Release Notes For GenBank Release 158
GBREL.TXT Genetic Sequence Data Bank
February 15 2007
NCBI-GenBank Flat File Release 158.0
Distribution Release Notes
67218344 loci, 71292211453 bases, from 67218344 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 158.0
1.2 Cutoff Date
1.3 Important Changes in Release 158.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 158.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 158.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high.
1.2 Cutoff Date
This full release, 158.0, incorporates data available to the collaborating
databases as of February 8, 2007 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 158.0
1.3.1 Organizational changes
The total number of sequence data files increased by 35 with this release:
- the BCT division is now comprised of 20 files (+2)
- the CON division is now comprised of 4 files (+1)
- the EST division is now comprised of 589 files (+19)
- the GSS division is now comprised of 202 files (+5)
- the HTG division is now comprised of 90 files (+2)
- the PAT division is now comprised of 28 files (+1)
- the PLN division is now comprised of 24 files (+4)
- the VRT division is now comprised of 13 files (+1)
The total number of index files increased by 8 with this release:
- the ACC index is now comprised of 3 files (+2)
- the AUT index is now comprised of 20 files (+4)
- the JOU index is now comprised of 2 files (+1)
- the KEY index is now comprised of 2 files (+1)
These increases reflect changes in the way index files are being
split into multiple files of more manageable sizes. Some flux in
the sizes/numbers of index files can be expected over the next
few releases.
1.3.2 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI. GenBank 158.0 thus contains these index
files, which lack all EST and most GSS content:
gbaut1.idx - gbaut20.idx (20 files)
gbgen.idx
gbjou1.idx - gbjou2.idx (2 files)
gbkey1.idx - gbkey2.idx (2 files)
gbsec.idx
The three gbacc*.idx index files continues to reflect the entirety of the release,
including all EST and GSS records, however the file contents are unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank files, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.3 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
forty-one of the GSS flatfiles in Release 158.0. Consider gbgss162.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2007
NCBI-GenBank Flat File Release 158.0
GSS Sequences (Part 1)
86834 loci, 64352152 bases, from 86834 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "162" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 Multiple identifiers for the PROJECT line
The recently-introduced PROJECT linetype (see Section 3.4.7.2) provides a
way to link GenBank sequences that are part of a sequencing project to the
Entrez Genome Project database, where further details about the project can
be found.
As of June 2007, multiple identifiers will be valid for the PROJECT line.
Here is a mocked-up example of the expected usage:
LOCUS AANA01000001 2 rc DNA linear BCT 09-FEB-2007
DEFINITION Polaribacter dokdonensis MED152 whole genome shotgun sequencing
project.
ACCESSION AANA01000001
VERSION AANA01000001.1 GI:85822094
PROJECT GenomeProject:13543 GenomeProject:99999
There are several situations in which a record could be considered part
of two different Genome Projects. For example, consider an
environmental-sampling metagenomic WGS project for which the individual
sequence-overlap contigs are not attributed to a specific organism. A
Genome Project could exist that provides further details about the
sequencing effort, the centers involved, etc.
If, in subsequent assembly and annotation phases, scaffold/super-contig/
chromosomal records are created which **are** attributed to a specific
organism, then those CON-division records could have two Genome Project IDs:
one for the WGS sequencing project as a whole; and a second for organism-
specific Genome Projects.
Additional examples illustrating the use of multiple Genome Project IDs
will be provided in future release notes, and via the GenBank listserv.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1115 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut3.idx - Index of the entries according to author name, part 3.
18. gbaut4.idx - Index of the entries according to author name, part 4.
19. gbaut5.idx - Index of the entries according to author name, part 5.
20. gbaut6.idx - Index of the entries according to author name, part 6.
21. gbaut7.idx - Index of the entries according to author name, part 7.
22. gbaut8.idx - Index of the entries according to author name, part 8.
23. gbaut9.idx - Index of the entries according to author name, part 9.
24. gbbct1.seq - Bacterial sequence entries, part 1.
25. gbbct10.seq - Bacterial sequence entries, part 10.
26. gbbct11.seq - Bacterial sequence entries, part 11.
27. gbbct12.seq - Bacterial sequence entries, part 12.
28. gbbct13.seq - Bacterial sequence entries, part 13.
29. gbbct14.seq - Bacterial sequence entries, part 14.
30. gbbct15.seq - Bacterial sequence entries, part 15.
31. gbbct16.seq - Bacterial sequence entries, part 16.
32. gbbct17.seq - Bacterial sequence entries, part 17.
33. gbbct18.seq - Bacterial sequence entries, part 18.
34. gbbct19.seq - Bacterial sequence entries, part 19.
35. gbbct2.seq - Bacterial sequence entries, part 2.
36. gbbct20.seq - Bacterial sequence entries, part 20.
37. gbbct3.seq - Bacterial sequence entries, part 3.
38. gbbct4.seq - Bacterial sequence entries, part 4.
39. gbbct5.seq - Bacterial sequence entries, part 5.
40. gbbct6.seq - Bacterial sequence entries, part 6.
41. gbbct7.seq - Bacterial sequence entries, part 7.
42. gbbct8.seq - Bacterial sequence entries, part 8.
43. gbbct9.seq - Bacterial sequence entries, part 9.
44. gbchg.txt - Accession numbers of entries updated since the previous release.
45. gbcon1.seq - Constructed sequence entries, part 1.
46. gbcon2.seq - Constructed sequence entries, part 2.
47. gbcon3.seq - Constructed sequence entries, part 3.
48. gbcon4.seq - Constructed sequence entries, part 4.
49. gbdel.txt - Accession numbers of entries deleted since the previous release.
50. gbenv1.seq - Environmental sampling sequence entries, part 1.
51. gbenv2.seq - Environmental sampling sequence entries, part 2.
52. gbenv3.seq - Environmental sampling sequence entries, part 3.
53. gbenv4.seq - Environmental sampling sequence entries, part 4.
54. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
55. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
56. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
57. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
58. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
59. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
60. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
61. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
62. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
63. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
64. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
65. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
66. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
67. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
68. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
69. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
70. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
71. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
72. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
73. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
74. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
75. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
76. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
77. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
78. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
79. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
80. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
81. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
82. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
83. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
84. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
85. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
86. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
87. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
88. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
89. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
90. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
91. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
92. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
93. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
94. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
95. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
96. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
97. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
98. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
99. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
100. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
101. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
102. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
103. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
104. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
105. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
106. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
107. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
108. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
109. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
110. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
111. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
112. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
113. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
114. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
115. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
116. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
117. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
118. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
119. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
120. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
121. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
122. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
123. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
124. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
125. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
126. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
127. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
128. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
129. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
130. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
131. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
132. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
133. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
134. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
135. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
136. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
137. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
138. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
139. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
140. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
141. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
142. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
143. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
144. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
145. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
146. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
147. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
148. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
149. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
150. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
151. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
152. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
153. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
154. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
155. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
156. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
157. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
158. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
159. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
160. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
161. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
162. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
163. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
164. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
165. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
166. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
167. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
168. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
169. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
170. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
171. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
172. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
173. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
174. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
175. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
176. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
177. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
178. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
179. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
180. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
181. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
182. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
183. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
184. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
185. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
186. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
187. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
188. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
189. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
190. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
191. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
192. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
193. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
194. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
195. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
196. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
197. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
198. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
199. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
200. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
201. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
202. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
203. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
204. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
205. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
206. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
207. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
208. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
209. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
210. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
211. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
212. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
213. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
214. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
215. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
216. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
217. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
218. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
219. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
220. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
221. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
222. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
223. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
224. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
225. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
226. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
227. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
228. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
229. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
230. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
231. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
232. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
233. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
234. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
235. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
236. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
237. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
238. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
239. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
240. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
241. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
242. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
243. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
244. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
245. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
246. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
247. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
248. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
249. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
250. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
251. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
252. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
253. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
254. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
255. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
256. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
257. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
258. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
259. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
260. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
261. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
262. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
263. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
264. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
265. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
266. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
267. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
268. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
269. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
270. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
271. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
272. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
273. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
274. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
275. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
276. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
277. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
278. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
279. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
280. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
281. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
282. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
283. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
284. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
285. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
286. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
287. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
288. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
289. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
290. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
291. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
292. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
293. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
294. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
295. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
296. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
297. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
298. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
299. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
300. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
301. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
302. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
303. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
304. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
305. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
306. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
307. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
308. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
309. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
310. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
311. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
312. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
313. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
314. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
315. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
316. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
317. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
318. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
319. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
320. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
321. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
322. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
323. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
324. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
325. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
326. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
327. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
328. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
329. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
330. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
331. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
332. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
333. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
334. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
335. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
336. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
337. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
338. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
339. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
340. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
341. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
342. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
343. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
344. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
345. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
346. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
347. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
348. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
349. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
350. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
351. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
352. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
353. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
354. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
355. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
356. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
357. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
358. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
359. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
360. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
361. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
362. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
363. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
364. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
365. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
366. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
367. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
368. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
369. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
370. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
371. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
372. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
373. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
374. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
375. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
376. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
377. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
378. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
379. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
380. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
381. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
382. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
383. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
384. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
385. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
386. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
387. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
388. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
389. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
390. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
391. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
392. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
393. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
394. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
395. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
396. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
397. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
398. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
399. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
400. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
401. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
402. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
403. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
404. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
405. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
406. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
407. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
408. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
409. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
410. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
411. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
412. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
413. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
414. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
415. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
416. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
417. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
418. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
419. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
420. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
421. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
422. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
423. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
424. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
425. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
426. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
427. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
428. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
429. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
430. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
431. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
432. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
433. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
434. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
435. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
436. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
437. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
438. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
439. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
440. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
441. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
442. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
443. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
444. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
445. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
446. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
447. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
448. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
449. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
450. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
451. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
452. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
453. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
454. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
455. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
456. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
457. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
458. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
459. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
460. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
461. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
462. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
463. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
464. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
465. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
466. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
467. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
468. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
469. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
470. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
471. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
472. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
473. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
474. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
475. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
476. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
477. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
478. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
479. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
480. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
481. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
482. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
483. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
484. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
485. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
486. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
487. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
488. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
489. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
490. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
491. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
492. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
493. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
494. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
495. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
496. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
497. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
498. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
499. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
500. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
501. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
502. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
503. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
504. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
505. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
506. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
507. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
508. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
509. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
510. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
511. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
512. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
513. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
514. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
515. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
516. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
517. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
518. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
519. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
520. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
521. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
522. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
523. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
524. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
525. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
526. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
527. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
528. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
529. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
530. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
531. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
532. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
533. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
534. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
535. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
536. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
537. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
538. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
539. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
540. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
541. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
542. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
543. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
544. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
545. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
546. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
547. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
548. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
549. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
550. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
551. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
552. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
553. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
554. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
555. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
556. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
557. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
558. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
559. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
560. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
561. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
562. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
563. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
564. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
565. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
566. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
567. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
568. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
569. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
570. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
571. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
572. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
573. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
574. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
575. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
576. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
577. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
578. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
579. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
580. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
581. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
582. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
583. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
584. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
585. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
586. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
587. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
588. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
589. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
590. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
591. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
592. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
593. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
594. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
595. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
596. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
597. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
598. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
599. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
600. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
601. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
602. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
603. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
604. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
605. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
606. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
607. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
608. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
609. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
610. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
611. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
612. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
613. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
614. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
615. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
616. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
617. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
618. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
619. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
620. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
621. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
622. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
623. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
624. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
625. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
626. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
627. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
628. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
629. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
630. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
631. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
632. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
633. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
634. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
635. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
636. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
637. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
638. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
639. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
640. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
641. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
642. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
643. gbgen.idx - Index of the entries according to gene symbols.
644. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
645. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
646. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
647. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
648. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
649. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
650. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
651. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
652. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
653. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
654. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
655. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
656. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
657. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
658. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
659. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
660. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
661. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
662. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
663. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
664. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
665. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
666. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
667. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
668. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
669. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
670. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
671. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
672. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
673. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
674. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
675. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
676. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
677. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
678. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
679. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
680. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
681. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
682. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
683. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
684. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
685. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
686. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
687. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
688. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
689. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
690. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
691. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
692. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
693. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
694. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
695. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
696. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
697. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
698. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
699. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
700. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
701. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
702. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
703. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
704. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
705. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
706. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
707. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
708. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
709. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
710. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
711. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
712. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
713. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
714. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
715. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
716. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
717. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
718. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
719. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
720. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
721. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
722. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
723. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
724. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
725. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
726. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
727. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
728. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
729. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
730. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
731. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
732. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
733. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
734. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
735. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
736. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
737. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
738. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
739. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
740. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
741. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
742. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
743. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
744. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
745. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
746. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
747. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
748. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
749. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
750. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
751. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
752. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
753. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
754. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
755. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
756. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
757. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
758. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
759. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
760. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
761. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
762. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
763. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
764. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
765. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
766. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
767. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
768. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
769. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
770. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
771. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
772. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
773. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
774. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
775. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
776. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
777. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
778. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
779. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
780. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
781. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
782. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
783. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
784. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
785. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
786. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
787. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
788. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
789. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
790. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
791. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
792. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
793. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
794. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
795. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
796. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
797. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
798. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
799. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
800. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
801. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
802. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
803. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
804. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
805. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
806. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
807. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
808. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
809. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
810. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
811. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
812. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
813. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
814. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
815. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
816. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
817. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
818. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
819. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
820. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
821. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
822. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
823. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
824. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
825. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
826. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
827. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
828. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
829. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
830. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
831. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
832. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
833. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
834. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
835. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
836. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
837. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
838. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
839. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
840. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
841. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
842. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
843. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
844. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
845. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
846. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
847. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
848. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
849. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
850. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
851. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
852. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
853. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
854. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
855. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
856. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
857. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
858. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
859. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
860. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
861. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
862. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
863. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
864. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
865. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
866. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
867. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
868. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
869. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
870. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
871. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
872. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
873. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
874. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
875. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
876. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
877. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
878. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
879. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
880. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
881. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
882. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
883. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
884. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
885. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
886. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
887. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
888. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
889. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
890. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
891. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
892. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
893. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
894. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
895. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
896. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
897. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
898. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
899. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
900. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
901. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
902. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
903. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
904. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
905. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
906. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
907. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
908. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
909. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
910. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
911. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
912. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
913. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
914. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
915. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
916. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
917. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
918. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
919. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
920. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
921. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
922. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
923. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
924. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
925. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
926. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
927. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
928. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
929. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
930. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
931. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
932. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
933. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
934. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
935. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
936. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
937. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
938. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
939. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
940. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
941. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
942. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
943. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
944. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
945. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
946. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
947. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
948. gbinv1.seq - Invertebrate sequence entries, part 1.
949. gbinv2.seq - Invertebrate sequence entries, part 2.
950. gbinv3.seq - Invertebrate sequence entries, part 3.
951. gbinv4.seq - Invertebrate sequence entries, part 4.
952. gbinv5.seq - Invertebrate sequence entries, part 5.
953. gbinv6.seq - Invertebrate sequence entries, part 6.
954. gbinv7.seq - Invertebrate sequence entries, part 7.
955. gbinv8.seq - Invertebrate sequence entries, part 8.
956. gbinv9.seq - Invertebrate sequence entries, part 9.
957. gbjou1.idx - Index of the entries according to journal citation, part 1.
958. gbjou2.idx - Index of the entries according to journal citation, part 2.
959. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
960. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
961. gbmam1.seq - Other mammalian sequence entries, part 1.
962. gbmam2.seq - Other mammalian sequence entries, part 2.
963. gbmam3.seq - Other mammalian sequence entries, part 3.
964. gbnew.txt - Accession numbers of entries new since the previous release.
965. gbpat1.seq - Patent sequence entries, part 1.
966. gbpat10.seq - Patent sequence entries, part 10.
967. gbpat11.seq - Patent sequence entries, part 11.
968. gbpat12.seq - Patent sequence entries, part 12.
969. gbpat13.seq - Patent sequence entries, part 13.
970. gbpat14.seq - Patent sequence entries, part 14.
971. gbpat15.seq - Patent sequence entries, part 15.
972. gbpat16.seq - Patent sequence entries, part 16.
973. gbpat17.seq - Patent sequence entries, part 17.
974. gbpat18.seq - Patent sequence entries, part 18.
975. gbpat19.seq - Patent sequence entries, part 19.
976. gbpat2.seq - Patent sequence entries, part 2.
977. gbpat20.seq - Patent sequence entries, part 20.
978. gbpat21.seq - Patent sequence entries, part 21.
979. gbpat22.seq - Patent sequence entries, part 22.
980. gbpat23.seq - Patent sequence entries, part 23.
981. gbpat24.seq - Patent sequence entries, part 24.
982. gbpat25.seq - Patent sequence entries, part 25.
983. gbpat26.seq - Patent sequence entries, part 26.
984. gbpat27.seq - Patent sequence entries, part 27.
985. gbpat28.seq - Patent sequence entries, part 28.
986. gbpat3.seq - Patent sequence entries, part 3.
987. gbpat4.seq - Patent sequence entries, part 4.
988. gbpat5.seq - Patent sequence entries, part 5.
989. gbpat6.seq - Patent sequence entries, part 6.
990. gbpat7.seq - Patent sequence entries, part 7.
991. gbpat8.seq - Patent sequence entries, part 8.
992. gbpat9.seq - Patent sequence entries, part 9.
993. gbphg.seq - Phage sequence entries.
994. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
995. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
996. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
997. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
998. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
999. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1000. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1001. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1002. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1003. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1004. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1005. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1006. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1007. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1008. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1009. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1010. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1011. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1012. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1013. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1014. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1015. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1016. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1017. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1018. gbpri1.seq - Primate sequence entries, part 1.
1019. gbpri10.seq - Primate sequence entries, part 10.
1020. gbpri11.seq - Primate sequence entries, part 11.
1021. gbpri12.seq - Primate sequence entries, part 12.
1022. gbpri13.seq - Primate sequence entries, part 13.
1023. gbpri14.seq - Primate sequence entries, part 14.
1024. gbpri15.seq - Primate sequence entries, part 15.
1025. gbpri16.seq - Primate sequence entries, part 16.
1026. gbpri17.seq - Primate sequence entries, part 17.
1027. gbpri18.seq - Primate sequence entries, part 18.
1028. gbpri19.seq - Primate sequence entries, part 19.
1029. gbpri2.seq - Primate sequence entries, part 2.
1030. gbpri20.seq - Primate sequence entries, part 20.
1031. gbpri21.seq - Primate sequence entries, part 21.
1032. gbpri22.seq - Primate sequence entries, part 22.
1033. gbpri23.seq - Primate sequence entries, part 23.
1034. gbpri24.seq - Primate sequence entries, part 24.
1035. gbpri25.seq - Primate sequence entries, part 25.
1036. gbpri26.seq - Primate sequence entries, part 26.
1037. gbpri27.seq - Primate sequence entries, part 27.
1038. gbpri28.seq - Primate sequence entries, part 28.
1039. gbpri29.seq - Primate sequence entries, part 29.
1040. gbpri3.seq - Primate sequence entries, part 3.
1041. gbpri30.seq - Primate sequence entries, part 30.
1042. gbpri31.seq - Primate sequence entries, part 31.
1043. gbpri32.seq - Primate sequence entries, part 32.
1044. gbpri4.seq - Primate sequence entries, part 4.
1045. gbpri5.seq - Primate sequence entries, part 5.
1046. gbpri6.seq - Primate sequence entries, part 6.
1047. gbpri7.seq - Primate sequence entries, part 7.
1048. gbpri8.seq - Primate sequence entries, part 8.
1049. gbpri9.seq - Primate sequence entries, part 9.
1050. gbrel.txt - Release notes (this document).
1051. gbrod1.seq - Rodent sequence entries, part 1.
1052. gbrod10.seq - Rodent sequence entries, part 10.
1053. gbrod11.seq - Rodent sequence entries, part 11.
1054. gbrod12.seq - Rodent sequence entries, part 12.
1055. gbrod13.seq - Rodent sequence entries, part 13.
1056. gbrod14.seq - Rodent sequence entries, part 14.
1057. gbrod15.seq - Rodent sequence entries, part 15.
1058. gbrod16.seq - Rodent sequence entries, part 16.
1059. gbrod17.seq - Rodent sequence entries, part 17.
1060. gbrod18.seq - Rodent sequence entries, part 18.
1061. gbrod19.seq - Rodent sequence entries, part 19.
1062. gbrod2.seq - Rodent sequence entries, part 2.
1063. gbrod20.seq - Rodent sequence entries, part 20.
1064. gbrod21.seq - Rodent sequence entries, part 21.
1065. gbrod22.seq - Rodent sequence entries, part 22.
1066. gbrod23.seq - Rodent sequence entries, part 23.
1067. gbrod24.seq - Rodent sequence entries, part 24.
1068. gbrod25.seq - Rodent sequence entries, part 25.
1069. gbrod3.seq - Rodent sequence entries, part 3.
1070. gbrod4.seq - Rodent sequence entries, part 4.
1071. gbrod5.seq - Rodent sequence entries, part 5.
1072. gbrod6.seq - Rodent sequence entries, part 6.
1073. gbrod7.seq - Rodent sequence entries, part 7.
1074. gbrod8.seq - Rodent sequence entries, part 8.
1075. gbrod9.seq - Rodent sequence entries, part 9.
1076. gbsdr1.txt - Short directory of the data bank, part 1.
1077. gbsdr2.txt - Short directory of the data bank, part 2.
1078. gbsdr3.txt - Short directory of the data bank, part 3.
1079. gbsec.idx - Index of the entries according to secondary accession number.
1080. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1081. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1082. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1083. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1084. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1085. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1086. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1087. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1088. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1089. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1090. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1091. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1092. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1093. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1094. gbsyn.seq - Synthetic and chimeric sequence entries.
1095. gbuna.seq - Unannotated sequence entries.
1096. gbvrl1.seq - Viral sequence entries, part 1.
1097. gbvrl2.seq - Viral sequence entries, part 2.
1098. gbvrl3.seq - Viral sequence entries, part 3.
