Release Notes For GenBank Release 155
GBREL.TXT Genetic Sequence Data Bank
August 15 2006
NCBI-GenBank Flat File Release 155.0
Distribution Release Notes
61132599 loci, 65369091950 bases, from 61132599 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 155.0
1.2 Cutoff Date
1.3 Important Changes in Release 155.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 155.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 155.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 155.0, incorporates data available to the collaborating
databases as of August 21, 2006 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 155.0
1.3.1 Organizational changes
The total number of sequence data files increased by 31 with this release:
- the BCT division is now comprised of 16 files (+1)
- the EST division is now comprised of 546 files (+18)
- the ENV division is now comprised of 4 files (+1)
- the GSS division is now comprised of 181 files (+4)
- the HTC division is now comprised of 12 files (+2)
- the HTG division is now comprised of 84 files (+1)
- the MAM division is now comprised of 3 files (+1)
- the PAT division is now comprised of 25 files (+1)
- the PRI division is now comprised of 31 files (+1)
- the ROD division is now comprised of 25 files (+1)
Reminder: the Short-Directory 'index' file is now split into
three pieces, as of GB 154 :
gbsdr1.txt : non-EST and non-GSS short directory entries
gbsdr2.txt : EST short directory entries
gbsdr3.txt : GSS short directory entries
1.3.2 Index files gbjou.idx and gbkey.idx not available.
Problems were encountered generating the journal and keyword 'index' files,
in spite of the recent changes which limit their content to non-EST and non-GSS
records (see Section 1.3.3 for a description of those changes).
Because Release 155.0 was already late due to other (unrelated) issues, we
are making this release available without gbjou.idx and gbkey.idx . If possible,
we will provide them within a few days of 155.0's availability, and let users
know via the GenBank listserv.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics since January 2005
seem to support this: the index files are transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 155.0 thus contains these ten index
files, which lack all EST and most GSS content:
gbaut1.idx
gbaut2.idx
gbaut3.idx
gbaut4.idx
gbaut5.idx
gbaut6.idx
gbgen.idx
gbjou.idx
gbkey.idx
gbsec.idx
In addition, a version of gbacc.idx which encompasses the entirety of the
release was built manually, but note that the first field contains just an
accession number, rather than Accession.Version, and that the file is unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options within the next year:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
thirty-three of the GSS flatfiles in Release 155.0. Consider gbgss149.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
August 15 2006
NCBI-GenBank Flat File Release 155.0
GSS Sequences (Part 1)
86836 loci, 64404216 bases, from 86836 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "149" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New protein residue abbreviation for Pyrrolysine
Sequence databases use single-letter amino acid abbreviations to
record the primary structure (sequence) of amino acids in a polypeptide.
The table of abbreviations includes only those amino acids that are
encoded in the genetic code and directly inserted by a tRNA during the
process of protein translation. Post-translational modifications are
not represented in the sequence data itself, but may be described by
features annotated on the sequence.
The discovery of the 22nd naturally encoded amino acid, pyrrolysine,
and the recent submission of sequence records that should contain
this residue, require the adoption of a new amino acid abbreviation.
Because several letters are assigned to represent different experimental
ambiguities, the only letter still available for use is O (uppercase
letter o). Scientists working in the field have independently suggested
use of this letter, and it has a reasonable mnemonic, pyrrOlysine.
The IUPAC-IUBMB Joint Commission on Biochemical Nomenclature has agreed
that Pyl/O will be recommended for this amino acid.
The consequences for flatfile users are that O will appear in CDS
/translation qualifiers, and that Pyl (the three-letter abbreviation)
will appear in CDS /transl_except qualifiers and in the /product and
/anticodon qualifiers of tRNA features. These changes will take effect
as of the October 2006 GenBank release.
Sample records in ASN.1, FASTA, GenBank flatfile, and INSDSeq XML
formats will be made available on the NCBI ftp site for the purpose of
testing software prior to the public introduction of 'O' in protein
sequences.
For BLAST and other sequence similarity search tools, we expect to map
pyrrolysine (O) to unknown (X), as is already done with selenocysteine
(U), the 21st naturally encoded amino acid. One reason is that the PAM
and BLOSUM substitution matrices do not accommodate these more recently
discovered amino acids. The other reason is that selenocysteine and
pyrrolysine both appear to be used as active sites in certain enzymes,
and thus do not simply substitute for cysteine or lysine.
Here are a few literature references which provide more information
about pyrrolysine :
G. Srinivasan, C. M. James, J. A. Krzycki. Pyrrolysine encoded by
UAG in Archaea: charging of a UAG-decoding specialized tRNA. Science
2002, 296:1459-1462.
B. Hao, W. Gong, T.K. Ferguson, C.M. James, J.A. Krzycki, M.K.
Chan. A new UAG-encoded residue in the structure of a methanogen
methyltransferase. Science 2002, 296:1462-1466.
C. Polycarpo, A. Ambrogelly, A. Berube, S.M. Winbush, J.A.
McCloskey, P. F. Crain, J. L. Wood, D. Soll. An aminoacyl-tRNA
synthetase that specifically activates pyrrolysine. Proc. Natl. Acad.
Sci. (USA) 2004, 101:12450-12454.
C. Fenske, G.J. Palm, W. Hinrichs. How unique is the genetic code?
Agnew. Chem. Int. Ed. 2003, 42:606-610.
1.4.2 Protein residue J for leucine/isoleucine ambiguities
The residue abbreviation J is reserved for mass spectrometry experiments that
cannot distinguish leucine from isoleucine. Although this abbreviation has
been part of the IUPAC recommendations for some time, it has not previously
appeared in protein sequences in the GenBank database.
As of October 2006, abbreviation J will be legal in CDS /translation
qualifiers, and Xle (the three-letter abbreviation) will be allowed in CDS
/transl_except qualifiers and in the /product and /anticodon qualifiers of
tRNA features.
J will also be mapped to unknown (X) for the purpose of BLAST and other
sequence similarity search tools.
1.4.3 /PCR_primers and modified bases
PCR primers are sometimes constructed which utilize modified bases,
such as those listed in the table of modified bases included in the
Feature Table document:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html#7.5.2
In October 2006, it will be legal to use modified-base abbreviations
for the /PCR_primers qualifier. For example:
/PCR_primers="fwd_seq: gcagtt<i>caag<gal q>tggagtgaa, rev_seq:
gcaacgtatcctccagagtgatcgb
Here, modified bases inosine and beta,D-galactosylqueosine are included
in the forward sequence of the primer pair, and enclosed between angle
brackets ( <...> ) .
Each pair of angle brackets will include only a single modified base
abbreviation.
1.4.4 Introduction of /mobile_element qualifier
For repeat_region features, the /transposon and /insertion_seq
qualifiers can be used to describe two specific classes of mobile
elements. But not all mobile elements fall into these two categories,
so a new structured /mobile_element qualifier will be introduced
as of GenBank 155.0 in December 2006. The preliminary description
of the new qualifier is as follows:
Qualifer: /mobile_element
Description: Type, and name (or identifier), of the mobile element
which is described by the parent feature.
Value format: <mobile_element_type>:<mobile_element_id>
Where mobile element type is one of the following: transposon,
integron, insertion_sequence, other .
Example: /mobile_element="transposon:Tnp9"
Further details about this new qualifier, the domain of mobile element
types in particular, will be provided in these release notes and via the
GenBank newsgroup as they become available.
1.4.5 New /mol_type value
A new legal molecule type value for viral cRNA sequences will be
introduced as of October 2006:
/mol_type="viral cRNA"
This value will also be legal for the molecule type field on the
LOCUS line of the GenBank flatfile format. Additional details about
the usage of this new molecule type value will be provided via
these release notes and the GenBank newsgroup.
1.4.6 Feature location syntax X.Y to be discontinued
The Feature Table currently supports feature locations of the
format X.Y, to represent a base position which is greater or
equal to X, and less than or equal to Y. For example:
misc_feature 1.10..20
misc_feature join(100..150,200.210..250)
In the first example, the misc_feature starts somewhere between
bases 1 and 10 (inclusive), and ends at basepair 20. In the second,
the 51 bases from 100..150 are joined together with a second basepair
interval, which could be anywhere from 200..250 to 210..250 .
Although this syntax seems like a reasonable way to capture an
uncertain interval, it is used for features on a vanishingly small
number of sequence records, most database submission mechanisms
don't support it, and the meaning of its use in a join() context
is not entirely clear.
As of October 2006, this type of location will no longer be
supported. Those records with features which utilize X.Y locations
will be reviewed and converted to a non-uncertain format prior to
that date.
1.4.7 /operon to become legal for rRNA features
With the October 2006 GenBank release, the /operon qualifier will
be legal for use on rRNA features.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1010 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc.idx - Index of the entries according to accession number.
2. gbaut1.idx - Index of the entries according to accession number, part 1.
3. gbaut2.idx - Index of the entries according to accession number, part 2.
4. gbaut3.idx - Index of the entries according to accession number, part 3.
5. gbaut4.idx - Index of the entries according to accession number, part 4.
6. gbaut5.idx - Index of the entries according to accession number, part 5.
7. gbaut6.idx - Index of the entries according to accession number, part 6.
8. gbaut7.idx - Index of the entries according to accession number, part 7.
9. gbbct1.seq - Bacterial sequence entries, part 1.
10. gbbct10.seq - Bacterial sequence entries, part 10.
11. gbbct11.seq - Bacterial sequence entries, part 11.
12. gbbct12.seq - Bacterial sequence entries, part 12.
13. gbbct13.seq - Bacterial sequence entries, part 13.
14. gbbct14.seq - Bacterial sequence entries, part 14.
15. gbbct15.seq - Bacterial sequence entries, part 15.
16. gbbct16.seq - Bacterial sequence entries, part 16.
17. gbbct2.seq - Bacterial sequence entries, part 2.
18. gbbct3.seq - Bacterial sequence entries, part 3.
19. gbbct4.seq - Bacterial sequence entries, part 4.
20. gbbct5.seq - Bacterial sequence entries, part 5.
21. gbbct6.seq - Bacterial sequence entries, part 6.
22. gbbct7.seq - Bacterial sequence entries, part 7.
23. gbbct8.seq - Bacterial sequence entries, part 8.
24. gbbct9.seq - Bacterial sequence entries, part 9.
25. gbchg.txt - Accession numbers of entries updated since the previous release.
26. gbcon1.seq - Constructed sequence entries, part 1.
27. gbcon2.seq - Constructed sequence entries, part 2.
28. gbcon3.seq - Constructed sequence entries, part 3.
29. gbdel.txt - Accession numbers of entries deleted since the previous release.
30. gbenv1.seq - Environmental sampling sequence entries, part 1.
31. gbenv2.seq - Environmental sampling sequence entries, part 2.
32. gbenv3.seq - Environmental sampling sequence entries, part 3.
