Release Notes For GenBank Release 160
GBREL.TXT Genetic Sequence Data Bank
June 15 2007
NCBI-GenBank Flat File Release 160.0
Distribution Release Notes
73078143 loci, 77248690945 bases, from 73078143 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 160.0
1.2 Cutoff Date
1.3 Important Changes in Release 160.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 160.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 160.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 160.0, incorporates data available to the collaborating
databases as of June 14, 2007 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 160.0
1.3.1 Organizational changes
The total number of sequence data files increased by 20 with this release:
- the BCT division is now comprised of 22 files (+1)
- the CON division is now comprised of 8 files (+1)
- the EST division is now comprised of 609 files (+5)
- the GSS division is now comprised of 261 files (+9)
- the HTG division is now comprised of 96 files (+3)
- the PAT division is now comprised of 29 files (+1)
1.3.2 Several CON-division files significantly exceed 2GB
Data generated by the AACY02 metagenomic WGS project:
PubMed ID 17355176
http://www.pubmedcentral.nih.gov/articlerender.fcgi?tool=pubmed&pubmedid=17355176
resulted in the addition of over 3 million CON-division records to GenBank.
Current procedures are not optimized for handling such a large influx, and
as a result, several of the CON-division sequence files exceed 2GB when
uncompressed. For example:
gbcon6.seq : 7,261,904,050 bytes
gbcon7.seq : 3,092,551,793 bytes
gbcon8.seq : 5,859,018,078 bytes
During the next several months, we will work to enhance the processing of
the CON-division of GenBank, such that the records are provided via a
larger number of much smaller files.
1.3.3 Multiple identifiers for the PROJECT line
The recently-introduced PROJECT linetype (see Section 3.4.7.2) provides a
way to link GenBank sequences that are part of a sequencing project to the
Entrez Genome Project database, where further details about the project can
be obtained.
As of June 2007, multiple identifiers are now valid for the PROJECT line.
Here is a mocked-up example of the expected usage:
LOCUS AANA01000001 2 rc DNA linear BCT 09-FEB-2007
DEFINITION Polaribacter dokdonensis MED152 whole genome shotgun sequencing
project.
ACCESSION AANA01000001
VERSION AANA01000001.1 GI:85822094
PROJECT GenomeProject:13543 GenomeProject:99999
There are several situations in which a record could be considered part
of two different Genome Projects. For example, consider an
environmental-sampling metagenomic WGS project for which the individual
sequence-overlap contigs are not attributed to a specific organism. An
associated Genome Project could exist which provides further details about
the sequencing effort, the centers involved, etc.
If, in subsequent assembly and annotation phases, scaffold/super-contig/
chromosomal records are created which **are** attributed to a specific
organism, then those CON-division records could have two Genome Project IDs:
one for the WGS sequencing project as a whole; and a second for an
organism-specific Genome Project.
Additional examples illustrating the use of multiple Genome Project IDs
will be provided in future release notes, and via the GenBank listserv.
1.3.4 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.5 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
forty-three of the GSS flatfiles in Release 160.0. Consider gbgss219.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
June 15 2007
NCBI-GenBank Flat File Release 160.0
GSS Sequences (Part 1)
86834 loci, 64340568 bases, from 86834 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "219" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 Structured /specimen_voucher qualifiers
As of October 2007, the content of the /specimen_voucher qualifier will
be able to support a structured value consisting of an institution code,
a collection code, and a specimen identifier, as well as the existing
unstructured values. Here is the preliminary new definition of the qualifier:
Qualifier:
specimen_voucher
Definition:
Identifier for the specimen from which the nucleic acid sequenced was obtained.
Value format:
/specimen_voucher="[<institution-code>:[<collection-code>:]]<specimen_id>"
Example:
/specimen_voucher="UAM:Mamm:52179"
/specimen_voucher="AMCC:101706"
/specimen_voucher="USNM:field series 8798"
/specimen_voucher="personal collection:Dan Janzen:99-SRNP-2003"
/specimen_voucher="99-SRNP-2003"
Comment:
The specimen_voucher qualifier is intended to annotate a reference to the
physical specimen that remains after the sequence has been obtained. If the
specimen was destroyed in the process of sequencing, electronic images
(e-vouchers) are an adequate substitute for a physical voucher specimen.
Ideally the specimens will be deposited in a curated museum, herbarium, or
frozen tissue collection, but often they will remain in a personal or
laboratory collection for some time before they are deposited in a curated
collection.
There are three forms of specimen_voucher qualifiers. If the text of the
qualifier includes one or more colons it is a 'structured voucher'. Structured
vouchers include institution-codes (and optional collection-codes) taken from
a controlled vocabulary that denote the museum or herbarium collection where
the specimen resides.
<specimen_id>
<institution_code>:<specimen_id>
<institution_code>:<collection_code>:<specimen_id>
1.4.2 New /culture_collection and /bio_material qualifiers
As of the December 2007 GenBank release, new qualifiers /culture_collection
and /bio_material qualifiers will be legal for the source feature. These
qualifiers will utilize the same format as /speciment_voucher (see Section
1.4.1 of these release notes). Their preliminary definitions are:
Qualifier:
culture_collection
Definition:
Institution code and identifier for the culture from which the nucleic acid
sequenced was obtained, with optional collection code.
Value format:
/culture_collection="<institution-code>:[<collection-code>:]<culture_id>"
Example:
/culture_collection="ATCC:26370"
Comment:
01234567890123456789012345678901234567890123456789012345678901234567890123456789
The culture_collection qualifier should be used to annotate live microbial and
viral cultures, and cell lines that have been deposited in curated culture
collections. Microbial cultures in personal or laboratory collections should
be annotated in strain qualifiers.
Annotation with a culture_collection qualifier implies that the sequence was
obtained from a sample retrieved (by the submitter or a collaborator) from the
indicated culture collection, or that the sequence was obtained from a sample
that was deposited (by the submitter or a collaborator) in the indicated culture
collection. Annotation with more than one culture_collection qualifier
indicates that the sequence was obtained from a sample that was deposited
(by the submitter or a collaborator) in more than one culture collection.
Culture_id and institution_code are mandatory, collection_code is optional.
Institution code is mandatory where collection code is present.
Qualifier:
bio_material
Definition:
Identifier for the biological material from which the nucleic acid sequenced
was obtained, with optional institution code and collection code for the place
where it is currently stored.
Value format:
/bio_material="[<institution-code>:[<collection-code>:]]<material_id>"
Example:
/bio_material="CGC:CB3912" <- Caenorhabditis stock center
Comment:
The bio_material qualifier should be used to annotate the identifiers of material
in biological collections that are not appropriate to annotate as either
/specimen_voucher or /culture_collection. These include zoos and aquaria,
stock centers, seed banks, germplasm repositories and DNA banks.
Material_id is mandatory, institution_code and collection_code are optional.
Institution code is mandatory where collection code is present.
1.4.3 /operon qualifiers for protein_bind features
Due to an oversight, the /operon qualifier is not currently listed
as a legal qualifier for the protein_bind feature. This will be
corrected as of October 2007, with an update to the Feature Table
document which includes the qualifier among those that are legal
for protein_bind.
1.4.4 Alignment as EVIDENCE_BASIS for the /inference qualifier
Several algorithms exist which allow mRNAs to be aligned to genomic
sequence, taking into account introns and splice signals. In order to
document the use of such algorithms for the structured /inference
qualifier, a new class of EVIDENCE_BASIS will be introduced:
alignment
This addition to the controlled vocabulary of the /inference qualifier
will be legal as of October 2007.
1.4.5 New ncRNA feature
A variety of new types of RNA features have been introduced in
recent years. snRNA, snoRNA, and scRNA are some examples.
Because the number of non-coding RNA families is quite likely to
continue to expand, a new ncRNA feature that can flexibly
accomodate them will be introduced as of October 2007.
This new feature will utilize a new qualifier called
/ncRNA_class, with a controlled vocabulary to indicate what type
of non-coding feature is being represented.
A complete description of the ncRNA feature and the new
qualifier are not yet available. When details are finalized,
hopefully by June 30, additional details will be distributed
via the GenBank listserv, and in future versions of these
release notes.
1.4.6 New tmRNA feature and /peptide_tag qualifier
To support the annotation of a class of RNAs that have dual
tRNA-like and mRNA-like behaviors, a new tmRNA feature will be
legal for the Feature Table as of December 2007. The "tmRNA Website"
at Indiana University provides some background information about
the unusual biology of tmRNAs :
http://www.indiana.edu/~tmrna/
Here is a preliminary definition of the new tmRNA feature:
Feature Key tmRNA
Definition transfer messenger RNA; tmRNA acts like a tRNA first,
and then an mRNA that encodes a peptide tag.
The ribosome translates this mRNA region of tmRNA and
attaches the encoded peptide tag to the C-terminus of the
unfinished protein. This attached tag targets the protein
for destruction or proteolysis
Optional qualifiers /allele="text"
/citation=[number]
/db_xref="<database>:<identifier>"
/experiment="text"
/function="text"
/gene="text"
/inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
/label=feature_label
/locus_tag="text" (single token)
/map="text"
/note="text"
/old_locus_tag="text" (single token)
/product="text"
/pseudo
/standard_name="text"
To indicate the nucleotide region encoding the proteolysis tag
peptide, a new /peptide_tag qualifier will be introduced for
the tmRNA feature.
Complete details about this new feature and qualifier will be
distributed via the GenBank listserv, and in future versions of
these release notes.
1.4.7 /organism no longer to be used for misc_recomb
The /organism qualifier is currently legal for misc_recomb
features. A review of the existing cases in the database has
indicated that all could be better annotated through the use
of multiple source features.
That work will be completed by October 2007, at which
point /organism will no longer be allowed for the misc_recomb
feature key.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1213 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut3.idx - Index of the entries according to author name, part 3.
19. gbaut4.idx - Index of the entries according to author name, part 4.
20. gbaut5.idx - Index of the entries according to author name, part 5.
21. gbaut6.idx - Index of the entries according to author name, part 6.
22. gbaut7.idx - Index of the entries according to author name, part 7.
23. gbaut8.idx - Index of the entries according to author name, part 8.
24. gbaut9.idx - Index of the entries according to author name, part 9.
25. gbbct1.seq - Bacterial sequence entries, part 1.
26. gbbct10.seq - Bacterial sequence entries, part 10.
27. gbbct11.seq - Bacterial sequence entries, part 11.