1099. gbvrl4.seq - Viral sequence entries, part 4.
1100. gbvrl5.seq - Viral sequence entries, part 5.
1101. gbvrl6.seq - Viral sequence entries, part 6.
1102. gbvrl7.seq - Viral sequence entries, part 7.
1103. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1104. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1105. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1106. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1107. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1108. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1109. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1110. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1111. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1112. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1113. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1114. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1115. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 158.0 flatfiles require roughly 251 GB (sequence
files only) or 263 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
408401010 gbacc1.idx
1374104235 gbacc2.idx
427837944 gbacc3.idx
183912854 gbaut1.idx
183866144 gbaut10.idx
183752652 gbaut11.idx
183765653 gbaut12.idx
183832651 gbaut13.idx
183932599 gbaut14.idx
183916205 gbaut15.idx
183828041 gbaut16.idx
183824953 gbaut17.idx
183920952 gbaut18.idx
183636590 gbaut19.idx
183812538 gbaut2.idx
164220975 gbaut20.idx
183712551 gbaut3.idx
183786882 gbaut4.idx
183891981 gbaut5.idx
183875085 gbaut6.idx
183769619 gbaut7.idx
183846579 gbaut8.idx
183858532 gbaut9.idx
257421335 gbbct1.seq
250191834 gbbct10.seq
250033238 gbbct11.seq
255365487 gbbct12.seq
251901481 gbbct13.seq
258012214 gbbct14.seq
254439511 gbbct15.seq
251163040 gbbct16.seq
252136078 gbbct17.seq
250049803 gbbct18.seq
250000301 gbbct19.seq
250024572 gbbct2.seq
25140438 gbbct20.seq
250907046 gbbct3.seq
250000325 gbbct4.seq
254041327 gbbct5.seq
250001302 gbbct6.seq
250002880 gbbct7.seq
250945836 gbbct8.seq
250664389 gbbct9.seq
6624473 gbchg.txt
155802466 gbcon1.seq
645705157 gbcon2.seq
1311004797 gbcon3.seq
1182643479 gbcon4.seq
10332 gbdel.txt
250000046 gbenv1.seq
250002223 gbenv2.seq
250001608 gbenv3.seq
222311831 gbenv4.seq
230690796 gbest1.seq
230689658 gbest10.seq
230687763 gbest100.seq
230691234 gbest101.seq
230690282 gbest102.seq
230688468 gbest103.seq
230689870 gbest104.seq
230689609 gbest105.seq
230688387 gbest106.seq
230689166 gbest107.seq
230688421 gbest108.seq
230690461 gbest109.seq
230689625 gbest11.seq
230688051 gbest110.seq
230689441 gbest111.seq
230690026 gbest112.seq
230688711 gbest113.seq
230688908 gbest114.seq
230690648 gbest115.seq
230690229 gbest116.seq
230689944 gbest117.seq
230687619 gbest118.seq
230688151 gbest119.seq
230689666 gbest12.seq
230690314 gbest120.seq
230690150 gbest121.seq
230688173 gbest122.seq
230689346 gbest123.seq
230688391 gbest124.seq
230690265 gbest125.seq
230689918 gbest126.seq
230688599 gbest127.seq
230687842 gbest128.seq
230688472 gbest129.seq
230688387 gbest13.seq
230689665 gbest130.seq
230688759 gbest131.seq
230690486 gbest132.seq
230691630 gbest133.seq
230688563 gbest134.seq
230689424 gbest135.seq
230687827 gbest136.seq
230689066 gbest137.seq
230689821 gbest138.seq
230687792 gbest139.seq
230688451 gbest14.seq
230691697 gbest140.seq
230688192 gbest141.seq
230687711 gbest142.seq
230689315 gbest143.seq
230689161 gbest144.seq
230690116 gbest145.seq
230687581 gbest146.seq
230688814 gbest147.seq
230688917 gbest148.seq
230689508 gbest149.seq
230687633 gbest15.seq
230688599 gbest150.seq
230689521 gbest151.seq
230688717 gbest152.seq
230688966 gbest153.seq
230690452 gbest154.seq
230690435 gbest155.seq
230690606 gbest156.seq
230690442 gbest157.seq
230689894 gbest158.seq
230689884 gbest159.seq
230689430 gbest16.seq
230693570 gbest160.seq
230690509 gbest161.seq
230690227 gbest162.seq
230688318 gbest163.seq
230687904 gbest164.seq
230688879 gbest165.seq
230687774 gbest166.seq
230690067 gbest167.seq
230690902 gbest168.seq
230690046 gbest169.seq
230689624 gbest17.seq
230688622 gbest170.seq
230688929 gbest171.seq
230689434 gbest172.seq
230688460 gbest173.seq
230688702 gbest174.seq
230687740 gbest175.seq
223066345 gbest176.seq
230689112 gbest177.seq
230688305 gbest178.seq
230687533 gbest179.seq
230689148 gbest18.seq
230689791 gbest180.seq
230688854 gbest181.seq
230689127 gbest182.seq
230688307 gbest183.seq
230688760 gbest184.seq
230687561 gbest185.seq
230688765 gbest186.seq
230691369 gbest187.seq
230689069 gbest188.seq
230687799 gbest189.seq
230688609 gbest19.seq
230688655 gbest190.seq
230688967 gbest191.seq
230688846 gbest192.seq
230689441 gbest193.seq
230688574 gbest194.seq
230688386 gbest195.seq
230689939 gbest196.seq
230689176 gbest197.seq
230689396 gbest198.seq
230688841 gbest199.seq
230690075 gbest2.seq
230688496 gbest20.seq
230690908 gbest200.seq
230690230 gbest201.seq
230692077 gbest202.seq
230688147 gbest203.seq
230688867 gbest204.seq
230689284 gbest205.seq
230688607 gbest206.seq
230688124 gbest207.seq
230688734 gbest208.seq
230687815 gbest209.seq
230691129 gbest21.seq
230687877 gbest210.seq
230688784 gbest211.seq
230687631 gbest212.seq
230687615 gbest213.seq
230687696 gbest214.seq
230689169 gbest215.seq
230687585 gbest216.seq
230688268 gbest217.seq
230688157 gbest218.seq
230690070 gbest219.seq
230688449 gbest22.seq
230688729 gbest220.seq
230687689 gbest221.seq
230688457 gbest222.seq
230688175 gbest223.seq
230690243 gbest224.seq
230689642 gbest225.seq
187550035 gbest226.seq
162788739 gbest227.seq
163406917 gbest228.seq
171210352 gbest229.seq
230688787 gbest23.seq
169801271 gbest230.seq
164173541 gbest231.seq
165252939 gbest232.seq
164818228 gbest233.seq
164058427 gbest234.seq
164703119 gbest235.seq
164190717 gbest236.seq
164317082 gbest237.seq
163105593 gbest238.seq
168345283 gbest239.seq
230688524 gbest24.seq
162751330 gbest240.seq
162849352 gbest241.seq
166950720 gbest242.seq
168107322 gbest243.seq
165981237 gbest244.seq
165789332 gbest245.seq
165465393 gbest246.seq
165241212 gbest247.seq
164408593 gbest248.seq
164267561 gbest249.seq
230689026 gbest25.seq
165020440 gbest250.seq
164927938 gbest251.seq
179330742 gbest252.seq
173434715 gbest253.seq
180431473 gbest254.seq
230689394 gbest255.seq
230689413 gbest256.seq
230688760 gbest257.seq
230687651 gbest258.seq
230688833 gbest259.seq
230690203 gbest26.seq
230687496 gbest260.seq
230690343 gbest261.seq
230687558 gbest262.seq
230690693 gbest263.seq
230687654 gbest264.seq
230690597 gbest265.seq
230689095 gbest266.seq
230689804 gbest267.seq
230688969 gbest268.seq
230689009 gbest269.seq
230688437 gbest27.seq
230689238 gbest270.seq
230691457 gbest271.seq
230687662 gbest272.seq
230689761 gbest273.seq
230690758 gbest274.seq
230689269 gbest275.seq
230688825 gbest276.seq
230688254 gbest277.seq
230688232 gbest278.seq
230687982 gbest279.seq
230688959 gbest28.seq
230688720 gbest280.seq
230689312 gbest281.seq
230689436 gbest282.seq
230687755 gbest283.seq
230687591 gbest284.seq
230689059 gbest285.seq
207594965 gbest286.seq
230688929 gbest287.seq
230690001 gbest288.seq
230688195 gbest289.seq
230687749 gbest29.seq
230687505 gbest290.seq
230690432 gbest291.seq
230688693 gbest292.seq
230688957 gbest293.seq
230688075 gbest294.seq
230688976 gbest295.seq
230688624 gbest296.seq
230688547 gbest297.seq
230689294 gbest298.seq
230689518 gbest299.seq
230688010 gbest3.seq
230687638 gbest30.seq
230691298 gbest300.seq
230689443 gbest301.seq
230687903 gbest302.seq
230688504 gbest303.seq
230689365 gbest304.seq
230689123 gbest305.seq
230687966 gbest306.seq
230688668 gbest307.seq
230692057 gbest308.seq
230689565 gbest309.seq
230688098 gbest31.seq
230690564 gbest310.seq
230688605 gbest311.seq
230688770 gbest312.seq
230688394 gbest313.seq
230691694 gbest314.seq
230690225 gbest315.seq
230688172 gbest316.seq
230687479 gbest317.seq
230687611 gbest318.seq
230688325 gbest319.seq
230688441 gbest32.seq
230687521 gbest320.seq
230688466 gbest321.seq
230691281 gbest322.seq
230688887 gbest323.seq
230689793 gbest324.seq
230689265 gbest325.seq
230688357 gbest326.seq
230690173 gbest327.seq
230689369 gbest328.seq
230688109 gbest329.seq
230688413 gbest33.seq
230689170 gbest330.seq
230688685 gbest331.seq
230687769 gbest332.seq
230687738 gbest333.seq
230690591 gbest334.seq
230688061 gbest335.seq
204501264 gbest336.seq
230688764 gbest337.seq
230689631 gbest338.seq
230690620 gbest339.seq
230687863 gbest34.seq
230687858 gbest340.seq
230688025 gbest341.seq
199476798 gbest342.seq
142635115 gbest343.seq
230690542 gbest344.seq
230689713 gbest345.seq
230690113 gbest346.seq
230691070 gbest347.seq
