569 62102670
BCT2 4799 107677189
BCT3 117 116325957
BCT4 27036 102980765
BCT5 35267 100212922
BCT6 35736 99633191
BCT7 33850 103659427
BCT8 6446 102065706
BCT9 2274 101205167
ENV1 95594 71088121
ENV2 88744 80521384
ENV3 62427 54204274
EST1 68132 26291928
EST10 76538 29845881
EST100 70071 40328201
EST101 69073 36171364
EST102 72977 35980602
EST103 72346 46080559
EST104 72500 44813840
EST105 70041 42411623
EST106 72389 33396607
EST107 70030 29602754
EST108 66982 38060456
EST109 68886 36506294
EST11 75115 28773787
EST110 68119 43027658
EST111 73087 34779512
EST112 75050 34700936
EST113 74585 27273606
EST114 73589 35738185
EST115 73962 34643085
EST116 65402 38504090
EST117 80606 44335388
EST118 77486 44326540
EST119 68943 46677064
EST12 77707 30806669
EST120 67100 41004593
EST121 74429 50224651
EST122 69218 42123054
EST123 75530 44829754
EST124 73700 46011883
EST125 71552 48566491
EST126 73033 49188531
EST127 78801 42200074
EST128 75849 30707052
EST129 78851 37751101
EST13 77115 29303866
EST130 77817 44220615
EST131 76238 46200930
EST132 61965 29813012
EST133 72212 38660173
EST134 68693 39761226
EST135 65718 35937984
EST136 71862 42971382
EST137 72082 45056200
EST138 68511 39671819
EST139 72238 39411483
EST14 78466 31791252
EST140 70699 44336136
EST141 64836 39604434
EST142 71305 39675440
EST143 99591 54001097
EST144 72231 41031205
EST145 91382 47853474
EST146 106241 56293036
EST147 103291 56564836
EST148 91697 53418831
EST149 81886 47966401
EST15 74868 31627985
EST150 94296 55948917
EST151 98983 59868537
EST152 83236 45955414
EST153 71214 41654421
EST154 64876 31343960
EST155 63531 28951633
EST156 54205 25677144
EST157 65907 32305027
EST158 57052 28949884
EST159 74420 45237842
EST16 75816 33326488
EST160 68564 43551628
EST161 70382 49816273
EST162 76225 43655129
EST163 58684 30176633
EST164 64003 32460049
EST165 65663 38589803
EST166 64431 45628798
EST167 62490 35714473
EST168 100958 46132378
EST169 86167 49810981
EST17 82611 34107907
EST170 99802 56917432
EST171 99723 57704792
EST172 97102 51676216
EST173 96674 43648425
EST174 92189 43009413
EST175 93738 46537863
EST176 90517 36031567
EST177 90857 42670779
EST178 64169 45236421
EST179 70389 36971520
EST18 81052 32197750
EST180 57579 32844955
EST181 70705 44812106
EST182 73068 27358385
EST183 76214 43729713
EST184 72843 37866275
EST185 69020 35245137
EST186 68422 38504379
EST187 69657 51969857
EST188 68158 40220226
EST189 68682 34643388
EST19 78327 31882935
EST190 69330 52001789
EST191 68643 47507831
EST192 72854 37434958
EST193 68592 45830952
EST194 70410 58644256
EST195 64668 48017721
EST196 64370 47250215
EST197 64676 46698308
EST198 65604 46488659
EST199 67374 51127893
EST2 74651 28648243
EST20 74811 30649393
EST200 61453 39767513
EST201 62382 35183788
EST202 65374 37313357
EST203 69333 39206620
EST204 91397 51365678
EST205 70281 50069091
EST206 86131 50724958
EST207 106694 65958338
EST208 109051 64794174
EST209 108178 64586260
EST21 73419 34177074
EST210 103031 67100271
EST211 111608 53285328
EST212 97072 52818158
EST213 93652 51075636
EST214 97602 45195285
EST215 85909 50616101