28. gbbct12.seq - Bacterial sequence entries, part 12.
29. gbbct13.seq - Bacterial sequence entries, part 13.
30. gbbct14.seq - Bacterial sequence entries, part 14.
31. gbbct15.seq - Bacterial sequence entries, part 15.
32. gbbct16.seq - Bacterial sequence entries, part 16.
33. gbbct17.seq - Bacterial sequence entries, part 17.
34. gbbct18.seq - Bacterial sequence entries, part 18.
35. gbbct19.seq - Bacterial sequence entries, part 19.
36. gbbct2.seq - Bacterial sequence entries, part 2.
37. gbbct20.seq - Bacterial sequence entries, part 20.
38. gbbct21.seq - Bacterial sequence entries, part 21.
39. gbbct22.seq - Bacterial sequence entries, part 22.
40. gbbct3.seq - Bacterial sequence entries, part 3.
41. gbbct4.seq - Bacterial sequence entries, part 4.
42. gbbct5.seq - Bacterial sequence entries, part 5.
43. gbbct6.seq - Bacterial sequence entries, part 6.
44. gbbct7.seq - Bacterial sequence entries, part 7.
45. gbbct8.seq - Bacterial sequence entries, part 8.
46. gbbct9.seq - Bacterial sequence entries, part 9.
47. gbchg.txt - Accession numbers of entries updated since the previous release.
48. gbcon1.seq - Constructed sequence entries, part 1.
49. gbcon2.seq - Constructed sequence entries, part 2.
50. gbcon3.seq - Constructed sequence entries, part 3.
51. gbcon4.seq - Constructed sequence entries, part 4.
52. gbcon5.seq - Constructed sequence entries, part 5.
53. gbcon6.seq - Constructed sequence entries, part 6.
54. gbcon7.seq - Constructed sequence entries, part 7.
55. gbcon8.seq - Constructed sequence entries, part 8.
56. gbdel.txt - Accession numbers of entries deleted since the previous release.
57. gbenv1.seq - Environmental sampling sequence entries, part 1.
58. gbenv2.seq - Environmental sampling sequence entries, part 2.
59. gbenv3.seq - Environmental sampling sequence entries, part 3.
60. gbenv4.seq - Environmental sampling sequence entries, part 4.
61. gbenv5.seq - Environmental sampling sequence entries, part 5.
62. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
63. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
64. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
65. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
66. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
67. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
68. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
69. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
70. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
71. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
72. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
73. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
74. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
75. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
76. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
77. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
78. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
79. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
80. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
81. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
82. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
83. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
84. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
85. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
86. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
87. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
88. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
89. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
90. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
91. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
92. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
93. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
94. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
95. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
96. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
97. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
98. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
99. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
100. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
101. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
102. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
103. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
104. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
105. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
106. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
107. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
108. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
109. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
110. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
111. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
112. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
113. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
114. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
115. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
116. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
117. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
118. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
119. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
120. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
121. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
122. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
123. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
124. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
125. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
126. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
127. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
128. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
129. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
130. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
131. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
132. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
133. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
134. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
135. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
136. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
137. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
138. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
139. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
140. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
141. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
142. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
143. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
144. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
145. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
146. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
147. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
148. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
149. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
150. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
151. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
152. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
153. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
154. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
155. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
156. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
157. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
158. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
159. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
160. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
161. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
162. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
163. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
164. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
165. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
166. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
167. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
168. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
169. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
170. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
171. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
172. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
173. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
174. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
175. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
176. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
177. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
178. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
179. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
180. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
181. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
182. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
183. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
184. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
185. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
186. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
187. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
188. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
189. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
190. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
191. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
192. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
193. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
194. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
195. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
196. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
197. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
198. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
199. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
200. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
201. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
202. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
203. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
204. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
205. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
206. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
207. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
208. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
209. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
210. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
211. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
212. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
213. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
214. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
215. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
216. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
217. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
218. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
219. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
220. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
221. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
222. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
223. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
224. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
225. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
226. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
227. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
228. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
229. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
230. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
231. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
232. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
233. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
234. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
235. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
236. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
237. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
238. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
239. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
240. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
241. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
242. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
243. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
244. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
245. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
246. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
247. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
248. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
249. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
250. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
251. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
252. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
253. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
254. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
255. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
256. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
257. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
258. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
259. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
260. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
261. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
262. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
263. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
264. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
265. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
266. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
267. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
268. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
269. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
270. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
271. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
272. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
273. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
274. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
275. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
276. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
277. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
278. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
279. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
280. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
281. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
282. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
283. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
284. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
285. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
286. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
287. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
288. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
289. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
290. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
291. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
292. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
293. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
294. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
295. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
296. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
297. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
298. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
299. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
300. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
301. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
302. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
303. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
304. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
305. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
306. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
307. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
308. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
309. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
310. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
311. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
312. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
313. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
314. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
315. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
316. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
317. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
318. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
319. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
320. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
321. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
322. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
323. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
324. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
325. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
326. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
327. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
328. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
329. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
330. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
331. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
332. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
333. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
334. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
335. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
336. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
337. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
338. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
339. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
340. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
341. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
342. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
343. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
344. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
345. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
346. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
347. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
348. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
349. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
350. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
351. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
352. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
353. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
354. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
355. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
356. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
357. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
358. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
359. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
360. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
361. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
362. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
363. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
364. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
365. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
366. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
367. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
368. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
369. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
370. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
371. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
372. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
373. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
374. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
375. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
376. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
377. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
378. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
379. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
380. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
381. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
382. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
383. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
384. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
385. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
386. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
387. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
388. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
389. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
390. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
391. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
392. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
393. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
394. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
395. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
396. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
397. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
398. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
399. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
400. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
401. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
402. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
403. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
404. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
405. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
406. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
407. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
408. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
409. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
410. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
411. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
412. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
413. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
414. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
415. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
416. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
417. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
418. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
419. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
420. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
421. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
422. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
423. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
424. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
425. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
426. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
427. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
428. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
429. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
430. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
431. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
432. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
433. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
434. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
435. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
436. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
437. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
438. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
439. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
440. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
441. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
442. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
443. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
444. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
445. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
446. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
447. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
448. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
449. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
450. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
451. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
452. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
453. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
454. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
455. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
456. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
457. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
458. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
459. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
460. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
461. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
462. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
463. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
464. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
465. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
466. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
467. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
468. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
469. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
470. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
471. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
472. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
473. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
474. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
475. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
476. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
477. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
478. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
479. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
480. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
481. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
482. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
483. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
484. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
485. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
486. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
487. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
488. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
489. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
490. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
491. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
492. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
493. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
494. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
495. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
496. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
497. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
498. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
499. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
500. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
501. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
502. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
503. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
504. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
505. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
506. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
507. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
508. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
509. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
510. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
511. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
512. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
513. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
514. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
515. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
516. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
517. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
518. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
519. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
520. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
521. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
522. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
523. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
524. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
525. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
526. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
527. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
528. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
529. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
530. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
531. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
532. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
533. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
534. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
535. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
536. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
537. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
538. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
539. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
540. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
541. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
542. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
543. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
544. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
545. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
546. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
547. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
548. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
549. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
550. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
551. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
552. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
553. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
554. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
555. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
556. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
557. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
558. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
559. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
560. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
561. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
562. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
563. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
564. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
565. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
566. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
567. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
568. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
569. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
570. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
571. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
572. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
573. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
574. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
575. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
576. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
577. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
578. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
579. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
580. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
581. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
582. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
583. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
584. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
585. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
586. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
587. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
588. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
589. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
590. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
591. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
592. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
593. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
594. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
595. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
596. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
597. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
598. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
599. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
600. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
601. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
602. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
603. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
604. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
605. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
606. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
607. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
608. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
609. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
610. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
611. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
612. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
613. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
614. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
615. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
616. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
617. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
618. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
619. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
620. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
621. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
622. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
623. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
624. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
625. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
626. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
627. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
628. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
629. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
630. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
631. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
632. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
633. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
634. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
635. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
636. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
637. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
638. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
639. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
640. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
641. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
642. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
643. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
644. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
645. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
646. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
647. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
648. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
649. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
650. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
651. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
652. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
653. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
654. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
655. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
656. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
657. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
658. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
659. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
660. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
661. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
662. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
663. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
664. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
665. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
666. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
667. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
668. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
669. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
670. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
671. gbgen.idx - Index of the entries according to gene symbols.
672. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
673. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
674. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
675. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
676. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
677. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
678. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
679. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
680. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
681. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
682. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
683. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
684. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
685. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
686. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
687. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
688. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
689. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
690. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
691. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
692. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
693. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
694. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
695. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
696. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
697. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
698. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
699. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
700. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
701. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
702. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
703. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
704. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
705. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
706. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
707. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
708. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
709. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
710. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
711. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
712. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
713. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
714. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
715. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
716. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
717. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
718. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
719. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
720. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
721. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
722. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
723. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
724. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
725. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
726. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
727. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
728. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
729. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
730. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
731. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
732. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
733. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
734. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
735. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
736. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
737. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
738. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
739. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
740. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
741. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
742. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
743. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
744. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
745. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
746. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
747. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
748. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
749. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
750. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
751. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
752. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
753. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
754. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
755. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
756. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
757. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
758. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
759. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
760. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
761. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
762. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
763. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
764. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
765. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
766. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
767. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
768. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
769. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
770. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
771. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
772. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
773. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
774. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
775. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
776. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
777. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
778. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
779. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
780. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
781. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
782. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
783. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
784. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
785. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
786. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
787. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
788. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
789. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
790. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
791. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
792. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
793. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
794. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
795. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
796. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
797. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
798. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
799. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
800. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
801. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
802. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
803. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
804. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
805. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
806. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
807. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
808. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
809. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
810. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
811. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
812. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
813. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
814. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
815. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
816. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
817. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
818. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
819. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
820. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
821. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
822. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
823. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
824. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
825. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
826. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
827. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
828. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
829. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
830. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
831. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
832. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
833. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
834. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
835. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
836. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
837. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
838. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
839. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
840. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
841. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
842. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
843. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
844. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
845. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
846. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
847. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
848. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
849. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
850. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
851. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
852. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
853. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
854. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
855. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
856. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
857. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
858. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
859. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
860. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
861. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
862. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
863. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
864. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
865. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
866. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
867. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
868. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
869. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
870. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
871. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
872. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
873. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
874. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
875. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
876. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
877. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
878. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
879. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
880. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
881. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
882. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
883. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
884. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
885. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
886. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
887. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
888. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
889. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
890. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
891. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
892. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
893. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
894. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
895. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
896. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
897. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
898. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
899. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
900. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
901. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
902. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
903. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
904. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
905. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
906. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
907. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
908. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
909. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
910. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
911. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
912. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
913. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
914. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
915. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
916. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
917. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
918. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
919. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
920. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
921. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
922. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
923. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
924. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
925. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
926. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
927. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
928. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
929. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
930. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
931. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
932. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
933. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
934. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
935. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
936. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
937. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
938. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
939. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
940. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
941. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
942. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
943. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
944. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
945. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
946. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
947. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
948. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
949. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
950. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
951. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
952. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
953. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
954. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
955. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
956. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
957. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
958. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
959. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
960. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
961. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
962. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
963. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
964. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
965. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
966. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
967. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
968. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
969. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
970. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
971. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
972. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
973. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
974. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
975. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
976. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
977. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
978. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
979. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
980. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
981. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
982. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
983. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
984. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
985. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
986. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
987. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
988. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
989. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
990. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
991. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
992. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
993. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
994. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
995. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
996. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
997. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
998. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
999. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1000. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1001. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1002. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1003. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1004. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1005. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1006. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1007. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1008. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1009. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1010. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1011. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1012. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1013. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1014. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1015. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1016. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1017. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1018. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1019. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1020. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1021. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1022. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1023. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1024. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1025. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1026. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1027. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1028. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1029. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1030. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1031. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1032. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1033. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1034. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1035. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1036. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1037. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1038. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1039. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1040. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1041. gbinv1.seq - Invertebrate sequence entries, part 1.