230689238 gbest348.seq
230690094 gbest349.seq
230687776 gbest35.seq
230688080 gbest350.seq
230689445 gbest351.seq
230691173 gbest352.seq
230689792 gbest353.seq
230689277 gbest354.seq
230688773 gbest355.seq
230688763 gbest356.seq
230688419 gbest357.seq
230688896 gbest358.seq
230690992 gbest359.seq
230688293 gbest36.seq
230688346 gbest360.seq
230689832 gbest361.seq
230688536 gbest362.seq
230689682 gbest363.seq
230689714 gbest364.seq
221100420 gbest365.seq
230689861 gbest366.seq
230689080 gbest367.seq
230688831 gbest368.seq
230688469 gbest369.seq
230687883 gbest37.seq
230691468 gbest370.seq
230689576 gbest371.seq
230691026 gbest372.seq
230688232 gbest373.seq
230690118 gbest374.seq
230688632 gbest375.seq
230689883 gbest376.seq
230690431 gbest377.seq
230689464 gbest378.seq
230689237 gbest379.seq
230689761 gbest38.seq
230689918 gbest380.seq
230690025 gbest381.seq
230690136 gbest382.seq
230689052 gbest383.seq
230688653 gbest384.seq
230689945 gbest385.seq
230689075 gbest386.seq
230687441 gbest387.seq
230687779 gbest388.seq
230689769 gbest389.seq
230687592 gbest39.seq
230689974 gbest390.seq
230689025 gbest391.seq
230687996 gbest392.seq
230689638 gbest393.seq
230688968 gbest394.seq
230688384 gbest395.seq
230689370 gbest396.seq
211146823 gbest397.seq
230687719 gbest398.seq
230688145 gbest399.seq
230688498 gbest4.seq
230689799 gbest40.seq
230690492 gbest400.seq
230688833 gbest401.seq
230690209 gbest402.seq
230691022 gbest403.seq
230691226 gbest404.seq
230687768 gbest405.seq
230688242 gbest406.seq
230689423 gbest407.seq
230688548 gbest408.seq
230688546 gbest409.seq
230688809 gbest41.seq
230687580 gbest410.seq
230690681 gbest411.seq
230691672 gbest412.seq
230690168 gbest413.seq
230688529 gbest414.seq
210588881 gbest415.seq
210244866 gbest416.seq
210120829 gbest417.seq
210407972 gbest418.seq
210296536 gbest419.seq
230689331 gbest42.seq
210434278 gbest420.seq
211382358 gbest421.seq
211690969 gbest422.seq
211189127 gbest423.seq
212264234 gbest424.seq
213422972 gbest425.seq
211346422 gbest426.seq
210845888 gbest427.seq
210739469 gbest428.seq
210532061 gbest429.seq
192679634 gbest43.seq
210142274 gbest430.seq
210235421 gbest431.seq
210197915 gbest432.seq
210114558 gbest433.seq
225478817 gbest434.seq
230687715 gbest435.seq
230687939 gbest436.seq
230689893 gbest437.seq
230689133 gbest438.seq
230688085 gbest439.seq
191595893 gbest44.seq
230688335 gbest440.seq
230687851 gbest441.seq
230687589 gbest442.seq
230689041 gbest443.seq
230687493 gbest444.seq
230689715 gbest445.seq
230688994 gbest446.seq
230688653 gbest447.seq
230687687 gbest448.seq
230690200 gbest449.seq
211592068 gbest45.seq
230690998 gbest450.seq
230687443 gbest451.seq
230689357 gbest452.seq
230688466 gbest453.seq
230687944 gbest454.seq
230687911 gbest455.seq
230688919 gbest456.seq
230689359 gbest457.seq
226046432 gbest458.seq
230688983 gbest459.seq
216207081 gbest46.seq
230688548 gbest460.seq
230691537 gbest461.seq
230691425 gbest462.seq
230691369 gbest463.seq
230689659 gbest464.seq
230687606 gbest465.seq
230691364 gbest466.seq
230689378 gbest467.seq
230688341 gbest468.seq
230688258 gbest469.seq
215975671 gbest47.seq
230688963 gbest470.seq
230688009 gbest471.seq
230687846 gbest472.seq
230689624 gbest473.seq
230690229 gbest474.seq
230690410 gbest475.seq
230690130 gbest476.seq
230688261 gbest477.seq
230688907 gbest478.seq
230689071 gbest479.seq
217031395 gbest48.seq
230690318 gbest480.seq
230689997 gbest481.seq
230688085 gbest482.seq
230691574 gbest483.seq
230689113 gbest484.seq
230688949 gbest485.seq
230688136 gbest486.seq
230688676 gbest487.seq
230687739 gbest488.seq
230688662 gbest489.seq
230688473 gbest49.seq
230687599 gbest490.seq
230689218 gbest491.seq
230688044 gbest492.seq
230691164 gbest493.seq
230689987 gbest494.seq
230689611 gbest495.seq
230687834 gbest496.seq
230689614 gbest497.seq
230689291 gbest498.seq
230224339 gbest499.seq
164128347 gbest5.seq
230688920 gbest50.seq
230689338 gbest500.seq
230691182 gbest501.seq
230687951 gbest502.seq
230688475 gbest503.seq
230688768 gbest504.seq
230688328 gbest505.seq
230688824 gbest506.seq
230689817 gbest507.seq
230689470 gbest508.seq
230687799 gbest509.seq
229444033 gbest51.seq
230688504 gbest510.seq
230687718 gbest511.seq
230688291 gbest512.seq
230687982 gbest513.seq
196042339 gbest514.seq
208221599 gbest515.seq
230688848 gbest516.seq
230688722 gbest517.seq
230688542 gbest518.seq
230688271 gbest519.seq
228716074 gbest52.seq
230689764 gbest520.seq
230689958 gbest521.seq
230688396 gbest522.seq
230687911 gbest523.seq
230690405 gbest524.seq
230689488 gbest525.seq
230688378 gbest526.seq
230688094 gbest527.seq
230560235 gbest528.seq
222069870 gbest529.seq
230688211 gbest53.seq
230688181 gbest530.seq
230689375 gbest531.seq
230689853 gbest532.seq
230687593 gbest533.seq
230688834 gbest534.seq
230687931 gbest535.seq
219240049 gbest536.seq
216056972 gbest537.seq
230688702 gbest538.seq
230689878 gbest539.seq
230687673 gbest54.seq
230688786 gbest540.seq
230690136 gbest541.seq
230689682 gbest542.seq
230688308 gbest543.seq
230688307 gbest544.seq
230687640 gbest545.seq
230689632 gbest546.seq
230689173 gbest547.seq
230689765 gbest548.seq
230689600 gbest549.seq
230687868 gbest55.seq
230688199 gbest550.seq
230690654 gbest551.seq
230687580 gbest552.seq
230689211 gbest553.seq
230688181 gbest554.seq
230689010 gbest555.seq
230687529 gbest556.seq
230687628 gbest557.seq
230688288 gbest558.seq
230689459 gbest559.seq
230691044 gbest56.seq
230690155 gbest560.seq
230689081 gbest561.seq
230689808 gbest562.seq
230687694 gbest563.seq
230687535 gbest564.seq
230687520 gbest565.seq
220326049 gbest566.seq
230689985 gbest567.seq
230688515 gbest568.seq
230689353 gbest569.seq
230690061 gbest57.seq
230691978 gbest570.seq
230688315 gbest571.seq
230688759 gbest572.seq
230689950 gbest573.seq
230688845 gbest574.seq
230688324 gbest575.seq
230687646 gbest576.seq
230687835 gbest577.seq
230688180 gbest578.seq
230690386 gbest579.seq
230687674 gbest58.seq
230688994 gbest580.seq
230688729 gbest581.seq
230688114 gbest582.seq
230689686 gbest583.seq
230690346 gbest584.seq
230690882 gbest585.seq
225982739 gbest586.seq
230688299 gbest587.seq
230689141 gbest588.seq
44548884 gbest589.seq
230689928 gbest59.seq
177443987 gbest6.seq
230687624 gbest60.seq
230690592 gbest61.seq
230690131 gbest62.seq
230688576 gbest63.seq
230690390 gbest64.seq
230689819 gbest65.seq
229923206 gbest66.seq
230690342 gbest67.seq
211214243 gbest68.seq
209388782 gbest69.seq
230690464 gbest7.seq
208850471 gbest70.seq
209086006 gbest71.seq
209377398 gbest72.seq
210736096 gbest73.seq
209448609 gbest74.seq
208482155 gbest75.seq
210209922 gbest76.seq
209326718 gbest77.seq
205101176 gbest78.seq
208215126 gbest79.seq
230688138 gbest8.seq
207424260 gbest80.seq
210035074 gbest81.seq
222825784 gbest82.seq
230689570 gbest83.seq
230689393 gbest84.seq
223389343 gbest85.seq
214734045 gbest86.seq
214314224 gbest87.seq
230689698 gbest88.seq
230687521 gbest89.seq
230689173 gbest9.seq
230690217 gbest90.seq
230690165 gbest91.seq
230689824 gbest92.seq
230689829 gbest93.seq
230687460 gbest94.seq
230689547 gbest95.seq
230688380 gbest96.seq
230689280 gbest97.seq
230690718 gbest98.seq
230690127 gbest99.seq
62479754 gbgen.idx
230688637 gbgss1.seq
230687925 gbgss10.seq
228961235 gbgss100.seq
227967581 gbgss101.seq
228612853 gbgss102.seq
228592407 gbgss103.seq
228234721 gbgss104.seq
227713457 gbgss105.seq
230688750 gbgss106.seq
230689008 gbgss107.seq
230690456 gbgss108.seq
230689372 gbgss109.seq
230689943 gbgss11.seq
230688410 gbgss110.seq
230687687 gbgss111.seq
230688461 gbgss112.seq
230687567 gbgss113.seq
230689140 gbgss114.seq
230688373 gbgss115.seq
230688273 gbgss116.seq
230690830 gbgss117.seq
230688639 gbgss118.seq
230689503 gbgss119.seq
230687579 gbgss12.seq
230687464 gbgss120.seq
230689682 gbgss121.seq
230688855 gbgss122.seq
230687991 gbgss123.seq
230690337 gbgss124.seq
230689160 gbgss125.seq
230688256 gbgss126.seq
230688300 gbgss127.seq
230689817 gbgss128.seq
230688065 gbgss129.seq
230690564 gbgss13.seq
230687605 gbgss130.seq
230687461 gbgss131.seq
230689258 gbgss132.seq
230691049 gbgss133.seq
230688012 gbgss134.seq
230690138 gbgss135.seq
230690030 gbgss136.seq
230687641 gbgss137.seq
230689398 gbgss138.seq
230689142 gbgss139.seq
230689739 gbgss14.seq
230688799 gbgss140.seq
230689298 gbgss141.seq
230688065 gbgss142.seq
230690380 gbgss143.seq
229486739 gbgss144.seq
226636378 gbgss145.seq
230688013 gbgss146.seq
210543365 gbgss147.seq
230688261 gbgss148.seq
230689391 gbgss149.seq
230688189 gbgss15.seq
230689607 gbgss150.seq
230688951 gbgss151.seq
230690120 gbgss152.seq
230690128 gbgss153.seq