EST216 67408 40627596
EST217 68089 52032025
EST218 68082 59053424
EST219 76096 51629620
EST22 75917 30463987
EST220 79348 38878806
EST221 76617 51457233
EST222 71821 51480004
EST223 67379 45339062
EST224 27718 10448485
EST225 27839 10447421
EST226 26962 9889686
EST227 26872 9594395
EST228 26652 9124655
EST229 27380 10147426
EST23 77299 32566612
EST230 27200 9646940
EST231 27250 9936030
EST232 27202 11310910
EST233 27161 11668744
EST234 27212 10790737
EST235 27490 9648228
EST236 27285 8882688
EST237 27255 10646448
EST238 27895 10998806
EST239 27564 10940900
EST24 74989 33171146
EST240 26670 11528808
EST241 26787 12115796
EST242 27130 10628489
EST243 27003 11144483
EST244 27039 11947567
EST245 27217 11408318
EST246 27276 10735270
EST247 27252 10934144
EST248 27142 10307550
EST249 26374 14013655
EST25 73539 31503180
EST250 24741 16971046
EST251 25913 17587773
EST252 82390 32873784
EST253 59328 36928832
EST254 88683 35232619
EST255 80200 39826175
EST256 69033 44541023
EST257 69155 44833316
EST258 69130 44271080
EST259 65230 40847523
EST26 75755 31309555
EST260 78106 43968216
EST261 63519 41290523
EST262 70104 45918256
EST263 57426 28472893
EST264 101720 47979833
EST265 87477 43925634
EST266 72116 40063994
EST267 61099 29535663
EST268 71422 42508864
EST269 71515 34758166
EST27 75347 32845083
EST270 71682 33762629
EST271 72623 45085286
EST272 70981 39175826
EST273 64596 38642253
EST274 73112 34710046
EST275 84645 46076045
EST276 72466 47336116
EST277 79086 53955922
EST278 95065 50435249
EST279 98702 46712426
EST28 108334 51503202
EST280 76886 42841875
EST281 68970 46126580
EST282 75667 34644222
EST283 70258 31548667
EST284 72588 34137037
EST285 66800 40324786
EST286 59757 37564159
EST287 67846 39184190
EST288 68253 43951511
EST289 60753 37936887
EST29 97469 46531947
EST290 86156 43759782
EST291 79444 40945460
EST292 71063 44084855
EST293 99732 56733621
EST294 118752 48848944
EST295 90774 41009801
EST296 64519 34902253
EST297 71095 43465916
EST298 82244 43609110
EST299 72139 39305558
EST3 73739 29916860
EST30 96747 53359531
EST300 69852 44505916
EST301 69262 38271820
EST302 63574 37304019
EST303 47130 25221182
EST304 72566 52519166
EST305 71256 40101284
EST306 76701 48366767
EST307 62617 34523609
EST308 68788 34937838
EST309 54049 27158948
EST31 79749 44129554
EST310 53294 27497456
EST311 52794 28216351
EST312 51947 27525116
EST313 52626 29056968
EST314 55953 23067791
EST315 55791 24084336
EST316 54178 22183923
EST317 55412 21733893
EST318 54738 21571494
EST319 56332 22864017
EST32 66023 52475437
EST320 55038 21406398
EST321 55972 20590596
EST322 59339 24578094
EST323 76562 42190089
EST324 74333 34065246
EST325 76197 31160092
EST326 74538 31688068
EST327 91039 54305138
EST328 73463 56720081
EST329 90556 56748471
EST33 75562 53195124
EST330 95648 57386422
EST331 97168 57775804
EST332 73947 45073809
EST333 75283 39287108
EST334 67800 53994742
EST335 64560 49380492
EST336 61000 44213813
EST337 61851 32405684
EST338 72454 48586086
EST339 57883 35674382
EST34 86780 46625489
EST340 49629 24665016
EST341 67704 36148793