1042. gbinv10.seq - Invertebrate sequence entries, part 10.
1043. gbinv2.seq - Invertebrate sequence entries, part 2.
1044. gbinv3.seq - Invertebrate sequence entries, part 3.
1045. gbinv4.seq - Invertebrate sequence entries, part 4.
1046. gbinv5.seq - Invertebrate sequence entries, part 5.
1047. gbinv6.seq - Invertebrate sequence entries, part 6.
1048. gbinv7.seq - Invertebrate sequence entries, part 7.
1049. gbinv8.seq - Invertebrate sequence entries, part 8.
1050. gbinv9.seq - Invertebrate sequence entries, part 9.
1051. gbjou1.idx - Index of the entries according to journal citation, part 1.
1052. gbjou2.idx - Index of the entries according to journal citation, part 2.
1053. gbjou3.idx - Index of the entries according to journal citation, part 3.
1054. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1055. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1056. gbmam1.seq - Other mammalian sequence entries, part 1.
1057. gbmam2.seq - Other mammalian sequence entries, part 2.
1058. gbmam3.seq - Other mammalian sequence entries, part 3.
1059. gbnew.txt - Accession numbers of entries new since the previous release.
1060. gbpat1.seq - Patent sequence entries, part 1.
1061. gbpat10.seq - Patent sequence entries, part 10.
1062. gbpat11.seq - Patent sequence entries, part 11.
1063. gbpat12.seq - Patent sequence entries, part 12.
1064. gbpat13.seq - Patent sequence entries, part 13.
1065. gbpat14.seq - Patent sequence entries, part 14.
1066. gbpat15.seq - Patent sequence entries, part 15.
1067. gbpat16.seq - Patent sequence entries, part 16.
1068. gbpat17.seq - Patent sequence entries, part 17.
1069. gbpat18.seq - Patent sequence entries, part 18.
1070. gbpat19.seq - Patent sequence entries, part 19.
1071. gbpat2.seq - Patent sequence entries, part 2.
1072. gbpat20.seq - Patent sequence entries, part 20.
1073. gbpat21.seq - Patent sequence entries, part 21.
1074. gbpat22.seq - Patent sequence entries, part 22.
1075. gbpat23.seq - Patent sequence entries, part 23.
1076. gbpat24.seq - Patent sequence entries, part 24.
1077. gbpat25.seq - Patent sequence entries, part 25.
1078. gbpat26.seq - Patent sequence entries, part 26.
1079. gbpat27.seq - Patent sequence entries, part 27.
1080. gbpat28.seq - Patent sequence entries, part 28.
1081. gbpat29.seq - Patent sequence entries, part 29.
1082. gbpat3.seq - Patent sequence entries, part 3.
1083. gbpat4.seq - Patent sequence entries, part 4.
1084. gbpat5.seq - Patent sequence entries, part 5.
1085. gbpat6.seq - Patent sequence entries, part 6.
1086. gbpat7.seq - Patent sequence entries, part 7.
1087. gbpat8.seq - Patent sequence entries, part 8.
1088. gbpat9.seq - Patent sequence entries, part 9.
1089. gbphg.seq - Phage sequence entries.
1090. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1091. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1092. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1093. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1094. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1095. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1096. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1097. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1098. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1099. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1100. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1101. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1102. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1103. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1104. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1105. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1106. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1107. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1108. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1109. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1110. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1111. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1112. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1113. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1114. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1115. gbpri1.seq - Primate sequence entries, part 1.
1116. gbpri10.seq - Primate sequence entries, part 10.
1117. gbpri11.seq - Primate sequence entries, part 11.
1118. gbpri12.seq - Primate sequence entries, part 12.
1119. gbpri13.seq - Primate sequence entries, part 13.
1120. gbpri14.seq - Primate sequence entries, part 14.
1121. gbpri15.seq - Primate sequence entries, part 15.
1122. gbpri16.seq - Primate sequence entries, part 16.
1123. gbpri17.seq - Primate sequence entries, part 17.
1124. gbpri18.seq - Primate sequence entries, part 18.
1125. gbpri19.seq - Primate sequence entries, part 19.
1126. gbpri2.seq - Primate sequence entries, part 2.
1127. gbpri20.seq - Primate sequence entries, part 20.
1128. gbpri21.seq - Primate sequence entries, part 21.
1129. gbpri22.seq - Primate sequence entries, part 22.
1130. gbpri23.seq - Primate sequence entries, part 23.
1131. gbpri24.seq - Primate sequence entries, part 24.
1132. gbpri25.seq - Primate sequence entries, part 25.
1133. gbpri26.seq - Primate sequence entries, part 26.
1134. gbpri27.seq - Primate sequence entries, part 27.
1135. gbpri28.seq - Primate sequence entries, part 28.
1136. gbpri29.seq - Primate sequence entries, part 29.
1137. gbpri3.seq - Primate sequence entries, part 3.
1138. gbpri30.seq - Primate sequence entries, part 30.
1139. gbpri31.seq - Primate sequence entries, part 31.
1140. gbpri32.seq - Primate sequence entries, part 32.
1141. gbpri33.seq - Primate sequence entries, part 33.
1142. gbpri4.seq - Primate sequence entries, part 4.
1143. gbpri5.seq - Primate sequence entries, part 5.
1144. gbpri6.seq - Primate sequence entries, part 6.
1145. gbpri7.seq - Primate sequence entries, part 7.
1146. gbpri8.seq - Primate sequence entries, part 8.
1147. gbpri9.seq - Primate sequence entries, part 9.
1148. gbrel.txt - Release notes (this document).
1149. gbrod1.seq - Rodent sequence entries, part 1.
1150. gbrod10.seq - Rodent sequence entries, part 10.
1151. gbrod11.seq - Rodent sequence entries, part 11.
1152. gbrod12.seq - Rodent sequence entries, part 12.
1153. gbrod13.seq - Rodent sequence entries, part 13.
1154. gbrod14.seq - Rodent sequence entries, part 14.
1155. gbrod15.seq - Rodent sequence entries, part 15.
1156. gbrod16.seq - Rodent sequence entries, part 16.
1157. gbrod17.seq - Rodent sequence entries, part 17.
1158. gbrod18.seq - Rodent sequence entries, part 18.
1159. gbrod19.seq - Rodent sequence entries, part 19.
1160. gbrod2.seq - Rodent sequence entries, part 2.
1161. gbrod20.seq - Rodent sequence entries, part 20.
1162. gbrod21.seq - Rodent sequence entries, part 21.
1163. gbrod22.seq - Rodent sequence entries, part 22.
1164. gbrod23.seq - Rodent sequence entries, part 23.
1165. gbrod24.seq - Rodent sequence entries, part 24.
1166. gbrod25.seq - Rodent sequence entries, part 25.
1167. gbrod3.seq - Rodent sequence entries, part 3.
1168. gbrod4.seq - Rodent sequence entries, part 4.
1169. gbrod5.seq - Rodent sequence entries, part 5.
1170. gbrod6.seq - Rodent sequence entries, part 6.
1171. gbrod7.seq - Rodent sequence entries, part 7.
1172. gbrod8.seq - Rodent sequence entries, part 8.
1173. gbrod9.seq - Rodent sequence entries, part 9.
1174. gbsdr1.txt - Short directory of the data bank, part 1.
1175. gbsdr2.txt - Short directory of the data bank, part 2.
1176. gbsdr3.txt - Short directory of the data bank, part 3.
1177. gbsec.idx - Index of the entries according to secondary accession number.
1178. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1179. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1180. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1181. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1182. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1183. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1184. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1185. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1186. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1187. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1188. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1189. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1190. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1191. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1192. gbsyn.seq - Synthetic and chimeric sequence entries.
1193. gbuna.seq - Unannotated sequence entries.
1194. gbvrl1.seq - Viral sequence entries, part 1.
1195. gbvrl2.seq - Viral sequence entries, part 2.
1196. gbvrl3.seq - Viral sequence entries, part 3.
1197. gbvrl4.seq - Viral sequence entries, part 4.
1198. gbvrl5.seq - Viral sequence entries, part 5.
1199. gbvrl6.seq - Viral sequence entries, part 6.
1200. gbvrl7.seq - Viral sequence entries, part 7.
1201. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1202. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1203. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1204. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1205. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1206. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1207. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1208. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1209. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1210. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1211. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1212. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1213. gbvrt9.seq - Other vertebrate sequence entries, part 9.