230690220 gbgss154.seq
230688737 gbgss155.seq
230689750 gbgss156.seq
230688994 gbgss157.seq
230689610 gbgss158.seq
230688062 gbgss159.seq
230690067 gbgss16.seq
230688928 gbgss160.seq
209836298 gbgss161.seq
250001357 gbgss162.seq
250001049 gbgss163.seq
250002566 gbgss164.seq
250001260 gbgss165.seq
250003158 gbgss166.seq
250002814 gbgss167.seq
250000938 gbgss168.seq
250001812 gbgss169.seq
230687646 gbgss17.seq
250002369 gbgss170.seq
250002252 gbgss171.seq
250003125 gbgss172.seq
250000355 gbgss173.seq
250002552 gbgss174.seq
250001671 gbgss175.seq
250001316 gbgss176.seq
250002477 gbgss177.seq
250001361 gbgss178.seq
250001270 gbgss179.seq
230690809 gbgss18.seq
250000891 gbgss180.seq
250001685 gbgss181.seq
250001161 gbgss182.seq
250001797 gbgss183.seq
250000186 gbgss184.seq
250000280 gbgss185.seq
250000211 gbgss186.seq
250001032 gbgss187.seq
250001719 gbgss188.seq
250000714 gbgss189.seq
230689798 gbgss19.seq
250002341 gbgss190.seq
250000108 gbgss191.seq
250001809 gbgss192.seq
250001761 gbgss193.seq
250000943 gbgss194.seq
250001239 gbgss195.seq
250002209 gbgss196.seq
250001499 gbgss197.seq
250000332 gbgss198.seq
250000358 gbgss199.seq
230687653 gbgss2.seq
230688957 gbgss20.seq
250001344 gbgss200.seq
250003028 gbgss201.seq
86806649 gbgss202.seq
230687987 gbgss21.seq
230688943 gbgss22.seq
230687620 gbgss23.seq
230689870 gbgss24.seq
230688515 gbgss25.seq
230688470 gbgss26.seq
230688168 gbgss27.seq
230689681 gbgss28.seq
230688986 gbgss29.seq
230687885 gbgss3.seq
230688442 gbgss30.seq
230689741 gbgss31.seq
230689007 gbgss32.seq
230689889 gbgss33.seq
230688063 gbgss34.seq
230687621 gbgss35.seq
230688047 gbgss36.seq
230689687 gbgss37.seq
230689118 gbgss38.seq
230689667 gbgss39.seq
230689545 gbgss4.seq
230690351 gbgss40.seq
230688361 gbgss41.seq
230688389 gbgss42.seq
230687598 gbgss43.seq
230687852 gbgss44.seq
230688979 gbgss45.seq
230688503 gbgss46.seq
230687581 gbgss47.seq
230688141 gbgss48.seq
230689395 gbgss49.seq
230687819 gbgss5.seq
230688644 gbgss50.seq
230688678 gbgss51.seq
230689266 gbgss52.seq
230690739 gbgss53.seq
230687622 gbgss54.seq
230688110 gbgss55.seq
230688701 gbgss56.seq
230689435 gbgss57.seq
230688529 gbgss58.seq
230689701 gbgss59.seq
230689999 gbgss6.seq
230688879 gbgss60.seq
229121133 gbgss61.seq
230687872 gbgss62.seq
230688585 gbgss63.seq
230688864 gbgss64.seq
230688551 gbgss65.seq
230688098 gbgss66.seq
230688399 gbgss67.seq
230687773 gbgss68.seq
230689066 gbgss69.seq
230687516 gbgss7.seq
230688869 gbgss70.seq
230688517 gbgss71.seq
230688292 gbgss72.seq
230688982 gbgss73.seq
230688980 gbgss74.seq
230689524 gbgss75.seq
230689127 gbgss76.seq
230688589 gbgss77.seq
230687703 gbgss78.seq
230687897 gbgss79.seq
230688381 gbgss8.seq
230688670 gbgss80.seq
208067168 gbgss81.seq
194698973 gbgss82.seq
212057242 gbgss83.seq
230689417 gbgss84.seq
230689904 gbgss85.seq
230688833 gbgss86.seq
230687953 gbgss87.seq
230687802 gbgss88.seq
230689707 gbgss89.seq
230688662 gbgss9.seq
230688468 gbgss90.seq
230690679 gbgss91.seq
230687485 gbgss92.seq
230689910 gbgss93.seq
230689666 gbgss94.seq
230690133 gbgss95.seq
230688860 gbgss96.seq
230689274 gbgss97.seq
230689898 gbgss98.seq
230689450 gbgss99.seq
250005768 gbhtc1.seq
250001160 gbhtc10.seq
250003774 gbhtc11.seq
98409280 gbhtc12.seq
250008815 gbhtc2.seq
250006067 gbhtc3.seq
250002503 gbhtc4.seq
250004562 gbhtc5.seq
250004817 gbhtc6.seq
250002265 gbhtc7.seq
250002749 gbhtc8.seq
250002011 gbhtc9.seq
250174851 gbhtg1.seq
250177384 gbhtg10.seq
250145483 gbhtg11.seq
250212138 gbhtg12.seq
250055823 gbhtg13.seq
250194391 gbhtg14.seq
250222621 gbhtg15.seq
250063047 gbhtg16.seq
250221156 gbhtg17.seq
250071124 gbhtg18.seq
250142761 gbhtg19.seq
250047063 gbhtg2.seq
250100123 gbhtg20.seq
250263979 gbhtg21.seq
250028119 gbhtg22.seq
250035431 gbhtg23.seq
250154110 gbhtg24.seq
250245676 gbhtg25.seq
250060980 gbhtg26.seq
250048193 gbhtg27.seq
250280021 gbhtg28.seq
250050401 gbhtg29.seq
250012077 gbhtg3.seq
250180402 gbhtg30.seq
250040712 gbhtg31.seq
250075133 gbhtg32.seq
250054321 gbhtg33.seq
250059683 gbhtg34.seq
250032830 gbhtg35.seq
250108652 gbhtg36.seq
250102823 gbhtg37.seq
250144101 gbhtg38.seq
250260803 gbhtg39.seq
250018685 gbhtg4.seq
250006936 gbhtg40.seq
250015952 gbhtg41.seq
250002650 gbhtg42.seq
250310871 gbhtg43.seq
250113106 gbhtg44.seq
250102459 gbhtg45.seq
250020932 gbhtg46.seq
250011158 gbhtg47.seq
250100820 gbhtg48.seq
250086351 gbhtg49.seq
250070433 gbhtg5.seq
250194538 gbhtg50.seq
250276235 gbhtg51.seq
250059592 gbhtg52.seq
250060875 gbhtg53.seq
250274598 gbhtg54.seq
250326688 gbhtg55.seq
250062960 gbhtg56.seq
250353495 gbhtg57.seq
250176066 gbhtg58.seq
250035804 gbhtg59.seq
250053403 gbhtg6.seq
250020115 gbhtg60.seq
250174272 gbhtg61.seq
250239418 gbhtg62.seq
250155823 gbhtg63.seq
250089563 gbhtg64.seq
250151206 gbhtg65.seq
250111336 gbhtg66.seq
250129218 gbhtg67.seq
250164716 gbhtg68.seq
250156970 gbhtg69.seq
250134380 gbhtg7.seq
250044556 gbhtg70.seq
250199981 gbhtg71.seq
250148397 gbhtg72.seq
250006989 gbhtg73.seq
250050844 gbhtg74.seq
250002873 gbhtg75.seq
250148012 gbhtg76.seq
250043470 gbhtg77.seq
250196852 gbhtg78.seq
250000640 gbhtg79.seq
250119528 gbhtg8.seq
250044775 gbhtg80.seq
250105077 gbhtg81.seq
250211852 gbhtg82.seq
250120595 gbhtg83.seq
250290147 gbhtg84.seq
250010726 gbhtg85.seq
250159541 gbhtg86.seq
250085211 gbhtg87.seq
250083206 gbhtg88.seq
250077238 gbhtg89.seq
250000639 gbhtg9.seq
136627189 gbhtg90.seq
250139525 gbinv1.seq
265201321 gbinv2.seq
250004874 gbinv3.seq
250001092 gbinv4.seq
250001574 gbinv5.seq
250002237 gbinv6.seq
250000589 gbinv7.seq
250003524 gbinv8.seq
205888401 gbinv9.seq
170976765 gbjou1.idx
239826454 gbjou2.idx
191482503 gbkey1.idx
74470511 gbkey2.idx
250000677 gbmam1.seq
250002174 gbmam2.seq
128498207 gbmam3.seq
36775548 gbnew.txt
250000582 gbpat1.seq
250002995 gbpat10.seq
250000048 gbpat11.seq
250000972 gbpat12.seq
250001273 gbpat13.seq
250000078 gbpat14.seq
250000136 gbpat15.seq
250001737 gbpat16.seq
250001728 gbpat17.seq
250008121 gbpat18.seq
250000229 gbpat19.seq
250001593 gbpat2.seq
250000154 gbpat20.seq
250001197 gbpat21.seq
250126253 gbpat22.seq
250000481 gbpat23.seq
250034896 gbpat24.seq
250000967 gbpat25.seq
250003621 gbpat26.seq
250000684 gbpat27.seq
4901728 gbpat28.seq
250000965 gbpat3.seq
250001545 gbpat4.seq
250001408 gbpat5.seq
250000196 gbpat6.seq
250000696 gbpat7.seq
250000078 gbpat8.seq
250000409 gbpat9.seq
55947478 gbphg.seq
250064305 gbpln1.seq
250010418 gbpln10.seq
250001371 gbpln11.seq
250053515 gbpln12.seq
250081646 gbpln13.seq
310314332 gbpln14.seq
256261948 gbpln15.seq
250177361 gbpln16.seq
250000069 gbpln17.seq
250001221 gbpln18.seq
250000644 gbpln19.seq
250220183 gbpln2.seq
250003579 gbpln20.seq
250001804 gbpln21.seq
250001426 gbpln22.seq
250015804 gbpln23.seq
15168386 gbpln24.seq
250132034 gbpln3.seq
250000308 gbpln4.seq
250003111 gbpln5.seq
250001910 gbpln6.seq
250001863 gbpln7.seq
250178417 gbpln8.seq
250039198 gbpln9.seq
250088931 gbpri1.seq
250204306 gbpri10.seq
250116927 gbpri11.seq
250011854 gbpri12.seq
250048145 gbpri13.seq
250126908 gbpri14.seq
250100191 gbpri15.seq
250245052 gbpri16.seq
250029747 gbpri17.seq
250001896 gbpri18.seq
250006841 gbpri19.seq
250123035 gbpri2.seq
250062711 gbpri20.seq
250115124 gbpri21.seq
250007732 gbpri22.seq
250065923 gbpri23.seq
250102092 gbpri24.seq
250143882 gbpri25.seq
250056781 gbpri26.seq
250001889 gbpri27.seq
250009642 gbpri28.seq
250190706 gbpri29.seq
250180864 gbpri3.seq
250001821 gbpri30.seq
250000159 gbpri31.seq
197588163 gbpri32.seq
250076362 gbpri4.seq
250154809 gbpri5.seq
250074140 gbpri6.seq
250175585 gbpri7.seq
250101248 gbpri8.seq
250136205 gbpri9.seq
239619 gbrel.txt
250304060 gbrod1.seq
250263288 gbrod10.seq
250178218 gbrod11.seq
250123809 gbrod12.seq
250050896 gbrod13.seq
250173213 gbrod14.seq
250040098 gbrod15.seq
250057986 gbrod16.seq
250091164 gbrod17.seq
250285969 gbrod18.seq
250237756 gbrod19.seq
250118153 gbrod2.seq
250105759 gbrod20.seq
250003823 gbrod21.seq
250002934 gbrod22.seq
250183526 gbrod23.seq
250001362 gbrod24.seq
184097860 gbrod25.seq
250074023 gbrod3.seq
250031977 gbrod4.seq
250076953 gbrod5.seq
250075447 gbrod6.seq
250125138 gbrod7.seq
250176883 gbrod8.seq
250093402 gbrod9.seq
704427392 gbsdr1.txt
3341237774 gbsdr2.txt
1331873285 gbsdr3.txt
1409197 gbsec.idx
250002604 gbsts1.seq
250001591 gbsts10.seq
250000100 gbsts11.seq
250000476 gbsts12.seq
250002904 gbsts13.seq
156602273 gbsts14.seq
250001674 gbsts2.seq
250001192 gbsts3.seq
250001619 gbsts4.seq
250002231 gbsts5.seq
250004523 gbsts6.seq
250004235 gbsts7.seq
250003836 gbsts8.seq
250003351 gbsts9.seq
226638791 gbsyn.seq
422536 gbuna.seq