33. gbenv4.seq - Environmental sampling sequence entries, part 4.
34. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
35. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
36. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
37. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
38. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
39. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
40. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
41. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
42. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
43. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
44. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
45. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
46. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
47. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
48. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
49. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
50. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
51. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
52. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
53. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
54. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
55. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
56. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
57. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
58. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
59. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
60. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
61. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
62. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
63. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
64. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
65. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
66. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
67. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
68. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
69. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
70. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
71. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
72. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
73. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
74. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
75. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
76. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
77. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
78. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
79. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
80. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
81. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
82. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
83. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
84. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
85. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
86. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
87. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
88. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
89. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
90. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
91. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
92. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
93. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
94. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
95. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
96. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
97. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
98. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
99. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
100. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
101. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
102. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
103. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
104. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
105. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
106. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
107. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
108. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
109. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
110. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
111. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
112. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
113. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
114. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
115. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
116. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
117. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
118. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
119. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
120. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
121. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
122. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
123. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
124. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
125. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
126. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
127. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
128. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
129. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
130. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
131. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
132. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
133. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
134. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
135. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
136. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
137. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
138. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
139. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
140. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
141. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
142. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
143. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
144. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
145. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
146. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
147. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
148. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
149. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
150. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
151. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
152. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
153. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
154. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
155. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
156. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
157. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
158. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
159. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
160. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
161. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
162. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
163. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
164. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
165. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
166. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
167. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
168. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
169. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
170. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
171. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
172. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
173. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
174. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
175. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
176. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
177. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
178. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
179. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
180. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
181. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
182. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
183. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
184. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
185. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
186. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
187. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
188. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
189. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
190. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
191. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
192. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
193. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
194. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
195. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
196. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
197. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
198. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
199. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
200. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
201. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
202. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
203. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
204. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
205. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
206. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
207. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
208. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
209. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
210. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
211. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
212. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
213. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
214. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
215. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
216. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
217. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
218. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
219. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
220. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
221. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
222. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
223. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
224. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
225. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
226. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
227. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
228. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
229. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
230. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
231. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
232. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
233. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
234. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
235. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
236. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
237. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
238. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
239. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
240. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
241. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
242. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
243. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
244. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
245. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
246. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
247. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
248. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
249. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
250. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
251. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
252. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
253. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
254. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
255. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
256. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
257. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
258. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
259. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
260. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
261. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
262. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
263. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
264. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
265. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
266. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
267. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
268. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
269. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
270. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
271. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
272. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
273. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
274. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
275. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
276. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
277. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
278. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
279. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
280. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
281. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
282. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
283. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
284. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
285. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
286. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
287. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
288. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
289. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
290. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
291. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
292. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
293. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
294. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
295. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
296. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
297. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
298. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
299. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
300. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
301. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
302. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
303. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
304. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
305. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
306. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
307. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
308. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
309. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
310. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
311. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
312. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
313. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
314. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
315. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
316. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
317. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
318. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
319. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
320. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
321. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
322. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
323. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
324. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
325. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
326. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
327. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
328. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
329. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
330. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
331. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
332. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
333. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
334. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
335. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
336. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
337. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
338. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
339. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
340. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
341. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
342. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
343. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
344. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
345. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
346. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
347. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
348. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
349. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
350. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
351. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
352. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
353. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
354. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
355. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
356. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
357. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
358. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
359. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
360. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
361. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
362. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
363. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
364. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
365. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
366. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
367. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
368. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
369. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
370. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
371. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
372. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
373. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
374. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
375. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
376. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
377. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
378. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
379. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
380. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
381. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
382. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
383. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
384. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
385. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
386. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
387. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
388. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
389. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
390. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
391. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
392. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
393. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
394. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
395. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
396. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
397. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
398. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
399. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
400. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
401. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
402. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
403. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
404. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
405. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
406. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
407. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
408. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
409. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
410. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
411. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
412. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
413. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
414. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
415. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
416. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
417. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
418. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
419. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
420. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
421. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
422. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
423. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
424. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
425. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
426. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
427. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
428. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
429. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
430. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
431. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
432. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
433. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
434. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
435. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
436. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
437. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
438. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
439. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
440. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
441. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
442. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
443. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
444. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
445. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
446. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
447. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
448. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
449. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
450. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
451. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
452. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
453. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
454. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
455. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
456. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
457. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
458. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
459. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
460. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
461. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
462. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
463. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
464. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
465. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
466. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
467. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
468. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
469. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
470. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
471. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
472. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
473. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
474. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
475. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
476. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
477. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
478. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
479. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
480. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
481. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
482. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
483. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
484. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
485. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
486. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
487. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
488. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
489. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
490. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
491. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
492. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
493. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
494. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
495. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
496. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
497. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
498. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
499. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
500. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
501. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
502. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
503. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
504. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
505. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
506. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
507. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
508. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
509. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
510. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
511. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
512. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
513. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
514. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
515. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
516. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
517. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
518. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
519. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
520. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
521. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
522. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
523. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
524. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
525. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
526. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
527. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
528. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
529. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
530. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
531. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
532. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
533. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
534. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
535. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
536. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
537. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
538. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
539. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
540. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
541. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
542. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
543. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
544. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
545. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
546. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
547. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
548. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
549. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
550. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
551. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
552. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
553. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
554. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
555. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
556. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
557. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
558. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
559. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
560. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
561. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
562. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
563. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
564. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
565. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
566. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
567. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
568. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
569. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
570. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
571. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
572. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
573. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
574. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
575. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
576. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
577. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
578. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
579. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
580. gbgen.idx - Index of the entries according to gene symbols.
581. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
582. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
583. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
584. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
585. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
586. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
587. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
588. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
589. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
590. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
591. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
592. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
593. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
594. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
595. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
596. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
597. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
598. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
599. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
600. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
601. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
602. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
603. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
604. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
605. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
606. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
607. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
608. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
609. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
610. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
611. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
612. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
613. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
614. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
615. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
616. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
617. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
618. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
619. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
620. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
621. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
622. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
623. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
624. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
625. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
626. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
627. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
628. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
629. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
630. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
631. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
632. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
633. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
634. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
635. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
636. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
637. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
638. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
639. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
640. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
641. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
642. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
643. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
644. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
645. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
646. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
647. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
648. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
649. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
650. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
651. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
652. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
653. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
654. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
655. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
656. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
657. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
658. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
659. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
660. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
661. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
662. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
663. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
664. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
665. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
666. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
667. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
668. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
669. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
670. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
671. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
672. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
673. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
674. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
675. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
676. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
677. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
678. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
679. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
680. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
681. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
682. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
683. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
684. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
685. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
686. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
687. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
688. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
689. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
690. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
691. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
692. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
693. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
694. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
695. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
696. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
697. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
698. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
699. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
700. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
701. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
702. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
703. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
704. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
705. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
706. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
707. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
708. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
709. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
710. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
711. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
712. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
713. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
714. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
715. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
716. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
717. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
718. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
719. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
720. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
721. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
722. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
723. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
724. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
725. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
726. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
727. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
728. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
729. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
730. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
731. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
732. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
733. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
734. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
735. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
736. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
737. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
738. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
739. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
740. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
741. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
742. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
743. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
744. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
745. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
746. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
747. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
748. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
749. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
750. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
751. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
752. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
753. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
754. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
755. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
756. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
757. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
758. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
759. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
760. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
761. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
762. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
763. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
764. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
765. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
766. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
767. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
768. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
769. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
770. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
771. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
772. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
773. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
774. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
775. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
776. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
777. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
778. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
779. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
780. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
781. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
782. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
783. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
784. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
785. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
786. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
787. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
788. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
789. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
790. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
791. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
792. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
793. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
794. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
795. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
796. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
797. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
798. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
799. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
800. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
801. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
802. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
803. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
804. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
805. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
806. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
807. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
808. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
809. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
810. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
811. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
812. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
813. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
814. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
815. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
816. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
817. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
818. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
819. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
820. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
821. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
822. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
823. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
824. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
825. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
826. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
827. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
828. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
829. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
830. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
831. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
832. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
833. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
834. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
835. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
836. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
837. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
838. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
839. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
840. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
841. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
842. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
843. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
844. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
845. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
846. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
847. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
848. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
849. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
850. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
851. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
852. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
853. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
854. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
855. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
856. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
857. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
858. gbinv1.seq - Invertebrate sequence entries, part 1.
859. gbinv2.seq - Invertebrate sequence entries, part 2.
860. gbinv3.seq - Invertebrate sequence entries, part 3.
861. gbinv4.seq - Invertebrate sequence entries, part 4.
862. gbinv5.seq - Invertebrate sequence entries, part 5.
863. gbinv6.seq - Invertebrate sequence entries, part 6.
864. gbinv7.seq - Invertebrate sequence entries, part 7.
865. gbinv8.seq - Invertebrate sequence entries, part 8.
866. gbinv9.seq - Invertebrate sequence entries, part 9.
867. gbjou.idx - Index of the entries according to journal citation.
868. gbkey.idx - Index of the entries according to keyword phrase.
869. gbmam1.seq - Other mammalian sequence entries, part 1.
870. gbmam2.seq - Other mammalian sequence entries, part 2.
871. gbmam3.seq - Other mammalian sequence entries, part 3.
872. gbnew.txt - Accession numbers of entries new since the previous release.
873. gbpat1.seq - Patent sequence entries, part 1.
874. gbpat10.seq - Patent sequence entries, part 10.
875. gbpat11.seq - Patent sequence entries, part 11.
876. gbpat12.seq - Patent sequence entries, part 12.
877. gbpat13.seq - Patent sequence entries, part 13.
878. gbpat14.seq - Patent sequence entries, part 14.
879. gbpat15.seq - Patent sequence entries, part 15.
880. gbpat16.seq - Patent sequence entries, part 16.
881. gbpat17.seq - Patent sequence entries, part 17.
882. gbpat18.seq - Patent sequence entries, part 18.
883. gbpat19.seq - Patent sequence entries, part 19.
884. gbpat2.seq - Patent sequence entries, part 2.
885. gbpat20.seq - Patent sequence entries, part 20.
886. gbpat21.seq - Patent sequence entries, part 21.
887. gbpat22.seq - Patent sequence entries, part 22.
888. gbpat23.seq - Patent sequence entries, part 23.
889. gbpat24.seq - Patent sequence entries, part 24.
890. gbpat25.seq - Patent sequence entries, part 25.
891. gbpat3.seq - Patent sequence entries, part 3.
892. gbpat4.seq - Patent sequence entries, part 4.
893. gbpat5.seq - Patent sequence entries, part 5.
894. gbpat6.seq - Patent sequence entries, part 6.
895. gbpat7.seq - Patent sequence entries, part 7.
896. gbpat8.seq - Patent sequence entries, part 8.
897. gbpat9.seq - Patent sequence entries, part 9.