The gbcon.seq data file provides an alternative representation for complex
sequences, such as segmented sets and complete-genomes that have been split
into pieces. These "CON" records do not contain sequence data; they utilize
a CONTIG linetype with a join() statement which describes how the component
sequences can be assembled to form the larger sequence. The contents of the
CON division are not reflected in the 'index', 'new', 'chg', and 'del' files
that accompany GenBank releases, nor in release statistics (Sections 2.2.6,
2.2.7, and 2.2.8). The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 160.0 flatfiles require roughly 280 GB (sequence
files only) or 293 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
430959167 gbacc1.idx
1427415108 gbacc2.idx
545339460 gbacc3.idx
189144845 gbaut1.idx
184221599 gbaut10.idx
183345870 gbaut11.idx
189391351 gbaut12.idx
185785400 gbaut13.idx
183414631 gbaut14.idx
185457825 gbaut15.idx
183994768 gbaut16.idx
183317618 gbaut17.idx
184865860 gbaut18.idx
183539465 gbaut19.idx
185633026 gbaut2.idx
183705768 gbaut20.idx
86474324 gbaut21.idx
183458396 gbaut3.idx
183500836 gbaut4.idx
183853079 gbaut5.idx
185579607 gbaut6.idx
186484306 gbaut7.idx
183537419 gbaut8.idx
183700752 gbaut9.idx
255906566 gbbct1.seq
258048351 gbbct10.seq
251238395 gbbct11.seq
250528447 gbbct12.seq
250181651 gbbct13.seq
260156168 gbbct14.seq
251577075 gbbct15.seq
251316887 gbbct16.seq
253728545 gbbct17.seq
259885258 gbbct18.seq
253253687 gbbct19.seq
251668114 gbbct2.seq
250000546 gbbct20.seq
250002948 gbbct21.seq
161898486 gbbct22.seq
251991272 gbbct3.seq
250004664 gbbct4.seq
255760258 gbbct5.seq
256957519 gbbct6.seq
255272428 gbbct7.seq
250000890 gbbct8.seq
263987359 gbbct9.seq
6293996 gbchg.txt
311597264 gbcon1.seq
221657823 gbcon2.seq
1325459171 gbcon3.seq
1589218719 gbcon4.seq
20056249 gbcon5.seq
2966936754 gbcon6.seq
3092551793 gbcon7.seq
1564050782 gbcon8.seq
147642 gbdel.txt
250001721 gbenv1.seq
250003012 gbenv2.seq
250001632 gbenv3.seq
250001927 gbenv4.seq
170761339 gbenv5.seq
230690048 gbest1.seq
230690195 gbest10.seq
230688016 gbest100.seq
230690339 gbest101.seq
230689667 gbest102.seq
230689241 gbest103.seq
230687582 gbest104.seq
230689957 gbest105.seq
230687721 gbest106.seq
230689511 gbest107.seq
230687670 gbest108.seq
230689039 gbest109.seq
230687653 gbest11.seq
230688924 gbest110.seq
230687577 gbest111.seq
230688760 gbest112.seq
230688283 gbest113.seq
230690319 gbest114.seq
230689824 gbest115.seq
230689109 gbest116.seq
230614424 gbest117.seq
230689760 gbest118.seq
230689329 gbest119.seq
230690386 gbest12.seq
230688039 gbest120.seq
230688512 gbest121.seq
230687660 gbest122.seq
230687686 gbest123.seq
230689561 gbest124.seq
230690556 gbest125.seq
230689571 gbest126.seq
230688322 gbest127.seq
230691098 gbest128.seq
230689180 gbest129.seq
230688027 gbest13.seq
230690687 gbest130.seq
230690255 gbest131.seq
230689919 gbest132.seq
230689372 gbest133.seq
230690266 gbest134.seq
230689450 gbest135.seq
230690887 gbest136.seq
230690996 gbest137.seq
230690224 gbest138.seq
230690348 gbest139.seq
230689696 gbest14.seq
230689942 gbest140.seq
230689626 gbest141.seq
230689607 gbest142.seq
230688006 gbest143.seq
230690378 gbest144.seq
230688630 gbest145.seq
230687949 gbest146.seq
230688944 gbest147.seq
230687889 gbest148.seq
230688482 gbest149.seq
230688265 gbest15.seq
230689380 gbest150.seq
230687568 gbest151.seq
230691217 gbest152.seq
230688234 gbest153.seq
230688659 gbest154.seq
230689987 gbest155.seq
230690654 gbest156.seq
230687871 gbest157.seq
230688551 gbest158.seq
230688460 gbest159.seq
230689787 gbest16.seq
230688189 gbest160.seq
230688727 gbest161.seq
230688697 gbest162.seq
230691021 gbest163.seq
230689709 gbest164.seq
230688849 gbest165.seq
230689216 gbest166.seq
230688146 gbest167.seq
230688870 gbest168.seq
230689722 gbest169.seq
230687935 gbest17.seq
230689546 gbest170.seq
230689685 gbest171.seq
230689064 gbest172.seq
230688139 gbest173.seq
230687691 gbest174.seq
230689463 gbest175.seq
230687572 gbest176.seq
230688675 gbest177.seq
230687975 gbest178.seq
229062025 gbest179.seq
230688364 gbest18.seq
230688504 gbest180.seq
230689029 gbest181.seq
230690309 gbest182.seq
230690724 gbest183.seq
230687621 gbest184.seq
230689492 gbest185.seq
230690825 gbest186.seq
230689831 gbest187.seq
230690027 gbest188.seq
230689481 gbest189.seq
230687676 gbest19.seq
230691607 gbest190.seq
230687668 gbest191.seq
230688257 gbest192.seq
230688775 gbest193.seq
230690222 gbest194.seq
230689579 gbest195.seq
230690490 gbest196.seq
230688729 gbest197.seq
230689329 gbest198.seq
230687917 gbest199.seq
230690014 gbest2.seq
230687609 gbest20.seq
230688427 gbest200.seq
230690380 gbest201.seq
230688945 gbest202.seq
230688764 gbest203.seq
230689247 gbest204.seq
230689404 gbest205.seq
230690628 gbest206.seq
230690603 gbest207.seq
230688096 gbest208.seq
230688432 gbest209.seq
230687941 gbest21.seq
230690777 gbest210.seq
230687689 gbest211.seq
230688616 gbest212.seq
230689243 gbest213.seq
230688755 gbest214.seq
230689626 gbest215.seq
230689114 gbest216.seq
230689590 gbest217.seq
230688075 gbest218.seq
230688947 gbest219.seq
230689319 gbest22.seq
230688597 gbest220.seq
230690058 gbest221.seq
230690502 gbest222.seq
230687943 gbest223.seq
230688188 gbest224.seq
230689054 gbest225.seq
230689766 gbest226.seq
230689719 gbest227.seq
230689570 gbest228.seq
198199816 gbest229.seq
230689740 gbest23.seq
162949484 gbest230.seq
162899735 gbest231.seq
170549511 gbest232.seq
169262408 gbest233.seq
165341087 gbest234.seq
165329430 gbest235.seq
164870426 gbest236.seq
164174071 gbest237.seq
164633440 gbest238.seq
164205809 gbest239.seq
230687893 gbest24.seq
164381988 gbest240.seq
163225280 gbest241.seq
167902477 gbest242.seq
163407182 gbest243.seq
162459356 gbest244.seq
166298648 gbest245.seq
168126058 gbest246.seq
166446234 gbest247.seq
165724543 gbest248.seq
165636278 gbest249.seq
230689109 gbest25.seq
165264906 gbest250.seq
164448827 gbest251.seq
164260118 gbest252.seq
164858998 gbest253.seq
165101558 gbest254.seq
177361706 gbest255.seq
174699464 gbest256.seq
177882501 gbest257.seq
230692768 gbest258.seq
230688520 gbest259.seq
230688851 gbest26.seq
230689335 gbest260.seq
230687532 gbest261.seq
230687545 gbest262.seq
230690308 gbest263.seq
230687946 gbest264.seq
230689289 gbest265.seq
230689502 gbest266.seq
230688221 gbest267.seq
230691100 gbest268.seq
230689285 gbest269.seq
230687535 gbest27.seq
230687534 gbest270.seq
230690097 gbest271.seq
230688306 gbest272.seq
230689368 gbest273.seq
230690606 gbest274.seq
230689668 gbest275.seq
230690072 gbest276.seq
230690377 gbest277.seq
230690834 gbest278.seq
230690981 gbest279.seq
230689194 gbest28.seq
230688423 gbest280.seq
230688288 gbest281.seq
230688773 gbest282.seq
230688262 gbest283.seq
230689011 gbest284.seq
230690072 gbest285.seq
230689696 gbest286.seq
230689233 gbest287.seq
230690048 gbest288.seq
209810888 gbest289.seq
230689673 gbest29.seq
230687963 gbest290.seq
230687667 gbest291.seq
230689210 gbest292.seq
230690004 gbest293.seq
230688481 gbest294.seq
230689217 gbest295.seq
230690216 gbest296.seq
230688018 gbest297.seq
230689558 gbest298.seq
230689480 gbest299.seq
230690086 gbest3.seq
230688580 gbest30.seq
230687993 gbest300.seq
230687781 gbest301.seq
230687902 gbest302.seq
230689763 gbest303.seq
230689645 gbest304.seq
230689862 gbest305.seq
230687737 gbest306.seq
230688868 gbest307.seq
230690646 gbest308.seq
230688715 gbest309.seq
230689237 gbest31.seq
230687718 gbest310.seq
230691760 gbest311.seq
230691524 gbest312.seq
230689489 gbest313.seq
230689856 gbest314.seq
230688573 gbest315.seq
230690307 gbest316.seq
230688315 gbest317.seq
230687634 gbest318.seq
230688757 gbest319.seq
230689375 gbest32.seq
230687510 gbest320.seq
230688702 gbest321.seq
230689487 gbest322.seq
230688267 gbest323.seq
230689962 gbest324.seq
230690608 gbest325.seq
230690731 gbest326.seq
230689322 gbest327.seq
230688774 gbest328.seq
230688106 gbest329.seq
230689881 gbest33.seq