250000146 gbvrl1.seq
250000935 gbvrl2.seq
250000717 gbvrl3.seq
250003648 gbvrl4.seq
250000021 gbvrl5.seq
250000521 gbvrl6.seq
93926435 gbvrl7.seq
250122029 gbvrt1.seq
250141939 gbvrt10.seq
250106400 gbvrt11.seq
250000950 gbvrt12.seq
60754762 gbvrt13.seq
250004023 gbvrt2.seq
250159900 gbvrt3.seq
250000844 gbvrt4.seq
250004092 gbvrt5.seq
250144361 gbvrt6.seq
250171027 gbvrt7.seq
250041180 gbvrt8.seq
250121908 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 27586 105901637
BCT10 190 95674449
BCT11 63 112827230
BCT12 55 112910154
BCT13 46 116009207
BCT14 60 117993630
BCT15 70 113924085
BCT16 42 111722424
BCT17 83 106768567
BCT18 47979 89900630
BCT19 51137 91889906
BCT2 4847 107725890
BCT20 3278 8811908
BCT3 144 112033611
BCT4 24610 103565275
BCT5 52768 87161975
BCT6 5458 95641508
BCT7 13518 104912374
BCT8 64164 84947638
BCT9 76 112707847
ENV1 92139 71719835
ENV2 93291 77097885
ENV3 87505 82353040
ENV4 81522 74976767
EST1 68128 26290229
EST10 76541 29845692
EST100 72053 32175114
EST101 73967 44534271
EST102 66742 36110551
EST103 73036 36611829
EST104 72819 46423671
EST105 72892 42895651
EST106 68905 46165069
EST107 74320 34856551
EST108 70553 29720877
EST109 64581 31292325
EST11 75114 28771931
EST110 68967 41780496
EST111 69666 37485365
EST112 70522 43047334
EST113 75498 34021972
EST114 74316 27657480
EST115 75058 27592523
EST116 73164 41166848
EST117 64485 30451197
EST118 78352 48755163
EST119 78394 44918583
EST12 77704 30805257
EST120 71840 45787713
EST121 68811 41455878
EST122 72687 48650275
EST123 68435 43774652
EST124 72161 44206295
EST125 76555 44083709
EST126 71077 48590765
EST127 74952 47939836
EST128 73897 45956939
EST129 78087 35477352
EST13 77114 29306020
EST130 77894 27285460
EST131 80030 49461257
EST132 74754 42895470
EST133 65613 36448767
EST134 72352 36483905
EST135 66275 36907243
EST136 66758 36498830
EST137 70185 42962617
EST138 72881 42766537
EST139 68160 41969692
EST14 78509 31797414
EST140 68379 40976800
EST141 74703 43727313
EST142 68432 41025213
EST143 59447 34051105
EST144 96315 52013742
EST145 86786 50054455
EST146 76877 39469908
EST147 101140 54276834
EST148 108594 58532248
EST149 98300 54314279
EST15 74841 31633615
EST150 74066 45095049
EST151 94360 55050312
EST152 99441 59840855
EST153 93659 57812668
EST154 79217 43461534
EST155 69072 39270197
EST156 66225 31120440
EST157 61515 27987592
EST158 56784 27331883
EST159 65098 31455655
EST16 75820 33341066
EST160 55436 27987862
EST161 76389 47966212
EST162 67774 41082525
EST163 71247 50898061
EST164 75089 43001701
EST165 59621 30300851
EST166 63702 33933375
EST167 65545 37004038
EST168 63965 45470281
EST169 62738 35957968
EST17 82600 34092888
EST170 102480 46249841
EST171 86212 50561791
EST172 99488 56840893
EST173 99716 57881220
EST174 97729 51263666
EST175 81389 39799737
EST176 90354 37124894
EST177 94769 50831858
EST178 89243 36522405
EST179 95226 40878826
EST18 81030 32199733
EST180 67260 40239273
EST181 68630 42079109
EST182 63902 36969179
EST183 65518 42687513
EST184 69429 30290942
EST185 76952 33617873
EST186 67939 42303117
EST187 82430 41046992
EST188 62642 32530618
EST189 66793 48460578
EST19 78351 31879601
EST190 70421 45698382
EST191 67795 36246379
EST192 68051 44594235
EST193 69202 53797924
EST194 68915 34032726
EST195 71670 41082097
EST196 69956 59839016
EST197 66393 49598492
EST198 64613 47020236
EST199 64122 47546642
EST2 74651 28648016
EST20 74797 30650654
EST200 66069 46050234
EST201 65897 48289761
EST202 63361 45561909
EST203 62551 37472146
EST204 63680 34540136
EST205 64367 37541984
EST206 83949 47761325
EST207 83869 54607997
EST208 70691 41179464
EST209 106330 66545429
EST21 73427 34176548
EST210 108529 65403470
EST211 108944 64438745
EST212 103356 66855835
EST213 107284 58884138
EST214 106411 50413043
EST215 90130 55022134
EST216 98313 44248135
EST217 92521 48255644
EST218 72369 46815993
EST219 67521 44166122
EST22 75839 30423651
EST220 68591 58507653
EST221 68703 57997050
EST222 80140 40032522
EST223 79925 46718297
EST224 74709 52945092
EST225 71041 51790421
EST226 40241 20148875
EST227 27781 10549880
EST228 27667 10231693
EST229 26319 9747231
EST23 77299 32592606
EST230 26637 8976258
EST231 27555 9821315
EST232 27191 10048020
EST233 27176 9758324
EST234 27327 10254971
EST235 27105 12114474
EST236 27215 11228755
EST237 27303 10120673
EST238 27607 9283610
EST239 26839 9182854
EST24 74887 33094820
EST240 27765 11280802
EST241 27772 10810068
EST242 27070 11333006
EST243 26616 11924138
EST244 27064 11363846
EST245 27046 10904079
EST246 27022 11505152
EST247 27134 11549907
EST248 27262 11158114
EST249 27264 10824414
EST25 73588 31538649
EST250 27184 10561218
EST251 27196 10795095
EST252 24657 17248980
EST253 25593 17048788
EST254 40057 19075655
EST255 90729 44520790
EST256 48643 28515276
EST257 103865 40659883
EST258 70997 40764226
EST259 68633 44552742
EST26 75649 31261782
EST260 69436 44542419
EST261 69306 44143666
EST262 67718 39758794
EST263 72909 42558075
EST264 64997 49080757
EST265 64204 32283337
EST266 78957 39099628
EST267 101947 46852914
EST268 73138 42104135
EST269 66376 33589392
EST27 75216 32708007
EST270 68140 32969331
EST271 70190 42394903
EST272 73649 34816421
EST273 70195 35242265
EST274 73389 46780349
EST275 63697 33863542
EST276 67738 38235735
EST277 81959 42990035
EST278 75796 42682884
EST279 79067 51454986
EST28 108389 51534424
EST280 75719 54220580
EST281 111609 49074323
EST282 83737 42503146
EST283 73330 45494565
EST284 73501 40181614
EST285 72229 38165008
EST286 70097 27564038
EST287 70042 41517519
EST288 62141 33836811
EST289 63776 41832069
EST29 97393 46472579
EST290 71419 40536539
EST291 61952 44181409
EST292 63396 31960982
EST293 82421 43427445
EST294 83732 42932217
EST295 77920 49332308
EST296 104295 57311876
EST297 124225 46066330
EST298 73528 37196008
EST299 68101 35379831
EST3 73738 29916603
EST30 98702 53777605
EST300 69580 46606235
EST301 80682 39460750
EST302 71338 42122571
EST303 71677 41400169
EST304 60276 33834967
EST305 56667 35253367
EST306 62469 38362563
EST307 70759 47985110
EST308 69151 42245934
EST309 72102 41890800
EST31 80523 46316101
EST310 73435 37471381
EST311 59035 30786927
EST312 53767 27564393
EST313 52763 28190814
EST314 53018 28298828
EST315 51901 27001440
EST316 53961 26375571
EST317 55685 24461835
EST318 55264 23370544
EST319 54455 22368282
EST32 65599 49341414
EST320 55566 21412420
EST321 54968 22090410
EST322 56143 22359295
EST323 55017 21375393
EST324 56187 20130076
EST325 64950 35693189
EST326 76535 35279168
EST327 74455 33330877
EST328 77253 32953837
EST329 76599 33322791
EST33 73807 53416425
EST330 93141 61547422
EST331 67907 52693491
EST332 92682 56093775
EST333 93011 56026348
EST334 92588 55175770
EST335 66753 37416557
EST336 74149 36810287
EST337 66920 52558732
EST338 64890 49771605
EST339 57892 43792911
EST34 85777 47810127
EST340 61701 35336378
EST341 71397 44163824
EST342 64467 41108567
EST343 48102 23696033
EST344 67847 35757889
EST345 66687 36089506
EST346 60905 29661081
EST347 64853 41535277
EST348 78003 45526356
EST349 77068 41195082
EST35 86999 44523800
EST350 64760 37936937
EST351 74108 43236388
EST352 64548 43962686
EST353 78416 46010140
EST354 84730 49530990
EST355 86626 47187332
EST356 62643 33025494
EST357 65619 39876962
EST358 74977 38982181
EST359 49288 25684870
EST36 96823 52648674
EST360 59665 33486262
EST361 70202 40850529
EST362 92752 47195022
EST363 78730 41119589
EST364 73469 49809935
EST365 68678 46689860
EST366 66027 37265498
EST367 65610 34751400
EST368 88371 39221152
EST369 60101 38832218
EST37 79853 57784455
EST370 53006 38071107
EST371 64773 35872361
EST372 86185 52913332
EST373 92142 51271408
EST374 67088 40194081
EST375 78444 42676812
EST376 57901 38211221
EST377 43512 21352291
EST378 57995 36192644
EST379 83227 45186804
EST38 80794 56598270
EST380 78765 46557855
EST381 73150 44619580
EST382 80351 47145816
EST383 76698 49304324
EST384 75691 55348420
EST385 65055 37986223
EST386 61943 40798062
EST387 74890 39569639
EST388 52872 33038508
EST389 80580 29814111
EST39 100943 49852697
EST390 81733 33060758
EST391 68428 42229677
EST392 64518 36531152
EST393 68877 36506380
EST394 73677 43636257
EST395 65213 45354563
EST396 63821 40964099
EST397 78969 46406191
EST398 58147 33318251
EST399 59255 36803342
EST4 74568 28390131
EST40 93957 45605097
EST400 82234 51919288
EST401 84192 49152448
EST402 74797 42775788
EST403 58872 41143450
EST404 56881 40943962
EST405 57272 40555186
EST406 64163 39432295
EST407 74878 45821167
EST408 52872 33316663
EST409 61426 38914808
EST41 95569 48081362
EST410 57959 40835816