EST342 65550 34855894
EST343 61639 30038141
EST344 63646 41307998
EST345 82093 44946377
EST346 72176 40748721
EST347 68520 41829410
EST348 70681 40422921
EST349 62535 42492419
EST35 87372 44730843
EST350 85583 49036599
EST351 84447 49928016
EST352 80088 43985789
EST353 64462 36242129
EST354 67842 36839560
EST355 71920 39559154
EST356 48507 24727176
EST357 63229 35898229
EST358 69611 42321626
EST359 98337 45738641
EST36 93826 52230556
EST360 75381 45048729
EST361 71462 47901820
EST362 71536 46041586
EST363 62672 35645718
EST364 74622 36425130
EST365 82902 38045047
EST366 57012 40376227
EST367 57284 38468816
EST368 62581 37526134
EST369 88321 52613065
EST37 78499 57765838
EST370 89677 48332803
EST371 66711 43528535
EST372 80090 41340633
EST373 50285 31670928
EST374 44231 23160867
EST375 71859 46569857
EST376 80168 40295144
EST377 79694 48035364
EST378 76052 46180946
EST379 81643 51416492
EST38 90811 47084407
EST380 78912 46990635
EST381 65695 38243363
EST382 64229 41963063
EST383 71501 38250335
EST384 53852 34570541
EST385 82126 27357966
EST386 81582 35808136
EST387 67075 39908837
EST388 66080 36994785
EST389 69323 38584281
EST39 88373 45461519
EST390 81472 48414074
EST391 62966 43480851
EST392 62443 39602976
EST393 78906 46009549
EST394 58735 34037927
EST395 64863 41804366
EST396 78154 48952790
EST397 85546 48830433
EST398 69203 41228131
EST399 58858 41183935
EST4 74569 28389457
EST40 103282 48031409
EST400 57106 40775335
EST401 57097 40669065
EST402 67192 40731024
EST403 67818 40939080
EST404 58853 37076609
EST405 59367 39265409
EST406 59261 40721745
EST407 60535 41735742
EST408 55470 41743546
EST409 51231 36493741
EST41 85833 32667951
EST410 93603 39818584
EST411 69557 38495793
EST412 69700 38408444
EST413 69803 38430313
EST414 69536 38695308
EST415 69625 38425885
EST416 69507 38753716
EST417 68919 38239433
EST418 68819 39356702
EST419 69066 38545762
EST42 68729 18389701
EST420 67790 36762602
EST421 68296 39132349
EST422 69430 39211604
EST423 69209 38268512
EST424 69373 38093283
EST425 69798 38076779
EST426 69841 38215124
EST427 69616 38541622
EST428 69814 38108981
EST429 70026 37211453
EST43 68586 18335232
EST430 90233 54600856
EST431 81523 37194893
EST432 72483 37222212
EST433 52263 40519626
EST434 63634 46403273
EST435 70742 38789744
EST436 57500 35362947
EST437 102788 53377780
EST438 92362 54194836
EST439 86576 53946670
EST44 61433 18815921
EST440 68036 46195956
EST441 42257 29200102
EST442 46962 58524773
EST443 61229 57388714
EST444 64606 43087100
EST445 74015 42584084
EST446 72089 43619598
EST447 66293 43689040
EST448 67177 43575728
EST449 64277 49803755
EST45 43712 11960099
EST450 109240 47873132
EST451 98643 47880345
EST452 64260 41242893
EST453 55866 40554174
EST454 55900 38507658
EST455 65107 45885528
EST456 66256 47018415
EST457 62462 46354514
EST458 52227 36986418
EST459 52197 38700001
EST46 43289 11900087
EST460 59856 42517098
EST461 62031 35895298
EST462 71456 45040268
EST463 57402 38213826
EST464 57163 39637941
EST465 59723 45457043
EST466 60011 46385161
EST467 58751 41430042
EST468 54962 41765499
EST469 52705 34958960