898. gbphg.seq - Phage sequence entries.
899. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
900. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
901. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
902. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
903. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
904. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
905. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
906. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
907. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
908. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
909. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
910. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
911. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
912. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
913. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
914. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
915. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
916. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
917. gbpri1.seq - Primate sequence entries, part 1.
918. gbpri10.seq - Primate sequence entries, part 10.
919. gbpri11.seq - Primate sequence entries, part 11.
920. gbpri12.seq - Primate sequence entries, part 12.
921. gbpri13.seq - Primate sequence entries, part 13.
922. gbpri14.seq - Primate sequence entries, part 14.
923. gbpri15.seq - Primate sequence entries, part 15.
924. gbpri16.seq - Primate sequence entries, part 16.
925. gbpri17.seq - Primate sequence entries, part 17.
926. gbpri18.seq - Primate sequence entries, part 18.
927. gbpri19.seq - Primate sequence entries, part 19.
928. gbpri2.seq - Primate sequence entries, part 2.
929. gbpri20.seq - Primate sequence entries, part 20.
930. gbpri21.seq - Primate sequence entries, part 21.
931. gbpri22.seq - Primate sequence entries, part 22.
932. gbpri23.seq - Primate sequence entries, part 23.
933. gbpri24.seq - Primate sequence entries, part 24.
934. gbpri25.seq - Primate sequence entries, part 25.
935. gbpri26.seq - Primate sequence entries, part 26.
936. gbpri27.seq - Primate sequence entries, part 27.
937. gbpri28.seq - Primate sequence entries, part 28.
938. gbpri29.seq - Primate sequence entries, part 29.
939. gbpri3.seq - Primate sequence entries, part 3.
940. gbpri30.seq - Primate sequence entries, part 30.
941. gbpri31.seq - Primate sequence entries, part 31.
942. gbpri4.seq - Primate sequence entries, part 4.
943. gbpri5.seq - Primate sequence entries, part 5.
944. gbpri6.seq - Primate sequence entries, part 6.
945. gbpri7.seq - Primate sequence entries, part 7.
946. gbpri8.seq - Primate sequence entries, part 8.
947. gbpri9.seq - Primate sequence entries, part 9.
948. gbrel.txt - Release notes (this document).
949. gbrod1.seq - Rodent sequence entries, part 1.
950. gbrod10.seq - Rodent sequence entries, part 10.
951. gbrod11.seq - Rodent sequence entries, part 11.
952. gbrod12.seq - Rodent sequence entries, part 12.
953. gbrod13.seq - Rodent sequence entries, part 13.
954. gbrod14.seq - Rodent sequence entries, part 14.
955. gbrod15.seq - Rodent sequence entries, part 15.
956. gbrod16.seq - Rodent sequence entries, part 16.
957. gbrod17.seq - Rodent sequence entries, part 17.
958. gbrod18.seq - Rodent sequence entries, part 18.
959. gbrod19.seq - Rodent sequence entries, part 19.
960. gbrod2.seq - Rodent sequence entries, part 2.
961. gbrod20.seq - Rodent sequence entries, part 20.
962. gbrod21.seq - Rodent sequence entries, part 21.
963. gbrod22.seq - Rodent sequence entries, part 22.
964. gbrod23.seq - Rodent sequence entries, part 23.
965. gbrod24.seq - Rodent sequence entries, part 24.
966. gbrod25.seq - Rodent sequence entries, part 25.
967. gbrod3.seq - Rodent sequence entries, part 3.
968. gbrod4.seq - Rodent sequence entries, part 4.
969. gbrod5.seq - Rodent sequence entries, part 5.
970. gbrod6.seq - Rodent sequence entries, part 6.
971. gbrod7.seq - Rodent sequence entries, part 7.
972. gbrod8.seq - Rodent sequence entries, part 8.
973. gbrod9.seq - Rodent sequence entries, part 9.
974. gbsdr1.txt - Short directory of the data bank, part 1.
975. gbsdr2.txt - Short directory of the data bank, part 2.
976. gbsdr3.txt - Short directory of the data bank, part 3.
977. gbsec.idx - Index of the entries according to secondary accession number.
978. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
979. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
980. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
981. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
982. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
983. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
984. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
985. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
986. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
987. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
988. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
989. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
990. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
991. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
992. gbsyn.seq - Synthetic and chimeric sequence entries.
993. gbuna.seq - Unannotated sequence entries.
994. gbvrl1.seq - Viral sequence entries, part 1.
995. gbvrl2.seq - Viral sequence entries, part 2.
996. gbvrl3.seq - Viral sequence entries, part 3.
997. gbvrl4.seq - Viral sequence entries, part 4.
998. gbvrl5.seq - Viral sequence entries, part 5.
999. gbvrl6.seq - Viral sequence entries, part 6.
1000. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1001. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1002. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1003. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1004. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1005. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1006. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1007. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1008. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1009. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1010. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 155.0 flatfiles require roughly 230 GB (sequence
files only) or 240 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1887731942 gbacc.idx
500333738 gbaut1.idx
511473313 gbaut2.idx
500888300 gbaut3.idx
500085819 gbaut4.idx
500926572 gbaut5.idx
501697876 gbaut6.idx
464881798 gbaut7.idx
250005208 gbbct1.seq
252636586 gbbct10.seq
250750358 gbbct11.seq
254860814 gbbct12.seq
252021125 gbbct13.seq
250000733 gbbct14.seq
250244200 gbbct15.seq
106147831 gbbct16.seq
250032879 gbbct2.seq
250892678 gbbct3.seq
250001152 gbbct4.seq
253715156 gbbct5.seq
250001840 gbbct6.seq
257552911 gbbct7.seq
255533949 gbbct8.seq
252700943 gbbct9.seq
46250949 gbchg.txt
95263511 gbcon1.seq
870177754 gbcon2.seq
1325786804 gbcon3.seq
15578 gbdel.txt
250075599 gbenv1.seq
250002071 gbenv2.seq
250000546 gbenv3.seq
5761912 gbenv4.seq
230688413 gbest1.seq
230689410 gbest10.seq
230688905 gbest100.seq
230688543 gbest101.seq
230687636 gbest102.seq
230689741 gbest103.seq
230689191 gbest104.seq
230688498 gbest105.seq
230691053 gbest106.seq
230688247 gbest107.seq
230687791 gbest108.seq
230688102 gbest109.seq
230688482 gbest11.seq
230687960 gbest110.seq
230687758 gbest111.seq
230689636 gbest112.seq
230689934 gbest113.seq
230673277 gbest114.seq
230690249 gbest115.seq
230689811 gbest116.seq
230687809 gbest117.seq
230688359 gbest118.seq
230688542 gbest119.seq
230688289 gbest12.seq
230687844 gbest120.seq
230689035 gbest121.seq
230690496 gbest122.seq
230688849 gbest123.seq
230688644 gbest124.seq
230689415 gbest125.seq
230687834 gbest126.seq
230690709 gbest127.seq
230688858 gbest128.seq
230689937 gbest129.seq
230688229 gbest13.seq
230689204 gbest130.seq
230687786 gbest131.seq
230689089 gbest132.seq
230688884 gbest133.seq
230691153 gbest134.seq
230689024 gbest135.seq
230689286 gbest136.seq
230688951 gbest137.seq
230689243 gbest138.seq
230688534 gbest139.seq
230688619 gbest14.seq
230688156 gbest140.seq
230689017 gbest141.seq
230687539 gbest142.seq
230689487 gbest143.seq
230687991 gbest144.seq
230688726 gbest145.seq
230689056 gbest146.seq
230688008 gbest147.seq
230687844 gbest148.seq
230689654 gbest149.seq
230687763 gbest15.seq
230687539 gbest150.seq
230689541 gbest151.seq
230688143 gbest152.seq
230690166 gbest153.seq
230689383 gbest154.seq
230689758 gbest155.seq
230687655 gbest156.seq
230690362 gbest157.seq
230688123 gbest158.seq
230689293 gbest159.seq
230689014 gbest16.seq