230688179 gbest330.seq
230689241 gbest331.seq
230688354 gbest332.seq
230689055 gbest333.seq
230689777 gbest334.seq
230689175 gbest335.seq
230688223 gbest336.seq
230689488 gbest337.seq
230687490 gbest338.seq
230690489 gbest339.seq
230690410 gbest34.seq
230687900 gbest340.seq
198306356 gbest341.seq
230688409 gbest342.seq
230687768 gbest343.seq
230689752 gbest344.seq
230691038 gbest345.seq
230687572 gbest346.seq
209011353 gbest347.seq
142768401 gbest348.seq
229635577 gbest349.seq
230688694 gbest35.seq
230687521 gbest350.seq
230689536 gbest351.seq
230689473 gbest352.seq
230688551 gbest353.seq
230690053 gbest354.seq
230689584 gbest355.seq
230687733 gbest356.seq
230691171 gbest357.seq
230689721 gbest358.seq
230689690 gbest359.seq
230689242 gbest36.seq
230691590 gbest360.seq
230692187 gbest361.seq
230689214 gbest362.seq
230690004 gbest363.seq
230688202 gbest364.seq
230687606 gbest365.seq
230689024 gbest366.seq
230687851 gbest367.seq
230690232 gbest368.seq
230688864 gbest369.seq
230689933 gbest37.seq
212269020 gbest370.seq
230691482 gbest371.seq
230690074 gbest372.seq
230688700 gbest373.seq
230691295 gbest374.seq
230688835 gbest375.seq
230688187 gbest376.seq
230689041 gbest377.seq
230688454 gbest378.seq
230689396 gbest379.seq
230688539 gbest38.seq
230688304 gbest380.seq
230691262 gbest381.seq
230688500 gbest382.seq
230690240 gbest383.seq
230689517 gbest384.seq
230687631 gbest385.seq
230688944 gbest386.seq
230690052 gbest387.seq
230690193 gbest388.seq
230688329 gbest389.seq
230688453 gbest39.seq
230690138 gbest390.seq
230688016 gbest391.seq
230694379 gbest392.seq
230689198 gbest393.seq
230688486 gbest394.seq
230689562 gbest395.seq
230689033 gbest396.seq
226881673 gbest397.seq
230691087 gbest398.seq
230689858 gbest399.seq
230690304 gbest4.seq
230689913 gbest40.seq
230688591 gbest400.seq
230688844 gbest401.seq
230688601 gbest402.seq
230688719 gbest403.seq
218866240 gbest404.seq
230688906 gbest405.seq
230688716 gbest406.seq
230689040 gbest407.seq
230689611 gbest408.seq
230689273 gbest409.seq
230688832 gbest41.seq
230689350 gbest410.seq
230688342 gbest411.seq
230688897 gbest412.seq
230690264 gbest413.seq
230689069 gbest414.seq
230689933 gbest415.seq
230690388 gbest416.seq
230687728 gbest417.seq
230688068 gbest418.seq
230690076 gbest419.seq
230464428 gbest42.seq
230688493 gbest420.seq
230689563 gbest421.seq
210638052 gbest422.seq
210240817 gbest423.seq
210113339 gbest424.seq
210380161 gbest425.seq
210313883 gbest426.seq
210463714 gbest427.seq
211165609 gbest428.seq
211594282 gbest429.seq
230688487 gbest43.seq
211470879 gbest430.seq
211707137 gbest431.seq
213804293 gbest432.seq
211531625 gbest433.seq
210631869 gbest434.seq
210725341 gbest435.seq
210732429 gbest436.seq
210180382 gbest437.seq
210192857 gbest438.seq
210208675 gbest439.seq
210827016 gbest44.seq
210155789 gbest440.seq
216815109 gbest441.seq
230688605 gbest442.seq
230689375 gbest443.seq
230688211 gbest444.seq
230687519 gbest445.seq
230689430 gbest446.seq
230689928 gbest447.seq
230688306 gbest448.seq
230688811 gbest449.seq
192182263 gbest45.seq
230689513 gbest450.seq
230689145 gbest451.seq
230687798 gbest452.seq
230689782 gbest453.seq
230687458 gbest454.seq
230689822 gbest455.seq
230688911 gbest456.seq
230691674 gbest457.seq
230687538 gbest458.seq
230688398 gbest459.seq
195650964 gbest46.seq
230697572 gbest460.seq
230691186 gbest461.seq
230689013 gbest462.seq
230687740 gbest463.seq
230689165 gbest464.seq
230689159 gbest465.seq
230689536 gbest466.seq
230687550 gbest467.seq
225335612 gbest468.seq
230689353 gbest469.seq
216512807 gbest47.seq
230688641 gbest470.seq
230688968 gbest471.seq
230691661 gbest472.seq
230689138 gbest473.seq
230688886 gbest474.seq
230689646 gbest475.seq
230688570 gbest476.seq
230687532 gbest477.seq
230688930 gbest478.seq
230688246 gbest479.seq
216126590 gbest48.seq
230687482 gbest480.seq
230687850 gbest481.seq
230689288 gbest482.seq
230688086 gbest483.seq
230690481 gbest484.seq
230690772 gbest485.seq
230688834 gbest486.seq
230687465 gbest487.seq
230687743 gbest488.seq
230687946 gbest489.seq
216170002 gbest49.seq
230690419 gbest490.seq
230689382 gbest491.seq
230688442 gbest492.seq
230687969 gbest493.seq
230690026 gbest494.seq
230689362 gbest495.seq
230688600 gbest496.seq
230689923 gbest497.seq
230689495 gbest498.seq
230690518 gbest499.seq
164122838 gbest5.seq
216815299 gbest50.seq
230688881 gbest500.seq
230687849 gbest501.seq
230687700 gbest502.seq
230688487 gbest503.seq
230689523 gbest504.seq
230689430 gbest505.seq
230689250 gbest506.seq
230688443 gbest507.seq
230687723 gbest508.seq
230023156 gbest509.seq
230687928 gbest51.seq
230687897 gbest510.seq
230688774 gbest511.seq
230689833 gbest512.seq
230689329 gbest513.seq
230689005 gbest514.seq
230687973 gbest515.seq
230688200 gbest516.seq
230687447 gbest517.seq
230688619 gbest518.seq
230689967 gbest519.seq
230688238 gbest52.seq
230687463 gbest520.seq
230689308 gbest521.seq
230688762 gbest522.seq
230689682 gbest523.seq
196039670 gbest524.seq
206200083 gbest525.seq
230688964 gbest526.seq
230687633 gbest527.seq
230688601 gbest528.seq
230688569 gbest529.seq
230687583 gbest53.seq
230688339 gbest530.seq
230688096 gbest531.seq
230688404 gbest532.seq
230689135 gbest533.seq
230690096 gbest534.seq
230688864 gbest535.seq
230687602 gbest536.seq
230687784 gbest537.seq
230687447 gbest538.seq
222133714 gbest539.seq
220093897 gbest54.seq
230688701 gbest540.seq
230688687 gbest541.seq
230689118 gbest542.seq
230687759 gbest543.seq
230689011 gbest544.seq
230688400 gbest545.seq
218963182 gbest546.seq
215182031 gbest547.seq
230688713 gbest548.seq
230689590 gbest549.seq
230688762 gbest55.seq
230689859 gbest550.seq
230688842 gbest551.seq
230689518 gbest552.seq
230687935 gbest553.seq
230689223 gbest554.seq
230687622 gbest555.seq
230690447 gbest556.seq
230688102 gbest557.seq
230687992 gbest558.seq
230688016 gbest559.seq
230688571 gbest56.seq
230688686 gbest560.seq
230687952 gbest561.seq
230689637 gbest562.seq
230689221 gbest563.seq
230690706 gbest564.seq
230689064 gbest565.seq
230688624 gbest566.seq
230690373 gbest567.seq
230687538 gbest568.seq
230689906 gbest569.seq
230688933 gbest57.seq
230688423 gbest570.seq
230689810 gbest571.seq
230687833 gbest572.seq
230689018 gbest573.seq
230689152 gbest574.seq
230689654 gbest575.seq
230687934 gbest576.seq
217116414 gbest577.seq
230688213 gbest578.seq
230687469 gbest579.seq
230688289 gbest58.seq
230689796 gbest580.seq
230691526 gbest581.seq
230689564 gbest582.seq
230689816 gbest583.seq
230688963 gbest584.seq
230688472 gbest585.seq
230688966 gbest586.seq
230688049 gbest587.seq
230687600 gbest588.seq
230688093 gbest589.seq
230688080 gbest59.seq
230687583 gbest590.seq
230690893 gbest591.seq
230689443 gbest592.seq
230690201 gbest593.seq
230687487 gbest594.seq
230688169 gbest595.seq
230689073 gbest596.seq
230689261 gbest597.seq
230690706 gbest598.seq
230690114 gbest599.seq
177441792 gbest6.seq
230687821 gbest60.seq
230687637 gbest600.seq
230688429 gbest601.seq
230688010 gbest602.seq
230689374 gbest603.seq
230688112 gbest604.seq
230688434 gbest605.seq
230688102 gbest606.seq
220169768 gbest607.seq
230688579 gbest608.seq
215199976 gbest609.seq
230688536 gbest61.seq
230690431 gbest62.seq
230689082 gbest63.seq
230688348 gbest64.seq
230688103 gbest65.seq
230689243 gbest66.seq
230690720 gbest67.seq
230688087 gbest68.seq
230689084 gbest69.seq
230690089 gbest7.seq
230689009 gbest70.seq
209770460 gbest71.seq
209388568 gbest72.seq
208414699 gbest73.seq
209211364 gbest74.seq
209987510 gbest75.seq
210041119 gbest76.seq
208892145 gbest77.seq
209132352 gbest78.seq
210315036 gbest79.seq
230688637 gbest8.seq
207752047 gbest80.seq
205713461 gbest81.seq
208319863 gbest82.seq
208544102 gbest83.seq
212641093 gbest84.seq
228833320 gbest85.seq
230691892 gbest86.seq
230690413 gbest87.seq
218561432 gbest88.seq
214838093 gbest89.seq
230688601 gbest9.seq
215603530 gbest90.seq
230688809 gbest91.seq
230688231 gbest92.seq
230689733 gbest93.seq
230691289 gbest94.seq