EST411 61465 41212274
EST412 55698 41984537
EST413 46999 33491412
EST414 93163 42408963
EST415 69434 38580994
EST416 69708 38338180
EST417 69866 38223791
EST418 69535 38783552
EST419 69611 38494125
EST42 96624 39454018
EST420 69568 38739343
EST421 68928 38375020
EST422 68889 39135048
EST423 69182 38434027
EST424 68184 37539209
EST425 67688 38699559
EST426 69359 39109561
EST427 69289 38187724
EST428 69439 38463668
EST429 69536 38068975
EST43 68612 18431586
EST430 69865 38141047
EST431 69685 38375997
EST432 69765 38285849
EST433 69958 37348985
EST434 84060 48060029
EST435 84795 44099350
EST436 80987 37400629
EST437 98815 57569755
EST438 80020 43766805
EST439 79091 50236213
EST44 68853 18420527
EST440 89884 57203682
EST441 96703 59215146
EST442 56535 41690094
EST443 51505 40498379
EST444 76938 45396579
EST445 57119 34750847
EST446 80583 47122452
EST447 121280 61006174
EST448 72272 45397081
EST449 81202 57865567
EST45 67435 20367344
EST450 41932 23289379
EST451 49154 51772109
EST452 46533 58547199
EST453 77411 54464875
EST454 64877 36862981
EST455 73245 43566897
EST456 67076 42606417
EST457 68585 42213978
EST458 60234 52678536
EST459 91098 44095758
EST46 43607 11891291
EST460 109209 47896244
EST461 75040 52338003
EST462 59651 39588868
EST463 57236 40961075
EST464 58832 39177804
EST465 65782 50671056
EST466 62653 44927962
EST467 61079 41793545
EST468 51797 38359264
EST469 56887 38635460
EST47 43449 12208578
EST470 55659 41429346
EST471 69187 37588492
EST472 65975 44042884
EST473 57122 38076340
EST474 61926 42877412
EST475 58427 45768487
EST476 65150 48704405
EST477 63151 41707835
EST478 54169 41303293
EST479 53547 35711526
EST48 43217 11488290
EST480 53156 36472243
EST481 59850 38814001
EST482 67680 40181230
EST483 64558 44870395
EST484 75072 61548526
EST485 74638 50230963
EST486 59565 52798098
EST487 48375 55256478
EST488 61448 52550201
EST489 63186 40510828
EST49 69536 26726191
EST490 67393 38023295
EST491 82530 51767176
EST492 81201 54365156
EST493 77390 46924626
EST494 65446 41038447
EST495 67844 41764369
EST496 77287 51300434
EST497 81007 49107860
EST498 75108 62960749
EST499 73266 49062826
EST5 48198 15295086
EST50 97679 44455682
EST500 68723 47992851
EST501 67475 52104534
EST502 62703 45476153
EST503 63055 45197620
EST504 87302 46081811
EST505 89300 43250720
EST506 123375 40724272
EST507 89941 56713317
EST508 61887 51262672
EST509 50783 50210753
EST51 93868 45601366
EST510 86733 28167193
EST511 99641 11153452
EST512 99713 11036046
EST513 97518 40492305
EST514 86999 31675091
EST515 86607 34018248
EST516 64568 56668504
EST517 81266 56072279
EST518 86942 49973853
EST519 72436 41468594
EST52 90301 44403059
EST520 71664 51863650
EST521 72497 44712371
EST522 86969 54469802
EST523 74856 48764792
EST524 73310 52939444
EST525 65760 49303929
EST526 79944 57801956
EST527 89480 45653402
EST528 83538 48094961
EST529 83320 39291043
EST53 99554 49580598
EST530 75338 40783562
EST531 86189 53734698
EST532 75014 52179633
EST533 70278 52348906
EST534 73016 42415452
EST535 99672 49644440
EST536 112330 47316963
EST537 112389 48471611
EST538 131325 59500750
EST539 109415 54080516
EST54 104165 53582072
EST540 77605 54970142
EST541 84439 24096521
EST542 84291 8747725
EST543 109901 51371574
EST544 128764 62016247
EST545 82764 46729020
EST546 63597 40631090
EST547 75807 49262931
EST548 77086 49977426
EST549 71794 45665943
EST55 75973 33392193
EST550 77152 46393022
EST551 66777 51688806
EST552 74168 47632194
EST553 66330 43703929
EST554 72159 53708530
EST555 102848 62452362
EST556 78061 44387011
EST557 77592 41296515
EST558 83794 45747710
EST559 93998 45546768
EST56 67267 28502122
EST560 72487 50320532
EST561 78397 54731911
EST562 81195 54323845
EST563 84071 55779712
EST564 82226 52339576
EST565 79550 38293977
EST566 71043 48914467
EST567 61286 39911519
EST568 65891 39696683
EST569 68200 42672813
EST57 72256 32690249
EST570 50956 32660466
EST571 51356 33024567
EST572 50585 36013042
EST573 78432 52125261
EST574 68567 50339606
EST575 110892 21681972
EST576 120615 14768021
EST577 125177 11373525
EST578 125066 11538692
EST579 106817 24356775
EST58 71216 30167396
EST580 68813 50237394
EST581 68407 49568384
EST582 75861 25800406
EST583 71671 25922692
EST584 73238 26767959
EST585 72732 26354330
EST586 78270 26358818
EST587 72523 28283040
EST588 68723 28133847
EST589 18871 5611945
EST59 78926 32309466
EST6 54921 17444242
EST60 78076 30718328
EST61 70125 28131970
EST62 64240 29479143
EST63 73126 32469132
EST64 79576 35768574
EST65 73558 29266187
EST66 73753 25282579
EST67 87017 42063071
EST68 44310 13027360
EST69 40396 11116221
EST7 74545 29357383
EST70 40399 12320845
EST71 40748 12596577
EST72 40745 12153253
EST73 40805 13215936
EST74 40660 12687208
EST75 40486 12350653
EST76 40101 11933251
EST77 40731 12805346
EST78 41499 11684098
EST79 41028 13177599
EST8 75835 30591559
EST80 40933 12692813
EST81 41552 13279996
EST82 45657 13231393
EST83 43503 27566943
EST84 42001 20707801
EST85 46725 18775082
EST86 50542 23163496
EST87 51109 20951343
EST88 75385 44559973
EST89 78508 39090656
EST9 77569 29867913
EST90 73885 28866029
EST91 76379 28984164
EST92 73450 37839394
EST93 76337 42925303
EST94 76939 44096044
EST95 75696 35441198
EST96 76260 43517214
EST97 71242 37082261
EST98 74952 31902466
EST99 73052 46770039
GSS1 90403 38650982
GSS10 74873 43594696
GSS100 75810 43231204
GSS101 74356 43206739
GSS102 73608 45092575
GSS103 73629 45038170
GSS104 73272 45297711
GSS105 73284 44775941
GSS106 75777 48190154
GSS107 83795 55974348
GSS108 82629 54569481
GSS109 82646 51435711
GSS11 70608 35929964
GSS110 86017 53394087
GSS111 81863 63616271
GSS112 78732 47560409
GSS113 94779 52327129
GSS114 83071 51080237
GSS115 79790 53693392
GSS116 87353 68453691
GSS117 78089 48308490
GSS118 75367 49032947
GSS119 91166 47631879
GSS12 72867 38288960
GSS120 89490 55125120
GSS121 85498 53949272
GSS122 85997 56562476
GSS123 77752 60625063
GSS124 76047 68594386
GSS125 78394 63264070
GSS126 79054 53774152
GSS127 78715 54638659
GSS128 79236 53833881
GSS129 78915 54354604
GSS13 76706 38976659
GSS130 78774 54526516
GSS131 84103 58848781
GSS132 82174 57962358
GSS133 72871 57492909
GSS134 67952 54817422
GSS135 76141 65709270
GSS136 75502 66319514
GSS137 78329 52621574
GSS138 83265 52684145
GSS139 94422 58267005
GSS14 71317 32131575
GSS140 93664 59421152
GSS141 81393 54483747
GSS142 91411 49328437
GSS143 71471 63324533
GSS144 112221 56794978
GSS145 115012 58317130
GSS146 87938 62796819
GSS147 60582 37702932
GSS148 65262 44904309
GSS149 72906 55885064
GSS15 70051 34744962
GSS150 72985 55914938
GSS151 72999 55890600
GSS152 73006 55878093
GSS153 72976 55930053
GSS154 72985 55915683
GSS155 76817 59574051
GSS156 81974 37900297
GSS157 87621 59758899
GSS158 88498 63589356
GSS159 85847 61535054
GSS16 78481 46287362
GSS160 89748 56766857
GSS161 71970 48276534
GSS162 86834 64352152
GSS163 83575 62755583
GSS164 103097 48154460
GSS165 68573 58504175
GSS166 68308 58776118
GSS167 69368 56630047
GSS168 69629 56121839
GSS169 70359 55392866
GSS17 70906 33297270
GSS170 85867 73154326
GSS171 86330 44801801
GSS172 88555 47327143
GSS173 85088 64703508
GSS174 70298 58976642
GSS175 69810 59960783
GSS176 63537 60854074
GSS177 81899 47181123
GSS178 86421 35917394
GSS179 95872 74764383
GSS18 59083 27955126
GSS180 93028 47645401
GSS181 107928 59832338
GSS182 120671 73159279
GSS183 117284 76240757
GSS184 105028 55802038
GSS185 82118 54226893
GSS186 95322 60409618
GSS187 107279 78696621
GSS188 108166 77748178
GSS189 106183 79893796
GSS19 56793 29072986
GSS190 104855 81001984
GSS191 76135 51054952
GSS192 109153 66108331
GSS193 109961 66306217
GSS194 108963 63914808
GSS195 79152 43750476
GSS196 106301 51116121
GSS197 84801 40184974
GSS198 95511 37110395
GSS199 95533 37074218
GSS2 88922 39302459
GSS20 57668 26711291
GSS200 95460 37197279
GSS201 94426 39794364
GSS202 28323 27568615
GSS21 61407 28966548
GSS22 64809 38244472
GSS23 57538 27054876
GSS24 66074 42002910
GSS25 68294 28341003
GSS26 58182 25339251
GSS27 65220 31889902
GSS28 65622 32588692
GSS29 77073 39616607
GSS3 87407 41798561
GSS30 82957 39733837
GSS31 74196 40402021
GSS32 70532 48278528
GSS33 79797 37820178
GSS34 75878 40339244
GSS35 74094 40092533
GSS36 87331 56000162
GSS37 87600 58170874
GSS38 85511 44950825
GSS39 86886 50521806
GSS4 78863 41012944
GSS40 86224 40151618
GSS41 83189 31660038
GSS42 81245 56935935
GSS43 80201 58163386
GSS44 72026 47499324
GSS45 72032 47437663
GSS46 77658 45789103
GSS47 77835 38607298
GSS48 83194 57974590
GSS49 86561 64612160
GSS5 78780 40537254
GSS50 81536 54554514
GSS51 93903 59234791