230689760 gbest160.seq
230687512 gbest161.seq
230690759 gbest162.seq
230689014 gbest163.seq
230691267 gbest164.seq
230689961 gbest165.seq
230689170 gbest166.seq
230690316 gbest167.seq
230687566 gbest168.seq
230687507 gbest169.seq
230687500 gbest17.seq
230688168 gbest170.seq
230688667 gbest171.seq
230687906 gbest172.seq
230688024 gbest173.seq
230687569 gbest174.seq
222017943 gbest175.seq
230689999 gbest176.seq
230688856 gbest177.seq
230687532 gbest178.seq
230687953 gbest179.seq
230689139 gbest18.seq
230689260 gbest180.seq
230690812 gbest181.seq
230690430 gbest182.seq
230690225 gbest183.seq
230689723 gbest184.seq
230689568 gbest185.seq
230690047 gbest186.seq
230689311 gbest187.seq
230689628 gbest188.seq
230689799 gbest189.seq
230689779 gbest19.seq
230687876 gbest190.seq
230688577 gbest191.seq
230689052 gbest192.seq
230687507 gbest193.seq
230688913 gbest194.seq
230688516 gbest195.seq
230690441 gbest196.seq
230688293 gbest197.seq
230690669 gbest198.seq
230687790 gbest199.seq
230688569 gbest2.seq
230689756 gbest20.seq
230688382 gbest200.seq
230688638 gbest201.seq
230687790 gbest202.seq
230689941 gbest203.seq
230689207 gbest204.seq
230689599 gbest205.seq
230690893 gbest206.seq
230688902 gbest207.seq
230687967 gbest208.seq
230688555 gbest209.seq
230692076 gbest21.seq
230687899 gbest210.seq
230687773 gbest211.seq
230689207 gbest212.seq
230690052 gbest213.seq
230688250 gbest214.seq
230687785 gbest215.seq
230687963 gbest216.seq
230689220 gbest217.seq
230689676 gbest218.seq
230690682 gbest219.seq
230688204 gbest22.seq
230689991 gbest220.seq
230688495 gbest221.seq
230689630 gbest222.seq
230688797 gbest223.seq
230689350 gbest224.seq
189561650 gbest225.seq
162774211 gbest226.seq
163214480 gbest227.seq
171090759 gbest228.seq
169739615 gbest229.seq
230689102 gbest23.seq
164352081 gbest230.seq
165266653 gbest231.seq
164833201 gbest232.seq
164067230 gbest233.seq
164689983 gbest234.seq
164220339 gbest235.seq
164236015 gbest236.seq
163123971 gbest237.seq
168251233 gbest238.seq
162715224 gbest239.seq
230689793 gbest24.seq
162788262 gbest240.seq
166800921 gbest241.seq
168128455 gbest242.seq
165991590 gbest243.seq
165786203 gbest244.seq
165484964 gbest245.seq
165250992 gbest246.seq
164411328 gbest247.seq
164262934 gbest248.seq
165001350 gbest249.seq
230690001 gbest25.seq
164754116 gbest250.seq
179104346 gbest251.seq
173541220 gbest252.seq
180130580 gbest253.seq
230689352 gbest254.seq
230688522 gbest255.seq
230688707 gbest256.seq
230687850 gbest257.seq
230689057 gbest258.seq
230690361 gbest259.seq
230689694 gbest26.seq
230689851 gbest260.seq
230688939 gbest261.seq
230688168 gbest262.seq
230691078 gbest263.seq
230689791 gbest264.seq
230688308 gbest265.seq
230688281 gbest266.seq
230687533 gbest267.seq
230691543 gbest268.seq
230689116 gbest269.seq
230688899 gbest27.seq
230687910 gbest270.seq
230689202 gbest271.seq
230688579 gbest272.seq
230689175 gbest273.seq
230689826 gbest274.seq
230689348 gbest275.seq
230689481 gbest276.seq
230689410 gbest277.seq
230687552 gbest278.seq
230688725 gbest279.seq
230688835 gbest28.seq
230688274 gbest280.seq
230688270 gbest281.seq
230690338 gbest282.seq
230688244 gbest283.seq
230689447 gbest284.seq
207575484 gbest285.seq
230691279 gbest286.seq
230690139 gbest287.seq
230688058 gbest288.seq
230690155 gbest289.seq
230689662 gbest29.seq
230689152 gbest290.seq
230687898 gbest291.seq
230689427 gbest292.seq
230690385 gbest293.seq
230688195 gbest294.seq
230688335 gbest295.seq
230689484 gbest296.seq
230688628 gbest297.seq
230688677 gbest298.seq
230688023 gbest299.seq
230690160 gbest3.seq
230688091 gbest30.seq
230688944 gbest300.seq
230688942 gbest301.seq
230688526 gbest302.seq
230689704 gbest303.seq
230689546 gbest304.seq
230689985 gbest305.seq
230688060 gbest306.seq
230688454 gbest307.seq
230689889 gbest308.seq
230689239 gbest309.seq
230690812 gbest31.seq
230687541 gbest310.seq
230691177 gbest311.seq
230687576 gbest312.seq
230691361 gbest313.seq
230691519 gbest314.seq
230691141 gbest315.seq
230690267 gbest316.seq
230688465 gbest317.seq
230688072 gbest318.seq
230689538 gbest319.seq
230689150 gbest32.seq
230688792 gbest320.seq
230688606 gbest321.seq
230687855 gbest322.seq
230688693 gbest323.seq
230688316 gbest324.seq
230689015 gbest325.seq
230689406 gbest326.seq
230688748 gbest327.seq
230689641 gbest328.seq
230690887 gbest329.seq
230687535 gbest33.seq
230688563 gbest330.seq
230688802 gbest331.seq
230688963 gbest332.seq
230690491 gbest333.seq
230687497 gbest334.seq
216211708 gbest335.seq
230690947 gbest336.seq
230689324 gbest337.seq
230690221 gbest338.seq
230690628 gbest339.seq
230688817 gbest34.seq
230689367 gbest340.seq
180532185 gbest341.seq
150735750 gbest342.seq
230689653 gbest343.seq
230691584 gbest344.seq
230688383 gbest345.seq
230689954 gbest346.seq
230689633 gbest347.seq
230687555 gbest348.seq
230687856 gbest349.seq
230688019 gbest35.seq
230691425 gbest350.seq
230687533 gbest351.seq
230689127 gbest352.seq
230688308 gbest353.seq
230691075 gbest354.seq
230689304 gbest355.seq
230691046 gbest356.seq
230691081 gbest357.seq
230688573 gbest358.seq
230688369 gbest359.seq
230687884 gbest36.seq
230687554 gbest360.seq
230689721 gbest361.seq
230687689 gbest362.seq
230690380 gbest363.seq
229631944 gbest364.seq
230690633 gbest365.seq
230687749 gbest366.seq
230688079 gbest367.seq
230688031 gbest368.seq
230690078 gbest369.seq
230687807 gbest37.seq
230689942 gbest370.seq
230689299 gbest371.seq
230690344 gbest372.seq
230690631 gbest373.seq
230689001 gbest374.seq
230689115 gbest375.seq
230690400 gbest376.seq
230689647 gbest377.seq
230691592 gbest378.seq
230688129 gbest379.seq
230689002 gbest38.seq
230690309 gbest380.seq
230689000 gbest381.seq
230687718 gbest382.seq
230688820 gbest383.seq
230690701 gbest384.seq
230688944 gbest385.seq
230691405 gbest386.seq
230688272 gbest387.seq
222715625 gbest388.seq
230688050 gbest389.seq
230689121 gbest39.seq
230691224 gbest390.seq
230689335 gbest391.seq
230688109 gbest392.seq
230688621 gbest393.seq
230688074 gbest394.seq
223670963 gbest395.seq
230689143 gbest396.seq
230691268 gbest397.seq
230687661 gbest398.seq
230687527 gbest399.seq
230687668 gbest4.seq
230688548 gbest40.seq
230690280 gbest400.seq
230690675 gbest401.seq
230690582 gbest402.seq
230690585 gbest403.seq
230691463 gbest404.seq
230687519 gbest405.seq
230692408 gbest406.seq
230688171 gbest407.seq
230688823 gbest408.seq
230690884 gbest409.seq
230687945 gbest41.seq
230690807 gbest410.seq
230689144 gbest411.seq
230690032 gbest412.seq
210684913 gbest413.seq
210256761 gbest414.seq
210153345 gbest415.seq
210337454 gbest416.seq
210296682 gbest417.seq
210482207 gbest418.seq
211094549 gbest419.seq
222732251 gbest42.seq
211667313 gbest420.seq
211449139 gbest421.seq
211546077 gbest422.seq
213966179 gbest423.seq
211533486 gbest424.seq
210596392 gbest425.seq
210696569 gbest426.seq
210801135 gbest427.seq
210181255 gbest428.seq
210189950 gbest429.seq
192370513 gbest43.seq
210225526 gbest430.seq
210042189 gbest431.seq
215339177 gbest432.seq
230687940 gbest433.seq
230688283 gbest434.seq
230690014 gbest435.seq
230687562 gbest436.seq
230690107 gbest437.seq
230690368 gbest438.seq
230691238 gbest439.seq
191875225 gbest44.seq
230688113 gbest440.seq
230688604 gbest441.seq
230687862 gbest442.seq
230689150 gbest443.seq
230688879 gbest444.seq
230691136 gbest445.seq
230689565 gbest446.seq
230688930 gbest447.seq
230688852 gbest448.seq
230690702 gbest449.seq
215236461 gbest45.seq
230690732 gbest450.seq
230688501 gbest451.seq
230690275 gbest452.seq
230689339 gbest453.seq
230689302 gbest454.seq
230688536 gbest455.seq
230691400 gbest456.seq
230689970 gbest457.seq
230689124 gbest458.seq
230689503 gbest459.seq
216203855 gbest46.seq
230687742 gbest460.seq
230690363 gbest461.seq
230688286 gbest462.seq
230688995 gbest463.seq
230687544 gbest464.seq
230689910 gbest465.seq
230688613 gbest466.seq
230691349 gbest467.seq
230689602 gbest468.seq
230690908 gbest469.seq
215869013 gbest47.seq
230688370 gbest470.seq
230688812 gbest471.seq
230690984 gbest472.seq
230688646 gbest473.seq
230688840 gbest474.seq
230690358 gbest475.seq
230690328 gbest476.seq
230688073 gbest477.seq
230687507 gbest478.seq
230687763 gbest479.seq
216960744 gbest48.seq
230688890 gbest480.seq
230691781 gbest481.seq
230689192 gbest482.seq
230687838 gbest483.seq
230688442 gbest484.seq
230689606 gbest485.seq
230689918 gbest486.seq
230689319 gbest487.seq
230689080 gbest488.seq
230688514 gbest489.seq
230687688 gbest49.seq
230688710 gbest490.seq
230688098 gbest491.seq
225321089 gbest492.seq
230691666 gbest493.seq
230687724 gbest494.seq
230688412 gbest495.seq
230687617 gbest496.seq
230689988 gbest497.seq