230690355 gbest95.seq
230689813 gbest96.seq
230687465 gbest97.seq
230687714 gbest98.seq
230687982 gbest99.seq
66062398 gbgen.idx
230690046 gbgss1.seq
230687925 gbgss10.seq
230688445 gbgss100.seq
227786605 gbgss101.seq
228829791 gbgss102.seq
228541384 gbgss103.seq
228597325 gbgss104.seq
227733862 gbgss105.seq
230689646 gbgss106.seq
230688150 gbgss107.seq
230688910 gbgss108.seq
230688150 gbgss109.seq
230689943 gbgss11.seq
230690384 gbgss110.seq
230690069 gbgss111.seq
230689457 gbgss112.seq
230689061 gbgss113.seq
230689955 gbgss114.seq
230688893 gbgss115.seq
230688819 gbgss116.seq
230690330 gbgss117.seq
230689250 gbgss118.seq
230688772 gbgss119.seq
230687579 gbgss12.seq
230687866 gbgss120.seq
230689807 gbgss121.seq
230687734 gbgss122.seq
230688099 gbgss123.seq
230689318 gbgss124.seq
230689116 gbgss125.seq
230688957 gbgss126.seq
230688846 gbgss127.seq
230687637 gbgss128.seq
230690468 gbgss129.seq
230689530 gbgss13.seq
230689957 gbgss130.seq
230687712 gbgss131.seq
230688944 gbgss132.seq
230688650 gbgss133.seq
230688572 gbgss134.seq
230690138 gbgss135.seq
230687778 gbgss136.seq
230688568 gbgss137.seq
230687971 gbgss138.seq
230689251 gbgss139.seq
230689493 gbgss14.seq
230689665 gbgss140.seq
230690062 gbgss141.seq
230687548 gbgss142.seq
230687564 gbgss143.seq
230689407 gbgss144.seq
224178699 gbgss145.seq
230688539 gbgss146.seq
230691085 gbgss147.seq
211581040 gbgss148.seq
230688916 gbgss149.seq
230688454 gbgss15.seq
230689467 gbgss150.seq
230689047 gbgss151.seq
230689453 gbgss152.seq
230687895 gbgss153.seq
230688940 gbgss154.seq
230688990 gbgss155.seq
230687743 gbgss156.seq
230689016 gbgss157.seq
230688832 gbgss158.seq
230688964 gbgss159.seq
230687986 gbgss16.seq
230687901 gbgss160.seq
230688834 gbgss161.seq
230690139 gbgss162.seq
230688162 gbgss163.seq
230689378 gbgss164.seq
230688559 gbgss165.seq
230688435 gbgss166.seq
230687532 gbgss167.seq
230690744 gbgss168.seq
230689376 gbgss169.seq
230689511 gbgss17.seq
213545714 gbgss170.seq
207624609 gbgss171.seq
210221044 gbgss172.seq
210659198 gbgss173.seq
209619708 gbgss174.seq
209324700 gbgss175.seq
207501723 gbgss176.seq
207258269 gbgss177.seq
207715364 gbgss178.seq
209458106 gbgss179.seq
230691286 gbgss18.seq
209307168 gbgss180.seq
208342832 gbgss181.seq
205765441 gbgss182.seq
205639826 gbgss183.seq
205257716 gbgss184.seq
205430367 gbgss185.seq
205294494 gbgss186.seq
206286978 gbgss187.seq
207537255 gbgss188.seq
208584550 gbgss189.seq
230690261 gbgss19.seq
207848646 gbgss190.seq
208005129 gbgss191.seq
208756042 gbgss192.seq
208854483 gbgss193.seq
208740653 gbgss194.seq
205784904 gbgss195.seq
206126873 gbgss196.seq
206435204 gbgss197.seq
205451088 gbgss198.seq
206210873 gbgss199.seq
230687913 gbgss2.seq
230689570 gbgss20.seq
207262078 gbgss200.seq
207162940 gbgss201.seq
207110808 gbgss202.seq
207229333 gbgss203.seq
207023043 gbgss204.seq
207165452 gbgss205.seq
206844608 gbgss206.seq
206969184 gbgss207.seq
206697880 gbgss208.seq
207848901 gbgss209.seq
230688600 gbgss21.seq
207972186 gbgss210.seq
209554011 gbgss211.seq
210071819 gbgss212.seq
209272321 gbgss213.seq
210231129 gbgss214.seq
218725528 gbgss215.seq
218861105 gbgss216.seq
230688987 gbgss217.seq
49833128 gbgss218.seq
250002921 gbgss219.seq
230687685 gbgss22.seq
250000726 gbgss220.seq
250000067 gbgss221.seq
250000345 gbgss222.seq
250001954 gbgss223.seq
250000662 gbgss224.seq
250000835 gbgss225.seq
250001947 gbgss226.seq
250000440 gbgss227.seq
250002587 gbgss228.seq
250001247 gbgss229.seq
230691328 gbgss23.seq
250000988 gbgss230.seq
250003034 gbgss231.seq
250001796 gbgss232.seq
250002813 gbgss233.seq
250000528 gbgss234.seq
250001729 gbgss235.seq
250001718 gbgss236.seq
250001651 gbgss237.seq
250001847 gbgss238.seq
250001833 gbgss239.seq
230689939 gbgss24.seq
250000039 gbgss240.seq
250001551 gbgss241.seq
250001718 gbgss242.seq
250001617 gbgss243.seq
250000286 gbgss244.seq
250000240 gbgss245.seq
250002081 gbgss246.seq
250000744 gbgss247.seq
250002611 gbgss248.seq
250000064 gbgss249.seq
230688652 gbgss25.seq
250001728 gbgss250.seq
250000263 gbgss251.seq
250001074 gbgss252.seq
250001289 gbgss253.seq
250002350 gbgss254.seq
250000992 gbgss255.seq
250000825 gbgss256.seq
250001859 gbgss257.seq
250002263 gbgss258.seq
250002310 gbgss259.seq
230689524 gbgss26.seq
250000683 gbgss260.seq
196558575 gbgss261.seq
230689394 gbgss27.seq
230690602 gbgss28.seq
230689077 gbgss29.seq
230690350 gbgss3.seq
230689461 gbgss30.seq
230689369 gbgss31.seq
230689720 gbgss32.seq
230688735 gbgss33.seq
230689415 gbgss34.seq
230688931 gbgss35.seq
230690008 gbgss36.seq
230687666 gbgss37.seq
230688429 gbgss38.seq
230688370 gbgss39.seq
230689545 gbgss4.seq
230689378 gbgss40.seq
230688250 gbgss41.seq
230688405 gbgss42.seq
230690577 gbgss43.seq
230688619 gbgss44.seq
230689232 gbgss45.seq
230687556 gbgss46.seq
230688349 gbgss47.seq
230687454 gbgss48.seq
230689175 gbgss49.seq
230687819 gbgss5.seq
230688335 gbgss50.seq
230689117 gbgss51.seq
230687711 gbgss52.seq
230690407 gbgss53.seq
230689490 gbgss54.seq
230689065 gbgss55.seq
230687668 gbgss56.seq
230688562 gbgss57.seq
230688048 gbgss58.seq
230688918 gbgss59.seq
230689999 gbgss6.seq
230689975 gbgss60.seq
228993415 gbgss61.seq
230688778 gbgss62.seq
230687511 gbgss63.seq
230687607 gbgss64.seq
230688416 gbgss65.seq
230690049 gbgss66.seq
230687913 gbgss67.seq
230688471 gbgss68.seq
230689660 gbgss69.seq
230687516 gbgss7.seq
230688367 gbgss70.seq
230687760 gbgss71.seq
230688936 gbgss72.seq
230688026 gbgss73.seq
230688352 gbgss74.seq
230688700 gbgss75.seq
230687803 gbgss76.seq
230688996 gbgss77.seq
230689069 gbgss78.seq
230688537 gbgss79.seq
230688381 gbgss8.seq
230689811 gbgss80.seq
225572717 gbgss81.seq
194168522 gbgss82.seq
194316499 gbgss83.seq
230690064 gbgss84.seq
230688640 gbgss85.seq
230687954 gbgss86.seq
230688550 gbgss87.seq
230687633 gbgss88.seq
230687671 gbgss89.seq
230688662 gbgss9.seq
230688153 gbgss90.seq
230690534 gbgss91.seq
230687474 gbgss92.seq
230687718 gbgss93.seq
230689584 gbgss94.seq
230690041 gbgss95.seq
230688128 gbgss96.seq
230687726 gbgss97.seq
230688347 gbgss98.seq
230689824 gbgss99.seq
250005766 gbhtc1.seq
250002144 gbhtc10.seq
250001683 gbhtc11.seq
114514639 gbhtc12.seq
250008813 gbhtc2.seq
250006065 gbhtc3.seq
250002501 gbhtc4.seq
250004560 gbhtc5.seq
250004815 gbhtc6.seq
250003568 gbhtc7.seq
250001109 gbhtc8.seq
250001625 gbhtc9.seq
250096230 gbhtg1.seq
250059721 gbhtg10.seq
250131065 gbhtg11.seq
250063943 gbhtg12.seq
250231890 gbhtg13.seq
250295338 gbhtg14.seq
250228000 gbhtg15.seq
250068670 gbhtg16.seq
250215574 gbhtg17.seq
250140995 gbhtg18.seq
250157426 gbhtg19.seq
250020783 gbhtg2.seq
250008648 gbhtg20.seq
250296874 gbhtg21.seq
250298094 gbhtg22.seq
250035445 gbhtg23.seq
250154108 gbhtg24.seq
250245674 gbhtg25.seq
250060934 gbhtg26.seq
250053522 gbhtg27.seq
250279943 gbhtg28.seq
250050062 gbhtg29.seq
250039036 gbhtg3.seq
250180400 gbhtg30.seq
250047555 gbhtg31.seq
250262952 gbhtg32.seq
250053616 gbhtg33.seq
250328397 gbhtg34.seq
250157248 gbhtg35.seq
250031649 gbhtg36.seq
250211515 gbhtg37.seq
250160956 gbhtg38.seq
250064366 gbhtg39.seq
250101893 gbhtg4.seq
250106003 gbhtg40.seq
250059693 gbhtg41.seq
250219196 gbhtg42.seq
250025671 gbhtg43.seq
250145071 gbhtg44.seq
250048740 gbhtg45.seq
250213105 gbhtg46.seq
250088633 gbhtg47.seq
250064530 gbhtg48.seq
250109131 gbhtg49.seq
250209184 gbhtg5.seq
250206348 gbhtg50.seq
250007482 gbhtg51.seq
250020313 gbhtg52.seq
250145532 gbhtg53.seq
250293746 gbhtg54.seq
250035074 gbhtg55.seq
250137447 gbhtg56.seq
250156241 gbhtg57.seq
250120324 gbhtg58.seq
250050927 gbhtg59.seq
250053401 gbhtg6.seq
250240214 gbhtg60.seq
250275678 gbhtg61.seq
250046467 gbhtg62.seq
250204453 gbhtg63.seq
250216781 gbhtg64.seq
250099587 gbhtg65.seq
250158087 gbhtg66.seq
250015061 gbhtg67.seq
250146166 gbhtg68.seq
250183263 gbhtg69.seq
250004218 gbhtg7.seq
250001384 gbhtg70.seq
250009304 gbhtg71.seq
250142709 gbhtg72.seq
250144130 gbhtg73.seq
250069579 gbhtg74.seq
250092368 gbhtg75.seq
250192196 gbhtg76.seq