EST47 43174 11424357
EST470 53152 36677506
EST471 60320 39145321
EST472 69858 40818999
EST473 61817 45091367
EST474 76581 62228855
EST475 77038 50375920
EST476 54549 53288591
EST477 49006 53176162
EST478 63603 53715679
EST479 59800 38991113
EST48 82564 34347523
EST480 70359 39071858
EST481 84068 53440767
EST482 80616 53956707
EST483 80565 48842324
EST484 59200 38445218
EST485 74884 50960186
EST486 80678 49478019
EST487 78698 61371799
EST488 70491 47258965
EST489 72402 51539458
EST49 96614 43885023
EST490 68469 48006242
EST491 62288 49114422
EST492 66131 47385566
EST493 79651 43537844
EST494 89143 43218457
EST495 123731 40622724
EST496 78807 51728247
EST497 50501 49823131
EST498 71549 50826846
EST499 86995 31682842
EST5 48198 15295521
EST50 89161 46551583
EST500 87009 31661698
EST501 77055 43097746
EST502 91280 55523382
EST503 85229 47238681
EST504 68414 46597264
EST505 72423 46769473
EST506 81061 53537002
EST507 78482 50522403
EST508 73348 54146426
EST509 69252 52058001
EST51 88432 40195151
EST510 79666 57730603
EST511 88040 44618769
EST512 77756 40577788
EST513 82269 54536360
EST514 74774 56499059
EST515 69673 50364824
EST516 82168 44637197
EST517 107295 44327706
EST518 110900 49354975
EST519 126443 52397925
EST52 104037 54297457
EST520 132994 58850810
EST521 85266 32766745
EST522 70024 24791256
EST523 73286 27629472
EST524 73807 26134222
EST525 79313 26955516
EST526 74067 26959187
EST527 68597 29367823
EST528 37309 12770286
EST53 97300 48680026
EST54 77681 33498187
EST55 66359 28955902
EST56 73448 32314000
EST57 69346 29396699
EST58 83052 33289400
EST59 74048 29690719
EST6 54924 17445206
EST60 69659 28258098
EST61 65304 29359403
EST62 76580 35242647
EST63 74809 33195180
EST64 74588 28694817
EST65 77366 28077308
EST66 82319 38184229
EST67 40543 11644331
EST68 40429 11046978
EST69 40393 12519460
EST7 74544 29357938
EST70 40800 12648534
EST71 40836 12311864
EST72 40741 12932327
EST73 40580 12824191
EST74 40487 12150297
EST75 40161 12069576
EST76 41005 12697871
EST77 41338 11854980
EST78 41025 13064698
EST79 40851 13024063
EST8 75853 30597153
EST80 42636 12779398
EST81 46227 17791083
EST82 42540 26680595
EST83 42329 19099213
EST84 48747 19968811
EST85 50713 21948215
EST86 50533 21732020
EST87 83590 49237307
EST88 75933 37230471
EST89 73886 28216171
EST9 77568 29867722
EST90 73803 28939623
EST91 75247 41629867
EST92 77367 40732096
EST93 76097 43269291
EST94 76690 35029582
EST95 74000 43292651
EST96 71830 36564140
EST97 73913 38152123
EST98 72767 38694961
EST99 75118 41332839
GSS1 90427 38661176
GSS10 74870 43584742
GSS100 74989 42368480
GSS101 74332 43269222
GSS102 73629 45040039
GSS103 73604 45100522
GSS104 73270 45276061
GSS105 73294 44750127
GSS106 75837 48313583
GSS107 86676 57618295
GSS108 82312 55149981
GSS109 82719 51843534
GSS11 70615 35935175
GSS110 87724 53169755
GSS111 80145 63423338
GSS112 80480 47519036
GSS113 94587 52869806
GSS114 81673 50389415
GSS115 80861 54689130
GSS116 87082 69028161
GSS117 76895 44182783
GSS118 76613 51591624
GSS119 93571 48345731
GSS12 72880 38304785
GSS120 88267 55527860
GSS121 85656 53712978