230688500 gbest498.seq
230688353 gbest499.seq
164127827 gbest5.seq
230688381 gbest50.seq
230687933 gbest500.seq
230691150 gbest501.seq
230687802 gbest502.seq
230687641 gbest503.seq
196055448 gbest504.seq
217214521 gbest505.seq
230689949 gbest506.seq
230688595 gbest507.seq
230689310 gbest508.seq
230689292 gbest509.seq
224403268 gbest51.seq
230688360 gbest510.seq
230689229 gbest511.seq
230688827 gbest512.seq
230690324 gbest513.seq
230688304 gbest514.seq
230688292 gbest515.seq
230688683 gbest516.seq
230688558 gbest517.seq
230688280 gbest518.seq
230690251 gbest519.seq
230689824 gbest52.seq
230687991 gbest520.seq
230688679 gbest521.seq
230688995 gbest522.seq
228754599 gbest523.seq
218169478 gbest524.seq
230688378 gbest525.seq
230687927 gbest526.seq
230688559 gbest527.seq
230688358 gbest528.seq
230688468 gbest529.seq
230688722 gbest53.seq
230687566 gbest530.seq
230687947 gbest531.seq
230687908 gbest532.seq
230690655 gbest533.seq
230687955 gbest534.seq
230688227 gbest535.seq
230687953 gbest536.seq
230689495 gbest537.seq
229655452 gbest538.seq
230689373 gbest539.seq
230691187 gbest54.seq
230690704 gbest540.seq
230688885 gbest541.seq
230690117 gbest542.seq
230688387 gbest543.seq
230688785 gbest544.seq
230690881 gbest545.seq
87138789 gbest546.seq
230688590 gbest55.seq
230688259 gbest56.seq
230690410 gbest57.seq
230691647 gbest58.seq
230688466 gbest59.seq
177450586 gbest6.seq
230689150 gbest60.seq
230687856 gbest61.seq
230687909 gbest62.seq
230687716 gbest63.seq
230691866 gbest64.seq
230690143 gbest65.seq
230688211 gbest66.seq
230687950 gbest67.seq
209685318 gbest68.seq
209421994 gbest69.seq
230687876 gbest7.seq
208477430 gbest70.seq
209145026 gbest71.seq
209844462 gbest72.seq
210242705 gbest73.seq
209599870 gbest74.seq
208456813 gbest75.seq
210228695 gbest76.seq
208330905 gbest77.seq
205431204 gbest78.seq
208527781 gbest79.seq
230687875 gbest8.seq
208043663 gbest80.seq
211332037 gbest81.seq
226310984 gbest82.seq
230692737 gbest83.seq
230692246 gbest84.seq
220626103 gbest85.seq
214653924 gbest86.seq
213918219 gbest87.seq
230687549 gbest88.seq
230688710 gbest89.seq
230688341 gbest9.seq
230688607 gbest90.seq
230689804 gbest91.seq
230688727 gbest92.seq
230687546 gbest93.seq
230687697 gbest94.seq
230688547 gbest95.seq
230688403 gbest96.seq
230690347 gbest97.seq
230687632 gbest98.seq
230688831 gbest99.seq
55966830 gbgen.idx
230688077 gbgss1.seq
230689730 gbgss10.seq
228038693 gbgss100.seq
227980545 gbgss101.seq
228598143 gbgss102.seq
228612310 gbgss103.seq
228212424 gbgss104.seq
227703233 gbgss105.seq
230688645 gbgss106.seq
230689412 gbgss107.seq
230688127 gbgss108.seq
230687770 gbgss109.seq
230689992 gbgss11.seq
230688807 gbgss110.seq
230687869 gbgss111.seq
230689841 gbgss112.seq
230689642 gbgss113.seq
230690244 gbgss114.seq
230689402 gbgss115.seq
230688638 gbgss116.seq
230689369 gbgss117.seq
230687504 gbgss118.seq
230688950 gbgss119.seq
230689920 gbgss12.seq
230689210 gbgss120.seq
230690029 gbgss121.seq
230687718 gbgss122.seq
230688247 gbgss123.seq
230688225 gbgss124.seq
230687526 gbgss125.seq
230689005 gbgss126.seq
230690365 gbgss127.seq
230689865 gbgss128.seq
230688306 gbgss129.seq
230689812 gbgss13.seq
230688630 gbgss130.seq
230689828 gbgss131.seq
230688699 gbgss132.seq
230689040 gbgss133.seq
230688288 gbgss134.seq
230688154 gbgss135.seq
230688152 gbgss136.seq
230688075 gbgss137.seq
230689026 gbgss138.seq
230689742 gbgss139.seq
230687711 gbgss14.seq
230688439 gbgss140.seq
230689303 gbgss141.seq
230690220 gbgss142.seq
230687464 gbgss143.seq
224282746 gbgss144.seq
230688045 gbgss145.seq
230687893 gbgss146.seq
203757438 gbgss147.seq
127375547 gbgss148.seq
250002654 gbgss149.seq
230689194 gbgss15.seq
250000413 gbgss150.seq
250000610 gbgss151.seq
250001358 gbgss152.seq
250002661 gbgss153.seq
250000087 gbgss154.seq
250001749 gbgss155.seq
250001532 gbgss156.seq
250002533 gbgss157.seq
250000051 gbgss158.seq
250000170 gbgss159.seq
230690433 gbgss16.seq
250000228 gbgss160.seq
250001919 gbgss161.seq
250001198 gbgss162.seq
250001788 gbgss163.seq
250003107 gbgss164.seq
250001327 gbgss165.seq
250000822 gbgss166.seq
250000112 gbgss167.seq
250002119 gbgss168.seq
250003386 gbgss169.seq
230689500 gbgss17.seq
250002008 gbgss170.seq
250001008 gbgss171.seq
250001624 gbgss172.seq
250001987 gbgss173.seq
250000858 gbgss174.seq
250000482 gbgss175.seq
250000748 gbgss176.seq
250002372 gbgss177.seq
250000353 gbgss178.seq
250002603 gbgss179.seq
230690354 gbgss18.seq
250001924 gbgss180.seq
195843421 gbgss181.seq
230688963 gbgss19.seq
230687684 gbgss2.seq
230690353 gbgss20.seq
230690378 gbgss21.seq
230690820 gbgss22.seq
230690043 gbgss23.seq
230690276 gbgss24.seq
230687532 gbgss25.seq
230688590 gbgss26.seq
230689250 gbgss27.seq
230689496 gbgss28.seq
230689262 gbgss29.seq
230690835 gbgss3.seq
230690281 gbgss30.seq
230690207 gbgss31.seq
230690608 gbgss32.seq
230687460 gbgss33.seq
230687663 gbgss34.seq
230687549 gbgss35.seq
230688420 gbgss36.seq
230688908 gbgss37.seq
230687471 gbgss38.seq
230690130 gbgss39.seq
230689817 gbgss4.seq
230688609 gbgss40.seq
230687759 gbgss41.seq
230687625 gbgss42.seq
230689840 gbgss43.seq
230689853 gbgss44.seq
230690607 gbgss45.seq
230687759 gbgss46.seq
230688291 gbgss47.seq
230688935 gbgss48.seq
230690090 gbgss49.seq
230687574 gbgss5.seq
230688170 gbgss50.seq
230688112 gbgss51.seq
230688081 gbgss52.seq
230688084 gbgss53.seq
230689232 gbgss54.seq
230688400 gbgss55.seq
230687626 gbgss56.seq
230688276 gbgss57.seq
230689024 gbgss58.seq
230689325 gbgss59.seq
230688137 gbgss6.seq
230690360 gbgss60.seq
229149318 gbgss61.seq
230688595 gbgss62.seq
230689690 gbgss63.seq
230689152 gbgss64.seq
230689102 gbgss65.seq
230688817 gbgss66.seq
230689369 gbgss67.seq
230688428 gbgss68.seq
230688222 gbgss69.seq
230690545 gbgss7.seq
230688853 gbgss70.seq
230687799 gbgss71.seq
230689124 gbgss72.seq
230688126 gbgss73.seq
230688380 gbgss74.seq
230687734 gbgss75.seq
230688955 gbgss76.seq
230689466 gbgss77.seq
230687513 gbgss78.seq
230689696 gbgss79.seq
230689401 gbgss8.seq
230688290 gbgss80.seq
207761086 gbgss81.seq
194703062 gbgss82.seq
212393575 gbgss83.seq
230689304 gbgss84.seq
230688842 gbgss85.seq
230689258 gbgss86.seq
230688625 gbgss87.seq
230688002 gbgss88.seq
230689368 gbgss89.seq
230687534 gbgss9.seq
230689270 gbgss90.seq
230690109 gbgss91.seq
230687664 gbgss92.seq
230689740 gbgss93.seq
230689454 gbgss94.seq
230687471 gbgss95.seq
230689019 gbgss96.seq
230690298 gbgss97.seq
230689348 gbgss98.seq
230687786 gbgss99.seq
250001968 gbhtc1.seq
250001195 gbhtc10.seq
250001461 gbhtc11.seq
30544988 gbhtc12.seq
250004428 gbhtc2.seq
250012262 gbhtc3.seq
250015320 gbhtc4.seq
250008411 gbhtc5.seq
250007056 gbhtc6.seq
250001941 gbhtc7.seq
250002773 gbhtc8.seq
250001438 gbhtc9.seq
250237448 gbhtg1.seq
250045437 gbhtg10.seq
250032938 gbhtg11.seq
250179642 gbhtg12.seq
250199617 gbhtg13.seq
250277060 gbhtg14.seq
250091761 gbhtg15.seq
250187683 gbhtg16.seq
250237715 gbhtg17.seq
250208345 gbhtg18.seq
250046641 gbhtg19.seq
250077396 gbhtg2.seq
250036213 gbhtg20.seq
250098671 gbhtg21.seq
250252062 gbhtg22.seq
250169127 gbhtg23.seq
250243030 gbhtg24.seq
250185543 gbhtg25.seq
250079499 gbhtg26.seq
250178920 gbhtg27.seq
250037259 gbhtg28.seq
250044466 gbhtg29.seq
250003990 gbhtg3.seq
250244546 gbhtg30.seq
250152942 gbhtg31.seq
250339855 gbhtg32.seq
250097373 gbhtg33.seq
250108236 gbhtg34.seq
250044369 gbhtg35.seq
250162010 gbhtg36.seq
250119260 gbhtg37.seq
250306034 gbhtg38.seq
250064189 gbhtg39.seq
250049411 gbhtg4.seq
250188586 gbhtg40.seq
250057655 gbhtg41.seq
250007145 gbhtg42.seq
250114281 gbhtg43.seq
250153988 gbhtg44.seq
250267595 gbhtg45.seq
250179879 gbhtg46.seq
250012436 gbhtg47.seq
250207690 gbhtg48.seq
250008723 gbhtg49.seq
250083749 gbhtg5.seq
250114430 gbhtg50.seq
250128136 gbhtg51.seq
250184643 gbhtg52.seq
250085640 gbhtg53.seq
250034671 gbhtg54.seq
250060812 gbhtg55.seq
250111887 gbhtg56.seq
250101058 gbhtg57.seq
250221079 gbhtg58.seq
250189789 gbhtg59.seq
250099605 gbhtg6.seq
250047291 gbhtg60.seq
250190079 gbhtg61.seq
250158112 gbhtg62.seq
250002607 gbhtg63.seq
250136451 gbhtg64.seq
250082525 gbhtg65.seq
250156990 gbhtg66.seq
250045350 gbhtg67.seq
250089900 gbhtg68.seq
250063126 gbhtg69.seq
250027750 gbhtg7.seq
250103383 gbhtg70.seq
250122028 gbhtg71.seq
250049555 gbhtg72.seq
250064266 gbhtg73.seq
250056674 gbhtg74.seq
250092842 gbhtg75.seq
250244925 gbhtg76.seq
250167009 gbhtg77.seq
250165853 gbhtg78.seq
250284076 gbhtg79.seq
250189743 gbhtg8.seq
250194714 gbhtg80.seq
250138763 gbhtg81.seq
250095949 gbhtg82.seq
250108073 gbhtg83.seq
245529166 gbhtg84.seq
250112663 gbhtg9.seq
250162623 gbinv1.seq
250326179 gbinv2.seq
250000011 gbinv3.seq
250002283 gbinv4.seq