250155352 gbhtg77.seq
250087971 gbhtg78.seq
250025457 gbhtg79.seq
250124022 gbhtg8.seq
250111682 gbhtg80.seq
250024292 gbhtg81.seq
250067408 gbhtg82.seq
250136086 gbhtg83.seq
250232901 gbhtg84.seq
250214338 gbhtg85.seq
250011909 gbhtg86.seq
250299094 gbhtg87.seq
250009713 gbhtg88.seq
250301890 gbhtg89.seq
250009913 gbhtg9.seq
250015835 gbhtg90.seq
250225224 gbhtg91.seq
250082256 gbhtg92.seq
250122833 gbhtg93.seq
250034026 gbhtg94.seq
250171525 gbhtg95.seq
67098525 gbhtg96.seq
250323496 gbinv1.seq
206376441 gbinv10.seq
279937828 gbinv2.seq
250001342 gbinv3.seq
250000221 gbinv4.seq
251010356 gbinv5.seq
250001815 gbinv6.seq
250001050 gbinv7.seq
250002027 gbinv8.seq
250000733 gbinv9.seq
166726898 gbjou1.idx
292387896 gbjou2.idx
47626924 gbjou3.idx
182877630 gbkey1.idx
97209856 gbkey2.idx
250002465 gbmam1.seq
250099297 gbmam2.seq
195694940 gbmam3.seq
20267799 gbnew.txt
250000101 gbpat1.seq
250004996 gbpat10.seq
250000197 gbpat11.seq
250000359 gbpat12.seq
250000649 gbpat13.seq
250000440 gbpat14.seq
250000617 gbpat15.seq
250000300 gbpat16.seq
250003588 gbpat17.seq
250001862 gbpat18.seq
250002929 gbpat19.seq
250000202 gbpat2.seq
250001659 gbpat20.seq
250001375 gbpat21.seq
250143409 gbpat22.seq
250001105 gbpat23.seq
250002239 gbpat24.seq
250001215 gbpat25.seq
256106879 gbpat26.seq
250000237 gbpat27.seq
250003013 gbpat28.seq
14958841 gbpat29.seq
250003351 gbpat3.seq
250002404 gbpat4.seq
250000082 gbpat5.seq
250000256 gbpat6.seq
250001296 gbpat7.seq
250000377 gbpat8.seq
250000958 gbpat9.seq
58817332 gbphg.seq
250093886 gbpln1.seq
250015599 gbpln10.seq
250001548 gbpln11.seq
250009369 gbpln12.seq
250124454 gbpln13.seq
250044924 gbpln14.seq
260041268 gbpln15.seq
256259063 gbpln16.seq
250093740 gbpln17.seq
250000336 gbpln18.seq
250001398 gbpln19.seq
250208646 gbpln2.seq
250004067 gbpln20.seq
250063810 gbpln21.seq
250002821 gbpln22.seq
250002411 gbpln23.seq
250001704 gbpln24.seq
200421238 gbpln25.seq
250047956 gbpln3.seq
250002110 gbpln4.seq
250001488 gbpln5.seq
250001651 gbpln6.seq
250008130 gbpln7.seq
250134565 gbpln8.seq
250000661 gbpln9.seq
250016311 gbpri1.seq
250037794 gbpri10.seq
250160887 gbpri11.seq
250036135 gbpri12.seq
250135180 gbpri13.seq
250293170 gbpri14.seq
250012325 gbpri15.seq
250243231 gbpri16.seq
250025293 gbpri17.seq
250294995 gbpri18.seq
250009068 gbpri19.seq
250184945 gbpri2.seq
250005278 gbpri20.seq
250102157 gbpri21.seq
250163260 gbpri22.seq
250103802 gbpri23.seq
250102007 gbpri24.seq
250040094 gbpri25.seq
250306746 gbpri26.seq
250051642 gbpri27.seq
250007981 gbpri28.seq
250000240 gbpri29.seq
250091155 gbpri3.seq
250129361 gbpri30.seq
250001162 gbpri31.seq
250002942 gbpri32.seq
135254016 gbpri33.seq
250155918 gbpri4.seq
250140948 gbpri5.seq
250212697 gbpri6.seq
250081363 gbpri7.seq
250014883 gbpri8.seq
250173883 gbpri9.seq
261290 gbrel.txt
250172007 gbrod1.seq
250002015 gbrod10.seq
250186367 gbrod11.seq
250185261 gbrod12.seq
250149962 gbrod13.seq
250250782 gbrod14.seq
250074248 gbrod15.seq
250221389 gbrod16.seq
250007704 gbrod17.seq
250023187 gbrod18.seq
250173104 gbrod19.seq
250042334 gbrod2.seq
250097801 gbrod20.seq
250003753 gbrod21.seq
250000597 gbrod22.seq
250151497 gbrod23.seq
250000002 gbrod24.seq
230937536 gbrod25.seq
250047382 gbrod3.seq
250181559 gbrod4.seq
250123719 gbrod5.seq
250222731 gbrod6.seq
250023945 gbrod7.seq
250172846 gbrod8.seq
250117246 gbrod9.seq
739115955 gbsdr1.txt
3470477590 gbsdr2.txt
1636734994 gbsdr3.txt
1397176 gbsec.idx
250001679 gbsts1.seq
250003545 gbsts10.seq
250001831 gbsts11.seq
250000863 gbsts12.seq
250001731 gbsts13.seq
174007151 gbsts14.seq
250001037 gbsts2.seq
250001378 gbsts3.seq
250003600 gbsts4.seq
250000982 gbsts5.seq
250003096 gbsts6.seq
250001347 gbsts7.seq
250000351 gbsts8.seq
250003375 gbsts9.seq
242012902 gbsyn.seq
422714 gbuna.seq
250001113 gbvrl1.seq
250002460 gbvrl2.seq
250000039 gbvrl3.seq
250003586 gbvrl4.seq
250011380 gbvrl5.seq
250001837 gbvrl6.seq
202794846 gbvrl7.seq
250033390 gbvrt1.seq
250005551 gbvrt10.seq
250065043 gbvrt11.seq
250000722 gbvrt12.seq
249789454 gbvrt13.seq
250011802 gbvrt2.seq
250058486 gbvrt3.seq
250001144 gbvrt4.seq
250002631 gbvrt5.seq
250135105 gbvrt6.seq
250011000 gbvrt7.seq
250094013 gbvrt8.seq
250039146 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-WGS
sequence data file:
Division Entries Bases
BCT1 29567 104400486
BCT10 219 97539273
BCT11 73 110923246
BCT12 48 111626856
BCT13 50 113942523
BCT14 61 120730072
BCT15 67 113445468
BCT16 42 111498586
BCT17 54 110578048
BCT18 62 114214463
BCT19 86 111514381
BCT2 4306 109307157
BCT20 23020 96816021
BCT21 70721 83276321
BCT22 26101 60303948
BCT3 160 112232466
BCT4 23043 104071134
BCT5 54354 87491468
BCT6 5397 98481616
BCT7 11617 104673699
BCT8 50484 92345446
BCT9 18946 114282954
ENV1 91100 71117104
ENV2 95327 73419306
ENV3 84984 84579060
ENV4 90281 85608830
ENV5 58095 55465730
EST1 68126 26289737
EST10 76542 29845947
EST100 71620 36569914
EST101 74052 37687918
EST102 73097 39255461
EST103 74653 40682771
EST104 70151 40171319
EST105 68921 36332839
EST106 73047 36351371
EST107 72326 45671320
EST108 72964 45296071
EST109 69405 42551945
EST11 75113 28770746
EST110 72504 33281542
EST111 69685 29562377
EST112 67375 38251261
EST113 68360 36069575
EST114 68342 42526980
EST115 72779 35621250
EST116 75053 34698805
EST117 74549 27207815
EST118 73603 35732710
EST119 74464 34735671
EST12 77630 30773407
EST120 64565 37662987
EST121 80536 44467237
EST122 77725 43873624
EST123 68549 47069188
EST124 67590 40649386
EST125 74435 50586222
EST126 69210 41886265
EST127 75125 44716496
EST128 73301 45675742
EST129 71784 49436314
EST13 77022 29275477
EST130 72433 47864299
EST131 78870 43243568
EST132 75562 31170163
EST133 78204 34715820
EST134 79179 45773906
EST135 74849 43850500
EST136 64213 33553470
EST137 70389 36661067
EST138 68503 38205513
EST139 65658 36605134
EST14 78503 31799444
EST140 71880 42753481
EST141 72603 46558226
EST142 68122 39420727
EST143 69673 39056043
EST144 72690 44757878
EST145 67391 39387310
EST146 64723 37114454
EST147 99281 53994220
EST148 77262 44065238
EST149 85998 44878793
EST15 74666 31555641
EST150 104469 55516536
EST151 105008 56990450
EST152 97203 55704033
EST153 75758 45198316
EST154 93427 55762810
EST155 97811 58761632
EST156 91869 54084030
EST157 77723 45132786
EST158 68848 37150429
EST159 65659 29746016
EST16 75789 33335854
EST160 60116 27857411
EST161 56394 27473988
EST162 64490 31342357
EST163 54293 27273001
EST164 80160 54231530
EST165 68095 36374877
EST166 72203 52636078
EST167 71820 40852590
EST168 60517 30351973
EST169 63849 38188104
EST17 82292 33971583
EST170 65875 32466277
EST171 63341 45875777
EST172 64160 36885298
EST173 104115 46040657
EST174 87830 52092350
EST175 99114 57401978
EST176 101837 57083374
EST177 96654 51987982
EST178 80186 37999235
EST179 92361 40315440
EST18 80898 32232516
EST180 94517 49520324
EST181 89443 34742314
EST182 94726 43011020
EST183 63879 42425711
EST184 68601 37350932
EST185 59848 35244633
EST186 69863 44682958
EST187 70657 29341384
EST188 76371 36480198
EST189 69552 41360619
EST19 78520 31851339
EST190 75953 37671555
EST191 66388 34722394
EST192 69191 49330165
EST193 68092 45838982
EST194 68426 35181425
EST195 68674 45077808
EST196 68955 52669624
EST197 69107 36142940
EST198 70781 42694990
EST199 70272 60868732
EST2 74651 28647346
EST20 74704 30615493
EST200 64546 46924272
EST201 63661 46505865
EST202 63235 46876284
EST203 65244 45220750
EST204 65767 49320391
EST205 62288 42765291
EST206 63281 37827299
EST207 62924 34746689
EST208 66791 38535560
EST209 81974 47947840
EST21 73721 34309621
EST210 83450 53753731
EST211 73542 42816076
EST212 106423 66374460
EST213 108843 65304080
EST214 108676 64447494
EST215 103305 66850413
EST216 107635 57837820
EST217 104712 50564411
EST218 85484 52153826
EST219 92613 41303321
EST22 75379 30237628
EST220 88544 45323200
EST221 73373 48023459
EST222 66893 42256063
EST223 68514 57814755
EST224 68056 58992573
EST225 78984 41329244
EST226 80964 44925319