GSS122 86901 56750888
GSS123 76600 62206197
GSS124 76643 68999218
GSS125 79249 61248945
GSS126 78674 54695884
GSS127 78762 54550100
GSS128 79110 54060556
GSS129 78841 54461052
GSS13 76710 38972527
GSS130 79296 53961093
GSS131 83981 60004421
GSS132 80976 58137965
GSS133 67167 56616698
GSS134 72087 55532681
GSS135 76500 68494180
GSS136 76203 62684216
GSS137 78606 52945398
GSS138 87021 53950602
GSS139 94727 58028309
GSS14 71294 32119834
GSS140 92854 59947845
GSS141 85439 56446800
GSS142 88126 45849571
GSS143 115381 59754744
GSS144 96972 48481201
GSS145 86832 64420446
GSS146 83574 62754367
GSS147 103238 48251782
GSS148 68488 58450645
GSS149 68286 58764457
GSS15 70057 34753284
GSS150 69349 56613361
GSS151 69610 56107267
GSS152 70360 55408449
GSS153 85833 73096867
GSS154 85359 39152211
GSS155 74964 33066604
GSS156 99500 75349447
GSS157 89186 41360470
GSS158 92284 63253928
GSS159 78713 64018585
GSS16 78474 46279427
GSS160 70304 59019273
GSS161 68302 63091443
GSS162 62745 54712669
GSS163 117472 70781322
GSS164 119026 74851838
GSS165 114278 72265249
GSS166 87628 49222754
GSS167 90237 55266340
GSS168 102928 71825010
GSS169 108147 77710650
GSS17 70905 33299465
GSS170 106271 79810349
GSS171 105896 80220054
GSS172 106014 70331716
GSS173 80304 43888591
GSS174 106192 51332384
GSS175 82062 60692950
GSS176 104440 51400761
GSS177 23831 10587382
GSS18 59066 27945653
GSS19 56793 29071416
GSS2 88926 39303697
GSS20 57668 26711331
GSS21 61484 29043687
GSS22 64941 38247108
GSS23 57530 27076838
GSS24 66155 42021939
GSS25 68222 28295497
GSS26 58177 25352279
GSS27 65296 31931766
GSS28 65540 32580714
GSS29 77208 39664312
GSS3 87398 41802021
GSS30 82963 39747672
GSS31 74191 40411407
GSS32 70581 48297720
GSS33 79811 37831802
GSS34 75888 40322506
GSS35 74118 40026623
GSS36 87368 56175713
GSS37 87598 58173229
GSS38 85545 44955496
GSS39 86867 50486743
GSS4 78874 41011062
GSS40 86278 40001306
GSS41 83186 31899999
GSS42 81247 56932703
GSS43 80142 58092618
GSS44 72026 47499046
GSS45 72036 47430677
GSS46 77682 45768214
GSS47 77857 38704557
GSS48 83235 58018576
GSS49 86567 64722481
GSS5 78791 40543955
GSS50 81608 54432268
GSS51 93879 59283478
GSS52 88559 58829378
GSS53 76600 42213950
GSS54 72859 40553922
GSS55 86514 47023747
GSS56 88086 58524679
GSS57 77051 64890987
GSS58 71989 79289622
GSS59 86884 69247311
GSS6 78151 38870151
GSS60 88544 59213499
GSS61 63416 45088143
GSS62 67061 45991222
GSS63 89650 67275315
GSS64 84980 57955097
GSS65 86071 53097057
GSS66 86454 56255938
GSS67 95452 58290365
GSS68 100714 54399125
GSS69 100604 54538148
GSS7 77733 39126124
GSS70 101399 53530978
GSS71 102480 52159759
GSS72 102413 52245362
GSS73 102577 52036510
GSS74 102151 52576547
GSS75 99627 55789785
GSS76 90051 69074887
GSS77 89844 70766190
GSS78 88287 69752904
GSS79 87837 69659978
GSS8 75721 38102431
GSS80 88017 61734279
GSS81 82918 31149482
GSS82 77836 24399651
GSS83 84732 33084785
GSS84 82005 50016436
GSS85 80194 45272855
GSS86 88079 61242116
GSS87 80629 59826368
GSS88 77054 79094233
GSS89 77418 62211621
GSS9 72104 37147963
GSS90 89925 48251131
GSS91 79188 45105713