250001416 gbinv5.seq
250002136 gbinv6.seq
250001091 gbinv7.seq
250000350 gbinv8.seq
64151761 gbinv9.seq
0 gbjou.idx
0 gbkey.idx
250003870 gbmam1.seq
250000880 gbmam2.seq
1520239 gbmam3.seq
35099899 gbnew.txt
250002898 gbpat1.seq
250000899 gbpat10.seq
250001512 gbpat11.seq
250000803 gbpat12.seq
250000968 gbpat13.seq
250002468 gbpat14.seq
250000705 gbpat15.seq
250000534 gbpat16.seq
250001059 gbpat17.seq
250000706 gbpat18.seq
250091866 gbpat19.seq
250002492 gbpat2.seq
250000968 gbpat20.seq
250006295 gbpat21.seq
250000241 gbpat22.seq
250002941 gbpat23.seq
250000768 gbpat24.seq
207942750 gbpat25.seq
250001521 gbpat3.seq
250003935 gbpat4.seq
250001906 gbpat5.seq
250000234 gbpat6.seq
250013261 gbpat7.seq
250000026 gbpat8.seq
250000667 gbpat9.seq
51741271 gbphg.seq
250199607 gbpln1.seq
269805077 gbpln10.seq
250001269 gbpln11.seq
250002892 gbpln12.seq
250001172 gbpln13.seq
250000001 gbpln14.seq
250041558 gbpln15.seq
250177808 gbpln16.seq
250135002 gbpln17.seq
211501680 gbpln18.seq
250183685 gbpln2.seq
250130456 gbpln3.seq
250002087 gbpln4.seq
250000474 gbpln5.seq
250002606 gbpln6.seq
250059865 gbpln7.seq
250145335 gbpln8.seq
287646474 gbpln9.seq
250015038 gbpri1.seq
250072333 gbpri10.seq
250087309 gbpri11.seq
250142684 gbpri12.seq
250036111 gbpri13.seq
250144355 gbpri14.seq
250196351 gbpri15.seq
250001736 gbpri16.seq
250006067 gbpri17.seq
250048819 gbpri18.seq
250209839 gbpri19.seq
250228108 gbpri2.seq
250110324 gbpri20.seq
250070269 gbpri21.seq
250380155 gbpri22.seq
250005489 gbpri23.seq
250004734 gbpri24.seq
250005112 gbpri25.seq
250218310 gbpri26.seq
250000180 gbpri27.seq
250000580 gbpri28.seq
250101256 gbpri29.seq
250081747 gbpri3.seq
250003772 gbpri30.seq
50725909 gbpri31.seq
250117926 gbpri4.seq
250098877 gbpri5.seq
250046487 gbpri6.seq
250159872 gbpri7.seq
250041437 gbpri8.seq
250070646 gbpri9.seq
230092 gbrel.txt
250238832 gbrod1.seq
250131771 gbrod10.seq
250151382 gbrod11.seq
250159289 gbrod12.seq
250144023 gbrod13.seq
250099971 gbrod14.seq
250157960 gbrod15.seq
250258825 gbrod16.seq
250045948 gbrod17.seq
250236625 gbrod18.seq
250128256 gbrod19.seq
250078755 gbrod2.seq
250161126 gbrod20.seq
250000270 gbrod21.seq
250015989 gbrod22.seq
250000099 gbrod23.seq
250000681 gbrod24.seq
72542911 gbrod25.seq
250237763 gbrod3.seq
250120595 gbrod4.seq
250133433 gbrod5.seq
250186119 gbrod6.seq
250033478 gbrod7.seq
250225765 gbrod8.seq
250146455 gbrod9.seq
638270222 gbsdr1.txt
3061951354 gbsdr2.txt
1189617059 gbsdr3.txt
2295930 gbsec.idx
250002483 gbsts1.seq
250003858 gbsts10.seq
250002700 gbsts11.seq
250000578 gbsts12.seq
250001316 gbsts13.seq
44451530 gbsts14.seq
250000857 gbsts2.seq
250001527 gbsts3.seq
250004195 gbsts4.seq
250004133 gbsts5.seq
250001009 gbsts6.seq
250003068 gbsts7.seq
250004332 gbsts8.seq
250000563 gbsts9.seq
150664180 gbsyn.seq
419480 gbuna.seq
250001918 gbvrl1.seq
250077102 gbvrl2.seq
250006090 gbvrl3.seq
250000070 gbvrl4.seq
250000901 gbvrl5.seq
138685425 gbvrl6.seq
250006585 gbvrt1.seq
250012613 gbvrt10.seq
231007356 gbvrt11.seq
250231361 gbvrt2.seq
250001468 gbvrt3.seq
250002690 gbvrt4.seq
250166656 gbvrt5.seq
250078443 gbvrt6.seq
250121121 gbvrt7.seq
250157917 gbvrt8.seq
250008118 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 25895 103022857
BCT10 59 114156922
BCT11 53 111685685
BCT12 55 117647329
BCT13 61 114127927
BCT14 25596 97566706
BCT15 50858 88353044
BCT16 12192 40415548
BCT2 4843 107679885
BCT3 144 112033611
BCT4 24249 103808149
BCT5 37894 95591569
BCT6 25080 103858198
BCT7 46109 96903930
BCT8 6420 108096929
BCT9 2287 99439208
ENV1 92045 72634486
ENV2 89093 80119701
ENV3 92038 81707140
ENV4 2260 1454349
EST1 68132 26291928
EST10 76538 29845881
EST100 74101 37168671
EST101 71379 40038024
EST102 68625 37259081
EST103 73286 36464688
EST104 72018 47276179
EST105 72413 44615521
EST106 69714 44299651
EST107 73490 32996863
EST108 70465 29738800
EST109 65977 35671325
EST11 75115 28773787
EST110 68251 37682783
EST111 69074 41119290
EST112 72073 38451731
EST113 75175 34460794
EST114 74530 27394254
EST115 74037 32543836
EST116 72923 37065371
EST117 65583 35440755
EST118 80104 45880506
EST119 78290 43479695
EST12 77707 30806669
EST120 68401 47851729
EST121 68843 39341201
EST122 74367 51243879
EST123 69121 41499798
EST124 73948 45251625
EST125 74206 45536123
EST126 71319 48803056
EST127 73624 48255430
EST128 78462 45341221
EST129 75314 31463155
EST13 77115 29303866
EST130 78040 32694677
EST131 79531 46731699
EST132 74841 42510363
EST133 64885 35446375
EST134 71228 36735110
EST135 67519 36940283
EST136 66026 36208702
EST137 71508 44103205
EST138 72754 45285506
EST139 67875 39374610
EST14 78480 31798234
EST140 68353 39885374
EST141 75505 45738712
EST142 67951 40017952
EST143 62031 35305247
EST144 99171 53956753
EST145 79955 45833426
EST146 84120 43711656
EST147 103972 54936638
EST148 105699 57575386
EST149 98892 56294552
EST15 74859 31632774
EST150 74079 44557910
EST151 93756 55654544
EST152 99923 59297624
EST153 86974 48743136
EST154 74729 45405267
EST155 68236 33666355
EST156 64023 29207546
EST157 54975 25056293
EST158 65243 31089563
EST159 59897 30868912
EST16 75818 33328356
EST160 64936 34809477
EST161 75367 52732805
EST162 63857 43851557
EST163 80887 47453712
EST164 61344 31456401
EST165 61079 30889542
EST166 66180 40649943
EST167 65444 31824616
EST168 64182 47469845
EST169 83124 43832556
EST17 82605 34104057
EST170 95549 45769223
EST171 92598 54891859
EST172 99603 57684787
EST173 96273 53631131
EST174 99049 48406266
EST175 90297 36823566
EST176 94990 49877086
EST177 89516 38265783
EST178 94517 41079757
EST179 71199 37977772
EST18 81048 32198622
EST180 68127 44210500
EST181 65220 37448483
EST182 65085 42733871
EST183 68217 30854052
EST184 76220 31605109
EST185 69060 43664853
EST186 82880 41262720
EST187 61628 32008533
EST188 67779 47600791
EST189 70407 46526296
EST19 78336 31879785
EST190 67693 36782902
EST191 67428 44785429
EST192 70584 54528469
EST193 69509 33349694
EST194 72248 40613631
EST195 69788 59452744
EST196 66707 50323486
EST197 64627 46989175
EST198 64135 47558206
EST199 66037 46133597
EST2 74651 28648243
EST20 74807 30649777
EST200 65680 47309937
EST201 63997 47444932
EST202 61945 37654677
EST203 64189 33992348
EST204 62735 36602982
EST205 85191 47810692
EST206 83939 54794595
EST207 68960 40395304
EST208 106257 66676506
EST209 108322 65428644
EST21 73434 34181726
EST210 109045 64580325
EST211 103524 66695627
EST212 107026 59640308
EST213 106758 50259383
EST214 90742 55053251
EST215 98184 44423662
EST216 92985 48268945
EST217 72719 46995603
EST218 67528 43542978
EST219 68684 58294463
EST22 75906 30459367
EST220 68255 58433906
EST221 80264 40176484
EST222 80212 46175695
EST223 74690 52937879
EST224 71181 51910519
EST225 41263 21016279
EST226 27787 10559603
EST227 27699 10229377
EST228 26347 9774065
EST229 26648 8986035
EST23 77302 32567547
EST230 27529 9768152
EST231 27190 10069641
EST232 27175 9749670
EST233 27328 10241953
EST234 27109 12086833
EST235 27209 11278983
EST236 27319 10129848
EST237 27603 9297013
EST238 26857 9187835
EST239 27775 11263127
EST24 74984 33169666
EST240 27781 10796739
EST241 27101 11342347
EST242 26616 11925440
EST243 27063 11374849
EST244 27050 10891118
EST245 27018 11509288
EST246 27131 11557860
EST247 27264 11161257
EST248 27265 10817291
EST249 27185 10578007
EST25 73550 31507451
EST250 27239 10800302
EST251 24700 17182416
EST252 25579 17030804
EST253 39655 19059348
EST254 91062 44459092
EST255 48890 28767035
EST256 104058 40738921
EST257 71005 40773444
EST258 68636 44546071
EST259 69435 44548504
EST26 75750 31306553
EST260 69306 44143469
EST261 67730 39763385
EST262 72887 42541059
EST263 65003 49083039
EST264 64306 32329510
EST265 79095 39164560
EST266 101935 46841105
EST267 73038 42095357
EST268 66387 33566388
EST269 68187 32986190
EST27 75334 32833469
EST270 70219 42437821
EST271 73699 34791706
EST272 70356 35404713
EST273 73224 46703940
EST274 63795 33961540
EST275 67765 38117088
EST276 82259 43082203
EST277 75735 42773676
EST278 79226 51537943
EST279 75460 54141717
EST28 108337 51504400
EST280 111973 49079314
EST281 83557 42527023
EST282 73107 45523258
EST283 73511 40010583
EST284 72301 38188337
EST285 70110 27515327
EST286 69922 41536709
EST287 62202 34101138
EST288 63807 41613708
EST289 71352 40513860
EST29 97463 46528948
EST290 62128 44249224
EST291 63464 31931151
EST292 82304 43425940
EST293 83753 43196805
EST294 78200 49400634
EST295 104813 56900692
EST296 123708 46426656
EST297 73689 37096685
EST298 68013 35445530
EST299 69709 46567423
EST3 73739 29916860
EST30 98609 53704827
EST300 80550 39203310
EST301 71539 42178579
EST302 71672 41625368