GSS52 88543 58798172
GSS53 76745 42467666
GSS54 72681 40296625
GSS55 86593 47186323
GSS56 88047 58388246
GSS57 77148 64748338
GSS58 71972 79313341
GSS59 86737 69317920
GSS6 78152 38866862
GSS60 88745 59429850
GSS61 63423 45029358
GSS62 66856 45836083
GSS63 89650 67275380
GSS64 84969 58060146
GSS65 86087 53078397
GSS66 86462 56262073
GSS67 95330 58328118
GSS68 100741 54364794
GSS69 100593 54553245
GSS7 77741 39121259
GSS70 101390 53543296
GSS71 102498 52137046
GSS72 102411 52247199
GSS73 102556 52064026
GSS74 102182 52537709
GSS75 99701 55695364
GSS76 90056 69051171
GSS77 89844 70766431
GSS78 88303 69759468
GSS79 87838 69659268
GSS8 75713 38106019
GSS80 88006 61741659
GSS81 83050 31522362
GSS82 77837 24396876
GSS83 84543 32807455
GSS84 82082 50259670
GSS85 80084 44996273
GSS86 88080 61099017
GSS87 80746 59758720
GSS88 77037 79042622
GSS89 77456 62533851
GSS9 72102 37149999
GSS90 89624 48484097
GSS91 79512 45034033
GSS92 79701 45121447
GSS93 73536 62635195
GSS94 83619 51999491
GSS95 80852 57019056
GSS96 85707 56717996
GSS97 83821 57921883
GSS98 87988 51729071
GSS99 82871 71932140
HTC1 25064 27057244
HTC10 67203 80956363
HTC11 67985 59527109
HTC12 24661 32558302
HTC2 15992 36040161
HTC3 15968 36540083
HTC4 16191 35387639
HTC5 15926 40287252
HTC6 16011 37280168
HTC7 51321 28424545
HTC8 55503 71483552
HTC9 81847 70118593
HTG1 1318 188986678
HTG10 1286 186588947
HTG11 1441 184188034
HTG12 879 191988472
HTG13 750 192274123
HTG14 743 192294826
HTG15 782 192309741
HTG16 802 192005952
HTG17 768 192322607
HTG18 2050 171265536
HTG19 1054 187970767
HTG2 2472 186091978
HTG20 996 189168468
HTG21 782 192060727
HTG22 924 190304687
HTG23 901 190586664
HTG24 808 191507090
HTG25 780 192166174
HTG26 857 191368821
HTG27 889 190738102
HTG28 948 190117267
HTG29 897 191062439
HTG3 2516 185270370
HTG30 928 190475719
HTG31 872 191303806
HTG32 968 189614530
HTG33 877 191166087
HTG34 857 191463999
HTG35 826 191818603
HTG36 933 190240070
HTG37 932 190852950
HTG38 943 190341497
HTG39 1035 189499509
HTG4 2548 188454164
HTG40 1189 187164037
HTG41 1227 188171325
HTG42 1207 188119317
HTG43 1170 187312805
HTG44 1097 191576875
HTG45 1217 191024666
HTG46 1240 190834403
HTG47 1136 191145047
HTG48 1052 191108201
HTG49 937 189647737
HTG5 1282 185626521
HTG50 1050 189710574
HTG51 911 189770667
HTG52 1041 189562388
HTG53 918 189526030
HTG54 1013 189595865
HTG55 920 189397605
HTG56 963 188825868
HTG57 1099 188932980
HTG58 975 189571053
HTG59 1098 185729060
HTG6 1274 185234665
HTG60 1096 188869107
HTG61 993 189259773
HTG62 1024 189003233
HTG63 970 189225063
HTG64 1121 188622284
HTG65 1097 188314252
HTG66 1288 184428644
HTG67 1249 185548775
HTG68 1234 184703189
HTG69 1255 184746888
HTG7 1271 185525698
HTG70 1208 186162121
HTG71 1431 187560233
HTG72 1261 188477121
HTG73 1111 191450264
HTG74 1134 191990864
HTG75 1229 191702133
HTG76 1127 191719155
HTG77 1185 191943653
HTG78 1167 190665429
HTG79 1209 190707850
HTG8 1425 184812159
HTG80 1243 190482067
HTG81 1227 189763692
HTG82 1092 189019804
HTG83 1230 189123831
HTG84 1434 188790235
HTG85 982 193518620
HTG86 744 169299578
HTG87 1114 193866373
HTG88 1097 192615575
HTG89 1169 192131541
HTG9 1200 186995800
HTG90 703 104712729
INV1 21032 155463998
INV2 1421 181651279
INV3 24948 126212196
INV4 79557 71496247
INV5 53487 90275419
INV6 80911 72722674
INV7 63715 85798667
INV8 83745 66502668
INV9 26677 93315034
MAM1 27973 147154123
MAM2 54456 99624296
MAM3 44962 38587309
PAT1 222623 70141546
PAT10 125396 99569402
PAT11 141760 62613496
PAT12 105827 59895234
PAT13 103573 50219401
PAT14 121422 53328684
PAT15 113096 61276623
PAT16 145013 54904631
PAT17 155478 69930723
PAT18 97474 122615235
PAT19 147625 87332832
PAT2 194507 84661262
PAT20 117313 104466646
PAT21 123736 103474698
PAT22 119301 106155650
PAT23 94382 85091179
PAT24 92322 88656589
PAT25 120348 61575783
PAT26 97623 78327581
PAT27 163085 84255002
PAT28 5168 1156893
PAT3 171987 95895459
PAT4 153749 106059248
PAT5 184019 85620296
PAT6 156376 93375370
PAT7 152397 81715411
PAT8 104665 119416000
PAT9 143590 89203025
PHG 3318 22512439
PLN1 45528 109132208
PLN10 19878 164061670
PLN11 19806 164172769
PLN12 17270 164273244
PLN13 1258 165525065
PLN14 1268 200732959
PLN15 5 168115057
PLN16 78 167185296
PLN17 65236 66783500
PLN18 78174 77138610
PLN19 73225 76971312
PLN2 1389 166510646
PLN20 17911 135646232
PLN21 70909 87973627
PLN22 98256 61078339
PLN23 58634 90969468
PLN24 2173 5984979
PLN3 1566 169248190
PLN4 29163 131616420
PLN5 76150 78560935
PLN6 75755 73683178
PLN7 33050 50892445
PLN8 24339 99913230
PLN9 21196 155794800
PRI1 29253 122380619
PRI10 1470 183084277
PRI11 1282 178966681
PRI12 1459 178349681
PRI13 1605 179787753
PRI14 1613 182193741
PRI15 1227 192255509
PRI16 1139 194187435
PRI17 22006 155347761
PRI18 53083 109675151
PRI19 49746 75147321
PRI2 1621 172507945
PRI20 10445 161927711
PRI21 2393 181897317
PRI22 1628 182632195
PRI23 2021 183383245
PRI24 1988 182499964
PRI25 11899 158471073
PRI26 1321 183510970
PRI27 44410 105677566
PRI28 42930 69737413
PRI29 22937 104422459
PRI3 1336 184781033
PRI30 19915 148384981
PRI31 81432 79816090
PRI32 44461 82959269
PRI4 1309 184541895
PRI5 1198 181773765
PRI6 1189 178867850
PRI7 1239 181415845
PRI8 1316 175115155
PRI9 1233 175393236
ROD1 10691 167167360
ROD10 976 182360312
ROD11 1030 186614626
ROD12 960 183496347
ROD13 1023 187430195
ROD14 954 181174779
ROD15 963 182163814
ROD16 1036 186170564
ROD17 25473 150506942
ROD18 11635 163459956
ROD19 1161 186266553
ROD2 926 174178893
ROD20 1187 185807307
ROD21 31074 127606436
ROD22 31706 66823426
ROD23 3353 182534468
ROD24 114297 66686054
ROD25 71840 43256029
ROD3 907 173827689
ROD4 904 174002855
ROD5 926 173942491
ROD6 985 181028879
ROD7 971 179827206
ROD8 987 181763336
ROD9 1010 182971991
STS1 82706 35286435
STS10 57925 44588992
STS11 57911 43613991
STS12 65683 42726657
STS13 86654 32961730
STS14 57824 25939090
STS2 85327 48519486
STS3 68607 26968639
STS4 78107 37468212
STS5 54817 32113573
STS6 54826 31994893
STS7 54670 32193887
STS8 55816 36373072
STS9 57856 44560692
SYN 49262 64876627
UNA 211 114018
VRL1 72061 66147687
VRL2 71896 62453797
VRL3 70993 67059962
VRL4 67019 69135821
VRL5 63414 71182155
VRL6 64523 75342484
VRL7 26296 25634443
VRT1 17477 166100166
VRT10 11049 177997898
VRT11 7410 180546708
VRT12 69175 89321092
VRT13 18974 17957743
VRT2 65392 95062669
VRT3 8281 176347766
VRT4 78589 70874616
VRT5 44494 64092474
VRT6 9674 164857344
VRT7 1281 191756845
VRT8 1288 191629252
VRT9 11280 176789912
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 158.0 (chloroplast and mitochon-
drial sequences not included, and Whole Genome Shotgun sequences not included) :
Entries Bases Species
10703938 12504459412 Homo sapiens
6784988 8115290614 Mus musculus
1268746 5748343551 Rattus norvegicus
1851261 3687679563 Bos taurus
1541817 2735876665 Danio rerio
2821147 2705770382 Zea mays
1156694 1509097774 Oryza sativa (japonica cultivar-group)
1278077 1259752967 Sus scrofa
226848 1252648032 Strongylocentrotus purpuratus
1242643 1005148047 Xenopus tropicalis
1427408 907622191 Canis familiaris
210615 895897302 Pan troglodytes
1939494 873721852 Arabidopsis thaliana
675944 863775009 Drosophila melanogaster
801476 832657627 Gallus gallus
497203 810163852 Vitis vinifera
74131 589029977 Macaca mulatta
887954 519141294 Triticum aestivum
801836 481941043 Sorghum bicolor
397755 480298800 Medicago truncatula
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 February 2007
NCBI-GenBank Flat File Release 158.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. All index keys
appear in uppercase characters even though they appear in mixed case
in the sequence entries. Following each index key, the identifiers of the
sequence entries containing that key are listed (LOCUS name,
division abbreviation, and primary accession number). The division
abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 158.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Lori Black, Larissa Brown, Larry Chlumsky, Karen Clark,
Irene Fang, Linda Frisse, Michael Fetchko, Andrea Gocke, Amelie Gubitz
Anjanette Johnston, Kellie Kelm, Richard McVeigh, Leonie Misquitta, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley, Gert Roosen,
Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, WonHee Jang,
Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen, Karl Sirotkin,
Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova,
Aleksey Vysokolov, Lukas Wagner, Jane Weisemann, Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Tony Stearman
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