GSS92 79826 45295873
GSS93 73361 62725039
GSS94 83829 51932991
GSS95 80886 57053102
GSS96 85698 56707922
GSS97 83773 57932820
GSS98 89189 52424535
GSS99 83365 72468544
HTC1 37148 54049779
HTC10 24346 42295521
HTC2 28557 64618005
HTC3 18241 42328023
HTC4 15822 39058962
HTC5 33607 32394353
HTC6 64679 54617974
HTC7 82433 69191853
HTC8 67295 60566970
HTC9 67578 78216614
HTG1 1315 188873586
HTG10 1242 186650227
HTG11 1431 184179327
HTG12 875 191964433
HTG13 750 192432006
HTG14 743 192221300
HTG15 781 192206872
HTG16 801 191984921
HTG17 768 192336719
HTG18 2048 171437583
HTG19 1052 188045013
HTG2 2563 186100623
HTG20 1000 189080891
HTG21 781 192047252
HTG22 924 190308180
HTG23 888 190841712
HTG24 820 191252083
HTG25 779 192123012
HTG26 848 191448324
HTG27 895 190812319
HTG28 937 190135666
HTG29 910 190888635
HTG3 2458 185319770
HTG30 925 190587619
HTG31 873 191462506
HTG32 971 189777453
HTG33 871 191236610
HTG34 857 191563606
HTG35 826 191951737
HTG36 911 190633135
HTG37 946 190542434
HTG38 953 190193820
HTG39 1015 189646490
HTG4 2519 188482648
HTG40 1185 187182445
HTG41 1220 188247342
HTG42 1217 188340440
HTG43 1175 186995770
HTG44 1096 191666281
HTG45 1212 190941202
HTG46 1252 190905827
HTG47 1137 190904976
HTG48 1031 191334712
HTG49 979 189902461
HTG5 1281 185650087
HTG50 1042 189586707
HTG51 958 189803726
HTG52 990 189687000
HTG53 987 189613610
HTG54 993 189655644
HTG55 933 189239221
HTG56 955 189074783
HTG57 1103 188529733
HTG58 993 189651813
HTG59 1047 187181694
HTG6 1273 185296258
HTG60 1080 187740063
HTG61 1054 188938800
HTG62 1027 189030193
HTG63 969 189201585
HTG64 1136 188508872
HTG65 1072 189400271
HTG66 1285 184741278
HTG67 1241 185708186
HTG68 1243 184752855
HTG69 1272 184591056
HTG7 1247 185472319
HTG70 1248 185076810
HTG71 1407 188084540
HTG72 1309 186935541
HTG73 1148 191099532
HTG74 1155 191020371
HTG75 1168 191485010
HTG76 1176 189331131
HTG77 1482 188814593
HTG78 1036 193629538
HTG79 1023 193851690
HTG8 1287 185088399
HTG80 835 181886636
HTG81 1183 193383198
HTG82 1152 192715468
HTG83 136 26517537
HTG9 1182 187153099
INV1 19145 158598728
INV2 1705 169192574
INV3 28156 121411040
INV4 79017 76272486
INV5 71742 74119364
INV6 75279 73110381
INV7 33804 119322854
INV8 62810 85543465
INV9 979 6227057
MAM1 50490 118952056
MAM2 49884 74137056
PAT1 222642 70162188
PAT10 141335 66383644
PAT11 107921 58771033
PAT12 103879 50193062
PAT13 116566 55600448
PAT14 110089 61120595
PAT15 148826 53294745
PAT16 156385 65713952
PAT17 104626 117452437
PAT18 141950 92188114
PAT19 110361 109439672
PAT2 194457 84679720
PAT20 129715 101248690
PAT21 104482 92630757
PAT22 102171 77602188
PAT23 104846 72578840
PAT24 102580 33238334
PAT3 172009 95885860
PAT4 153748 106061154
PAT5 160424 94250930
PAT6 149857 83324845
PAT7 106146 117756626
PAT8 145662 88586233
PAT9 126013 99791391
PHG 3101 19726147
PLN1 39939 115505097
PLN10 8 219884424
PLN11 38650 92371973
PLN12 74506 75283229
PLN13 76589 78645602
PLN14 56947 98908333
PLN15 34569 113105619
PLN16 66928 87507391
PLN17 37005 113795852
PLN18 7119 13338086
PLN2 1324 168832890
PLN3 2457 185171554