EST303 60316 33703312
EST304 56216 35063772
EST305 63159 38948029
EST306 70820 47906627
EST307 68523 41854777
EST308 72282 41944159
EST309 73599 37436501
EST31 80400 46237488
EST310 58934 30804093
EST311 53752 27557633
EST312 52750 28221229
EST313 52998 28245701
EST314 51882 27077398
EST315 54061 26200780
EST316 55676 24528439
EST317 55236 23351768
EST318 54469 22373051
EST319 55571 21402826
EST32 65852 49922173
EST320 54988 22088118
EST321 56110 22357472
EST322 55027 21389590
EST323 56195 20110923
EST324 65263 36062100
EST325 76494 35128356
EST326 74436 33211780
EST327 77253 33043007
EST328 76853 33698094
EST329 92736 61422621
EST33 73960 53181049
EST330 69385 53146134
EST331 96509 58706317
EST332 95437 57574211
EST333 89323 52637108
EST334 70138 38897297
EST335 75703 39677603
EST336 67402 54051582
EST337 64371 49175593
EST338 61788 44281453
EST339 61236 32079262
EST34 85809 47750392
EST340 72991 49244800
EST341 56989 34792914
EST342 50297 25232257
EST343 67513 36162238
EST344 65400 34755932
EST345 62175 30421713
EST346 63501 41060631
EST347 82466 45517131
EST348 72446 40624763
EST349 68505 41501100
EST35 87306 44620350
EST350 71153 40711598
EST351 62342 42796911
EST352 85034 48654868
EST353 84526 49829536
EST354 81129 44643560
EST355 64072 35607794
EST356 67602 37359852
EST357 72934 39918635
EST358 48001 24311584
EST359 62502 35707618
EST36 96359 52570774
EST360 69918 42015636
EST361 97707 45710069
EST362 75670 44793018
EST363 72259 47887745
EST364 72081 46465296
EST365 62542 36039577
EST366 72711 36048120
EST367 82974 38014953
EST368 59315 40566789
EST369 55550 37994698
EST37 79761 57857604
EST370 63623 37462418
EST371 86999 52870412
EST372 90385 48779564
EST373 67406 42766107
EST374 79861 41777455
EST375 52260 33227962
EST376 44246 23219595
EST377 69090 44083857
EST378 80855 41390549
EST379 80582 47848899
EST38 81885 57660790
EST380 74507 45770761
EST381 78864 48696588
EST382 75468 50260530
EST383 72529 39962751
EST384 60830 39449473
EST385 74148 40446645
EST386 53189 32953953
EST387 74659 31135331
EST388 79705 25559603
EST389 70817 45450978
EST39 101870 48131626
EST390 65906 37813058
EST391 70442 36887574
EST392 66075 40741500
EST393 73159 46666801
EST394 65996 44293764
EST395 73802 43482143
EST396 59572 33016584
EST397 65081 39650579
EST398 78524 50510417
EST399 83606 48315497
EST4 74569 28389457
EST40 89921 45721990
EST400 79676 45180181
EST401 58988 41011370
EST402 56700 41120993
EST403 57385 40426560
EST404 60497 38700819
EST405 78552 49193392
EST406 48682 29941989
EST407 65877 40254344
EST408 57943 40100959
EST409 60869 41379967
EST41 98958 47728577
EST410 56408 41937033
EST411 47515 33598257
EST412 89266 42349939
EST413 69385 38584947
EST414 69694 38365940
EST415 69823 38311409
EST416 69620 38660294
EST417 69619 38514596
EST418 69509 38799227
EST419 69029 38302355
EST42 91338 35148977
EST420 68966 38270392
EST421 69042 39197890
EST422 68667 38275953
EST423 67253 38056889
EST424 69293 39117557
EST425 69422 38192763
EST426 69452 38595947
EST427 69402 37845533
EST428 69833 38248384
EST429 69769 38305043
EST43 68712 18254628
EST430 69705 38296963
EST431 69973 37781947
EST432 76190 40839134
EST433 88363 50129018
EST434 80040 35555216
EST435 78867 41008996
EST436 59931 44244386
EST437 52024 40815636
EST438 70201 44789601
EST439 63753 37438093
EST44 68701 18400992
EST440 70501 41929847
EST441 113605 57446022
EST442 81264 49946931
EST443 84054 57516961
EST444 51283 30968447
EST445 48241 43593894
EST446 46354 59028646
EST447 72254 55931859
EST448 65136 38116812
EST449 72877 43186144
EST45 63649 19463529
EST450 68112 42900527
EST451 70475 43664090
EST452 61765 51373818
EST453 80828 44577649
EST454 109120 47983417
EST455 83991 53713031
EST456 61895 40098647
EST457 56463 40830510
EST458 56259 37832362
EST459 66540 49202844
EST46 43714 11915585
EST460 66193 46088724
EST461 61143 44591065
EST462 52007 37839162
EST463 53184 38216839
EST464 59169 42321565
EST465 65441 37109152
EST466 68803 44358611
EST467 57198 37958397
EST468 57368 40622845
EST469 62663 46733433
EST47 43324 12000544
EST470 59994 46423112
EST471 58061 40955944
EST472 55807 41496017
EST473 51775 34421699
EST474 54008 37516468
EST475 59761 38918331
EST476 71632 41137817
EST477 61572 46662437
EST478 76489 61117703
EST479 79017 50478480
EST48 43205 11443119
EST480 50425 53712283
EST481 49505 51538523
EST482 65798 54451171
EST483 58191 38414058
EST484 71092 39149200
EST485 85383 54612848
EST486 80482 53659625
EST487 81541 49144937
EST488 57857 37648881
EST489 74360 50622671
EST49 78330 31700224
EST490 80779 49605319
EST491 78245 61271884
EST492 70257 47738181
EST493 71728 50575894
EST494 69007 49073381
EST495 62971 49232531
EST496 66334 47323851
EST497 89267 47452689
EST498 84567 40435712
EST499 118088 43159122
EST5 48198 15295521
EST50 96034 43778252
EST500 95081 54685919
EST501 66933 51551110
EST502 50581 49977276
EST503 88531 46038660
EST504 86988 31698364
EST505 85146 33812033
EST506 63593 62327395
EST507 85792 55516762
EST508 85481 46757458
EST509 69683 43001148
EST51 91160 46330123
EST510 71307 50046685
EST511 75574 47566630
EST512 90205 53531370
EST513 73090 51946314
EST514 72969 52334100
EST515 71723 53940812
EST516 82367 55249192
EST517 86816 43630811
EST518 79856 43496331
EST519 79691 55133564
EST52 89438 41867417
EST520 72786 55635978
EST521 71543 48431635
EST522 90273 45015685
EST523 106265 45364761
EST524 109468 49055224
EST525 129866 54078151
EST526 130680 57895206
EST527 73743 54420683
EST528 84874 41449132
EST529 84288 8752058
EST53 102784 52610140
EST530 95394 30131233
EST531 127228 62580437
EST532 97866 56845739
EST533 66225 42458150
EST534 72664 46528564
EST535 75670 51749643
EST536 71435 45840248
EST537 71898 47844539
EST538 70649 53429429
EST539 77915 29969631
EST54 99632 50582761
EST540 70081 24915531
EST541 75562 27724162
EST542 72166 26214010
EST543 79582 27022980
EST544 73021 26830976
EST545 68398 29247681
EST546 32236 10780782
EST55 77614 33615128
EST56 65918 28597186
EST57 72475 32188041
EST58 71078 29987400
EST59 81169 32827232
EST6 54924 17445206
EST60 74584 29511036
EST61 70946 28530152
EST62 63854 29424552
EST63 75740 34123640
EST64 76563 34157214
EST65 73844 29117444
EST66 76271 26357601
EST67 85775 40862315
EST68 40599 11561923
EST69 40413 11092878
EST7 74544 29357938
EST70 40374 12434324
EST71 40799 12600325
EST72 40821 12295063
EST73 40748 13008029
EST74 40513 12951153
EST75 40562 12067819
EST76 40156 12006166
EST77 40892 12741724
EST78 41419 11832336
EST79 41006 13094422
EST8 75853 30597153
EST80 40878 12856048
EST81 42298 13021157
EST82 45883 16028950
EST83 42943 27024751
EST84 42186 19741072
EST85 47964 19422733
EST86 50698 22414395
EST87 51198 21744847
EST88 80925 47470201
EST89 77406 38108218
EST9 77568 29867722
EST90 71843 27739362
EST91 75451 29571087
EST92 74536 39938995
EST93 77397 41499579
EST94 77548 44464753
EST95 75161 35148705
EST96 74936 42839261
EST97 70583 36576730
EST98 75185 35637464
EST99 72727 42296827
GSS1 90427 38661176
GSS10 74870 43584742
GSS100 75087 42511982
GSS101 74344 43239187
GSS102 73629 45042310
GSS103 73606 45096160
GSS104 73270 45279931
GSS105 73291 44755222
GSS106 75828 48300165
GSS107 86687 57578307
GSS108 82316 55174300
GSS109 82704 51843211
GSS11 70615 35935175
GSS110 87610 53211266
GSS111 80263 63387588
GSS112 80415 47501680
GSS113 94528 52820153
GSS114 81746 50443815
GSS115 80802 54612024
GSS116 87105 68998146
GSS117 76951 44419169
GSS118 76338 51679219
GSS119 93675 48178164
GSS12 72880 38304785
GSS120 88391 55459542
GSS121 85617 53771483
GSS122 86881 56791736
GSS123 76693 62034126
GSS124 76641 69023151
GSS125 79339 61468776
GSS126 78689 54702920
GSS127 78775 54530501
GSS128 79095 54083148
GSS129 78863 54425415
GSS13 76710 38972527
GSS130 79235 53882212
GSS131 83953 60045451
GSS132 81395 58309666
GSS133 67342 56734920
GSS134 71765 55319486
GSS135 76516 68437520
GSS136 76148 62877643
GSS137 78643 52934822
GSS138 86523 53717696
GSS139 94701 58063897
GSS14 71317 32130397
GSS140 93156 59959927
GSS141 84910 56319633
GSS142 82441 55221274
GSS143 87031 56444758
GSS144 115648 59445406
GSS145 104031 60590461
GSS146 78712 55278151
GSS147 49677 31917845
GSS148 39405 28629642
GSS149 86836 64404216
GSS15 70061 34757698
GSS150 83575 62753164
GSS151 103108 48161425
GSS152 68548 58488280
GSS153 68306 58779598
GSS154 69368 56627991
GSS155 69629 56122459
GSS156 70375 55415422
GSS157 85863 73122780
GSS158 85378 39156750
GSS159 74963 33079603
GSS16 78471 46275348
GSS160 99506 75348035
GSS161 89185 41363850
GSS162 92288 63244766
GSS163 78702 64020542
GSS164 70304 59021023
GSS165 68301 63092133
GSS166 62749 54711659
GSS167 117480 70781758
GSS168 119025 74853485
GSS169 114267 72254427
GSS17 70905 33300657
GSS170 87631 49229155
GSS171 90246 55270778
GSS172 102926 71827750
GSS173 108147 77711555
GSS174 106272 79809757
GSS175 105897 80219201
GSS176 107049 72381349
GSS177 100003 56068892
GSS178 85050 46343972
GSS179 92430 47704839
GSS18 59072 27947831
GSS180 97897 64619078
GSS181 79920 37420076
GSS19 56793 29072377
GSS2 88926 39303697
GSS20 57668 26712370
GSS21 61488 29057627
GSS22 64939 38230047
GSS23 57529 27081083
GSS24 66168 42024043
GSS25 68211 28289704
GSS26 58176 25355644
GSS27 65303 31934874
GSS28 65527 32575936
GSS29 77225 39669329
GSS3 87398 41802021
GSS30 82941 39740821
GSS31 74191 40411920
GSS32 70577 48294741
GSS33 79802 37824944
GSS34 75888 40321723
GSS35 74118 40025167
GSS36 87368 56179107
GSS37 87598 58173223
GSS38 85523 44940858
GSS39 86842 50474937
GSS4 78874 41011062
GSS40 86235 40010785
GSS41 83170 31845412
GSS42 81247 56931682
GSS43 80151 58109065
GSS44 72029 47494612
GSS45 72036 47432000
GSS46 77670 45765395
GSS47 77852 38688037
GSS48 83227 58010682
GSS49 86577 64688617
GSS5 78791 40543955
GSS50 81582 54470283
GSS51 93869 59259705
GSS52 88547 58814864
GSS53 76634 42273729
GSS54 72820 40498003
GSS55 86508 47046265
GSS56 88083 58488041
GSS57 77072 64858906
GSS58 71984 79297095
GSS59 86848 69263601
GSS6 78151 38870151
GSS60 88595 59269234
GSS61 63418 45073816
GSS62 67010 45951178
GSS63 89650 67276495
GSS64 84977 57982472
GSS65 86077 53089534
GSS66 86455 56259854
GSS67 95417 58306687
GSS68 100726 54384268
GSS69 100601 54542451
GSS7 77733 39126124
GSS70 101398 53533159
GSS71 102485 52153030
GSS72 102417 52240125
GSS73 102570 52045621
GSS74 102155 52571486
GSS75 99645 55765892
GSS76 90053 69068841
GSS77 89843 70768813
GSS78 88293 69750437
GSS79 87836 69662977
GSS8 75721 38102431
GSS80 88014 61735137
GSS81 82953 31239512
GSS82 77833 24406765
GSS83 84678 32982575
GSS84 82016 50098224
GSS85 80185 45188726
GSS86 88071 61219987
GSS87 80660 59807489
GSS88 77047 79083981
GSS89 77429 62294764
GSS9 72104 37147963
GSS90 89842 48298589
GSS91 79275 45077466
GSS92 79790 45255544
GSS93 73424 62676198
GSS94 83721 51944563
GSS95 80854 57043892
GSS96 85701 56695468
GSS97 83788 57930313
GSS98 89143 52417098
GSS99 83341 72414518
HTC1 25078 27084705
HTC10 68763 57931150
HTC11 63086 92340607
HTC12 6140 11900954
HTC2 16058 36229239
HTC3 16038 36659055
HTC4 16267 35590099
HTC5 15990 40339220
HTC6 16079 37520340
HTC7 54075 28899070
HTC8 68822 68666092
HTC9 74820 66153981
HTG1 1315 189001996
HTG10 1242 186554222
HTG11 1431 184145531
HTG12 875 191959854
HTG13 750 192389796
HTG14 744 192349572
HTG15 781 192209305
HTG16 803 192103599
HTG17 767 192339460
HTG18 2057 171267054
HTG19 1060 187954823
HTG2 2565 186048467
HTG20 983 189168049
HTG21 782 191932247
HTG22 924 190481556
HTG23 903 190675343
HTG24 808 191581061
HTG25 778 192132261
HTG26 861 191378895
HTG27 886 190840247
HTG28 948 189926051
HTG29 897 191058389
HTG3 2462 185298819
HTG30 927 190534683
HTG31 873 191385647
HTG32 969 189828845
HTG33 876 191206623
HTG34 856 191509142
HTG35 827 191817102
HTG36 933 190289287
HTG37 932 190866152
HTG38 944 190473113
HTG39 1034 189365258
HTG4 2512 188369264
HTG40 1190 187296947
HTG41 1219 188353891
HTG42 1214 187981531
HTG43 1169 187168544
HTG44 1097 191611449
HTG45 1219 191128483
HTG46 1241 191035081
HTG47 1125 191016734
HTG48 1064 191241274
HTG49 948 189855440
HTG5 1281 185650087
HTG50 1052 189562319
HTG51 935 189770266
HTG52 1013 189819223
HTG53 954 189388393
HTG54 997 189505079
HTG55 933 189214632
HTG56 960 188927643
HTG57 1107 188635272
HTG58 971 189702585
HTG59 1092 186367097
HTG6 1273 185296458
HTG60 1095 188294189
HTG61 991 189350844
HTG62 1028 189164049
HTG63 971 188976728
HTG64 1136 188605223
HTG65 1060 189147126
HTG66 1290 184350752
HTG67 1240 185596635
HTG68 1239 184583979
HTG69 1270 184556192
HTG7 1247 185472319
HTG70 1217 185671394
HTG71 1423 188498058
HTG72 1286 187089618
HTG73 1120 191470147
HTG74 1128 191861721
HTG75 1213 192402180
HTG76 1210 190724567
HTG77 1121 190727665
HTG78 1382 189616290
HTG79 1184 190590209
HTG8 1287 185088399
HTG80 1057 193720413
HTG81 824 182251305
HTG82 1154 192964185
HTG83 1094 193288104
HTG84 1151 179504982
HTG9 1182 187153099
INV1 19424 158207180
INV2 1721 169897633
INV3 27020 122544890
INV4 77673 77590348
INV5 71276 74698851
INV6 78535 72103383
INV7 33368 117309086
INV8 73758 75842681
INV9 4963 31339404
MAM1 43015 127776600
MAM2 62235 91120597
MAM3 487 404900
PAT1 222661 70153368
PAT10 131378 94484437
PAT11 132691 49097192
PAT12 98678 62670606
PAT13 106585 52269888
PAT14 118298 50572468
PAT15 132825 61368974
PAT16 145798 55071555
PAT17 163674 72081754
PAT18 99838 123694029
PAT19 125185 100581343
PAT2 194463 84678606
PAT20 109171 111409176
PAT21 132217 97422079
PAT22 97968 86269861
PAT23 93589 88397252
PAT24 116136 62879962
PAT25 135481 51362787
PAT3 172005 95888203
PAT4 153751 106059983
PAT5 184027 85615040
PAT6 143672 90639971
PAT7 117052 108912035
PAT8 143257 91284644
PAT9 128552 98390983
PHG 3133 20987022
PLN1 41264 114023244
PLN10 7 212935788
PLN11 17643 146973938
PLN12 63594 68848456
PLN13 76364 79825769
PLN14 72704 74979597
PLN15 22074 136449511
PLN16 72865 79608981
PLN17 50337 106632997
PLN18 38689 84149393
PLN2 1329 168842465
PLN3 1700 172870147
PLN4 50910 101459358
PLN5 75726 78871340
PLN6 40848 53265884
PLN7 28068 101003373
PLN8 1267 166333799
PLN9 1016 199395591
PRI1 23601 138184720
PRI10 1446 181739865
PRI11 1304 179062265
PRI12 1529 178067270
PRI13 1586 179764992
PRI14 1510 185706612
PRI15 1239 192348990
PRI16 23052 153417029
PRI17 43536 96669036
PRI18 18195 134846681
PRI19 1609 183733155
PRI2 1495 172941800
PRI20 1713 183451913
PRI21 2098 181541623
PRI22 9242 164934818
PRI23 14453 156379216
PRI24 54887 85141086
PRI25 34266 65734614
PRI26 5246 180115911
PRI27 51032 120381134
PRI28 24888 149684258
PRI29 52631 114710404
PRI3 1283 186456779
PRI30 45927 116667230
PRI31 13609 18265677
PRI4 1316 183769278
PRI5 1192 181567723
PRI6 1214 178891038
PRI7 1231 180702496
PRI8 1363 174476885
PRI9 1226 177460200
ROD1 10551 167353725
ROD10 976 182240100
ROD11 1029 186601938
ROD12 961 183590825
ROD13 1022 187180465
ROD14 954 181242214
ROD15 962 182424639
ROD16 1044 186279949
ROD17 27973 143979646
ROD18 1153 189541310
ROD19 1205 193271370
ROD2 926 174172315
ROD20 1362 193705723
ROD21 43433 81469909
ROD22 19014 121847179
ROD23 46830 143530712
ROD24 126649 38119089
ROD25 18913 25568661
ROD3 905 173962592
ROD4 903 174078642
ROD5 926 174002445
ROD6 986 181144729
ROD7 970 179743598
ROD8 987 181796241
ROD9 1010 183014841
STS1 81961 35118162
STS10 58007 44374628
STS11 57856 43534988
STS12 73664 38752655
STS13 85604 38009156
STS14 20169 7801049
STS2 84099 44831343
STS3 76178 30730745
STS4 67016 33929465
STS5 54867 31984196
STS6 54730 32220767
STS7 54692 32190666
STS8 56286 38614037
STS9 57907 44422629
SYN 35185 47169042
UNA 211 114018
VRL1 72573 65420322
VRL2 71821 65377855
VRL3 68700 70502590
VRL4 64282 70378979
VRL5 66245 71093684
VRL6 40217 38215015
VRT1 26978 151805902
VRT10 9416 178233905
VRT11 67105 76539521
VRT2 51934 112300935
VRT3 37937 134201023
VRT4 69709 66955064
VRT5 22209 113717976
VRT6 1226 192703044
VRT7 1280 192383680
VRT8 8910 180162841
VRT9 14692 172568628
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 155.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
10649134 12385903706 Homo sapiens
6753652 8049817803 Mus musculus
1267882 5747965742 Rattus norvegicus
1663937 3566605068 Bos taurus
1287702 2540551749 Danio rerio
2499723 1998269811 Zea mays
1149146 1500985768 Oryza sativa (japonica cultivar-group)
226213 1251961979 Strongylocentrotus purpuratus
1236899 1075752229 Sus scrofa
1175934 961525020 Xenopus tropicalis
1426915 893771790 Canis familiaris
655519 845341580 Drosophila melanogaster
800633 770627209 Gallus gallus
1198209 758043364 Arabidopsis thaliana
209185 691252171 Pan troglodytes
868038 507883206 Triticum aestivum
397437 468939096 Medicago truncatula
784170 465881813 Sorghum bicolor
69335 463195893 Macaca mulatta
696319 421330392 Ciona intestinalis
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 August 2006
NCBI-GenBank Flat File Release 155.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
code assigned to each entry. (Please use this code when citing
information from GenBank.) Mandatory keyword/one or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when that
system was introduced.
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 155.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, WonHee Jang,
Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