PLN4 65445 87666439
PLN5 76629 75896512
PLN6 30921 50623171
PLN7 14448 135990172
PLN8 1291 168689704
PLN9 579 213927250
PRI1 23363 138524389
PRI10 1448 181755438
PRI11 1303 179138124
PRI12 1529 178072771
PRI13 1591 179839660
PRI14 1505 185713524
PRI15 1225 192468452
PRI16 33949 135150492
PRI17 41480 83162709
PRI18 8370 167344139
PRI19 1645 184189670
PRI2 1491 172808699
PRI20 1781 182966427
PRI21 3020 180069061
PRI22 1441 184757091
PRI23 39361 113481517
PRI24 44712 75076321
PRI25 21160 117360570
PRI26 11017 169461065
PRI27 24011 148526605
PRI28 50647 117429428
PRI29 37279 128847867
PRI3 1282 186429260
PRI30 28897 41132541
PRI4 1318 183809766
PRI5 1191 181561702
PRI6 1214 178805261
PRI7 1230 180768190
PRI8 1364 174504171
PRI9 1225 177458892
ROD1 10379 167700909
ROD10 974 182194549
ROD11 1025 186757473
ROD12 967 183510605
ROD13 1019 186438891
ROD14 951 181456970
ROD15 964 182326213
ROD16 1050 186595236
ROD17 27933 144078413
ROD18 1157 189843924
ROD19 1208 193420581
ROD2 926 174097727
ROD20 1659 193121207
ROD21 45062 73617163
ROD22 14803 140420959
ROD23 50659 129586431
ROD24 28649 35867086
ROD3 903 173779689
ROD4 904 174195647
ROD5 927 173966191
ROD6 987 181465219
ROD7 970 179755353
ROD8 987 181737340
ROD9 1015 183257616
STS1 81929 35109152
STS10 58007 44374676
STS11 57856 43534685
STS12 73867 38687525
STS13 86153 38349770
STS14 17957 6860863
STS2 84097 44826169
STS3 76194 30740371
STS4 66989 33925537
STS5 54867 31982008
STS6 54730 32223059
STS7 54692 32190534
STS8 56288 38620762
STS9 57907 44422610
SYN 25784 38093496
UNA 211 114018
VRL1 72498 65582375
VRL2 72296 64714354
VRL3 68194 71196611
VRL4 66802 69021778
VRL5 76060 64685952
VRL6 12005 17165469
VRT1 39276 133299365
VRT10 37222 135538208
VRT11 22433 22372314
VRT2 39419 130730491
VRT3 49893 115824944
VRT4 61433 66647056
VRT5 13990 142047697
VRT6 1251 192439261
VRT7 1298 192139516
VRT8 13897 172620493
VRT9 11504 177482445
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 154.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
10433520 12321436050 Homo sapiens
6704756 8029286094 Mus musculus
1191913 5740616200 Rattus norvegicus
1563805 3494600956 Bos taurus
1251813 2502522564 Danio rerio
2308713 1761575401 Zea mays
1144296 1521175157 Oryza sativa (japonica cultivar-group)
215364 1244658132 Strongylocentrotus purpuratus
1196544 961026882 Sus scrofa
1174272 958688961 Xenopus tropicalis
1426688 866665458 Canis familiaris
652758 843522663 Drosophila melanogaster
1191474 748317687 Arabidopsis thaliana
788514 718808300 Gallus gallus
208717 637848613 Pan troglodytes
867485 503611267 Triticum aestivum
784163 465672251 Sorghum bicolor
397213 459697796 Medicago truncatula
69148 438387669 Macaca mulatta
696314 421325024 Ciona intestinalis
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 June 2006
NCBI-GenBank Flat File Release 154.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 154.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Mark Cavanaugh, WonHee Jang, Jonathan Kans,
Michael Kimelman, Jim Ostell, Lynn Schriml, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