EST227 74733 52775369
EST228 70889 51962486
EST229 46564 25853795
EST23 77315 32640072
EST230 27767 10564416
EST231 27747 10276149
EST232 26437 9821921
EST233 26717 9074478
EST234 27383 9531041
EST235 27185 10180222
EST236 27175 9751342
EST237 27306 10180850
EST238 27126 12013277
EST239 27210 11266559
EST24 74816 32914705
EST240 27276 10280669
EST241 27583 9361236
EST242 26890 9126462
EST243 27667 11190355
EST244 27830 10772479
EST245 27188 11263673
EST246 26628 12036888
EST247 26986 11299135
EST248 27070 10797843
EST249 26994 11537624
EST25 73840 31767236
EST250 27119 11539495
EST251 27264 11263097
EST252 27267 10807282
EST253 27199 10637146
EST254 27169 10747681
EST255 25002 16684953
EST256 25410 16854017
EST257 36383 18817558
EST258 93339 43675704
EST259 43449 28496735
EST26 75387 31162894
EST260 106433 40323067
EST261 71123 40078391
EST262 68728 44459143
EST263 69329 44588350
EST264 69098 44440449
EST265 66557 39009018
EST266 75305 43680163
EST267 64325 47476133
EST268 65139 34753626
EST269 74463 37098363
EST27 74660 32519961
EST270 101822 47430266
EST271 76546 42909739
EST272 67549 34317493
EST273 67491 32676263
EST274 70439 42142242
EST275 72349 34629745
EST276 68728 33326119
EST277 75562 48456165
EST278 63645 33812474
EST279 68027 38799796
EST28 108051 51190416
EST280 79663 41014628
EST281 77541 43519951
EST282 75871 50381497
EST283 78309 54768466
EST284 107666 48980803
EST285 87457 43650655
EST286 74536 44586297
EST287 72651 41719758
EST288 72321 37477242
EST289 70513 28849360
EST29 97057 46019042
EST290 70838 38431654
EST291 62382 34977785
EST292 62935 41705698
EST293 71991 41246050
EST294 62078 44719683
EST295 61646 32295760
EST296 83099 42934055
EST297 84269 41002022
EST298 74543 48728444
EST299 103905 57811709
EST3 73738 29918375
EST30 98398 53792062
EST300 122890 46946233
EST301 78280 38104030
EST302 67085 35155568
EST303 70119 46234902
EST304 80825 40868243
EST305 71641 41529666
EST306 71118 40660446
EST307 60451 34438946
EST308 60414 37080968
EST309 57142 33541552
EST31 83822 48471566
EST310 71158 49936768
EST311 72300 43861703
EST312 71670 41793454
EST313 71597 36712418
EST314 60671 32039702
EST315 53905 27280650
EST316 52911 27876706
EST317 53046 28404001
EST318 51901 27053794
EST319 53468 27293821
EST32 65516 46331286
EST320 55756 24093541
EST321 55438 23596177
EST322 54369 22288890
EST323 55536 21479625
EST324 54871 21973461
EST325 56317 22517436
EST326 54877 21492258
EST327 56167 20124051
EST328 63306 32144162
EST329 76451 37306629
EST33 72826 54940113
EST330 74485 33940628
EST331 76847 32281580
EST332 74435 31076639
EST333 94582 61058919
EST334 67704 54122671
EST335 91970 55406439
EST336 93205 55654126
EST337 95985 57498734
EST338 101550 54687827
EST339 96769 55388271
EST34 85425 48187796
EST340 64131 36963090
EST341 74154 35990816
EST342 64857 50301870
EST343 64724 49357310
EST344 59919 45812411
EST345 62709 37076890
EST346 69399 42458804
EST347 66845 42751755
EST348 48071 23740612
EST349 67867 35515353
EST35 86489 44024280
EST350 67494 36624420
EST351 60012 29361050
EST352 65622 41921151
EST353 77108 45189799
EST354 76987 40487235
EST355 63626 37129020
EST356 75234 44603325
EST357 65886 44392545
EST358 75407 44534467
EST359 84761 49491739
EST36 95103 51890453
EST360 89478 48648854
EST361 61755 32448838
EST362 64290 40372289
EST363 75779 36915503
EST364 50581 28053222
EST365 59575 32443107
EST366 70326 40497033
EST367 88995 47427221
EST368 86928 43968528
EST369 70015 46975171
EST37 83244 58645355
EST370 65844 46454736
EST371 69446 38645747
EST372 57472 33629488
EST373 95197 39231751
EST374 59942 38295095
EST375 53754 39180291
EST376 62534 35376081
EST377 77968 49261326
EST378 97716 54062890
EST379 65841 39115524
EST38 78479 54576415
EST380 82760 45861234
EST381 57548 33546412
EST382 40724 23337691
EST383 56284 33309843
EST384 82770 48882442
EST385 79743 45597863
EST386 73563 44052581
EST387 78824 46955551
EST388 77037 48749744
EST389 83818 58501669
EST39 88229 52532502
EST390 80464 68262498
EST391 77619 58535260
EST392 71318 40352396
EST393 59739 38893594
EST394 74851 40019482
EST395 52657 32840033
EST396 77513 30731664
EST397 80580 28305144
EST398 70072 44361562
EST399 64494 36945342
EST4 74567 28390970
EST40 63430 49983687
EST400 68298 35415423
EST401 70701 42134945
EST402 69017 45910860
EST403 66278 44887004
EST404 75443 44110647
EST405 58855 32880430
EST406 61572 37870998
EST407 80457 51546489
EST408 83476 48314541
EST409 77977 44271287
EST41 94039 46099919
EST410 58944 41050748
EST411 56784 40968927
EST412 57335 40519557
EST413 61399 38859748
EST414 78383 48323704
EST415 48984 30727822
EST416 64536 39892094
EST417 57867 40233028
EST418 60947 41165657
EST419 56315 42124692
EST42 87543 46085576
EST420 47348 33571632
EST421 89981 42131461
EST422 69396 38623779
EST423 69709 38322501
EST424 69861 38229864
EST425 69578 38744750
EST426 69602 38550471
EST427 69525 38769604
EST428 69009 38317008
EST429 68996 38255717
EST43 104824 46813017
EST430 69020 39257020
EST431 68560 38077686
EST432 67363 38240759
EST433 69297 39130406
EST434 69409 38101992
EST435 69434 38607208
EST436 69437 37897273
EST437 69832 38241965
EST438 69759 38298821
EST439 69727 38275576
EST44 79494 29468514
EST440 69895 37662712
EST441 77857 42389076
EST442 87631 48734628
EST443 79893 35625341
EST444 99853 57476229
EST445 80479 45482331
EST446 78153 48884867
EST447 88383 55716244
EST448 95361 58420381
EST449 76548 45158250
EST45 68734 18358086
EST450 87232 47922132
EST451 83253 46345607
EST452 52272 40185027
EST453 56425 43331652
EST454 74951 42252340
EST455 54318 32994558
EST456 92649 49999780
EST457 107176 58115975
EST458 76220 48249476
EST459 78742 55610793
EST46 72769 19827131
EST460 36948 20089722
EST461 52035 57354524
EST462 48534 57785397
EST463 75155 50118882
EST464 67313 39214701
EST465 74171 42350913
EST466 67714 42147021
EST467 69671 42895524
EST468 60279 52501620
EST469 89062 43714565
EST47 54465 16630875
EST470 109097 48021175
EST471 76956 52866975
EST472 59799 39244546
EST473 57470 41108480
EST474 58776 39278916
EST475 65896 50541358
EST476 63104 44922731
EST477 60973 42171841
EST478 51806 38344043
EST479 56732 38518729
EST48 43742 11910000
EST480 55793 41594181
EST481 68655 37430771
EST482 66353 44130850
EST483 57131 38069380
EST484 61579 42485168
EST485 58449 45728423
EST486 65152 48704213
EST487 63297 41817460
EST488 53448 40851977
EST489 54594 36589569
EST49 43209 11948017
EST490 53102 36296163
EST491 59551 38912078
EST492 67053 39921000
EST493 65201 44755647
EST494 74050 60990378
EST495 73701 50198796
EST496 61535 52624444
EST497 47971 56024636
EST498 60809 52103082
EST499 63939 40841818
EST5 48195 15294033
EST50 43185 11380614
EST500 66936 38290504
EST501 81821 50915467
EST502 81565 54414877
EST503 78015 47612448
EST504 65728 40986950
EST505 67275 41192336
EST506 75984 51559524
EST507 81342 48192623
EST508 75443 63532910
EST509 73472 48649838
EST51 86634 36705518
EST510 68551 48440826
EST511 67603 51997030
EST512 62698 45489752
EST513 62892 45516525
EST514 87825 46034683
EST515 88371 42984029
EST516 122112 40397489
EST517 90667 56498377
EST518 63467 51353362
EST519 50727 50131835
EST52 92390 38251475
EST520 85273 29225627
EST521 99640 11156369
EST522 99716 11031401
EST523 95813 39746194
EST524 87001 31668654
EST525 87195 33843476
EST526 64408 55695798
EST527 80345 56216487
EST528 87152 50636515
EST529 72970 41203769
EST53 94526 42341538
EST530 72037 52367280
EST531 71569 43912458
EST532 86467 54601482
EST533 75637 48519915
EST534 73382 53823350
EST535 65481 48516149
EST536 79888 57899410
EST537 90392 46238382
EST538 82688 47584048
EST539 83234 39637198
EST54 88373 46600420
EST540 75156 40786268
EST541 86091 53092079
EST542 75717 52378007
EST543 70850 53042221
EST544 72710 41836120
EST545 97757 49813591
EST546 112709 46864420
EST547 111122 48520944
EST548 131300 59036946
EST549 111609 54411929
EST55 88045 39707904
EST550 77010 55391852
EST551 84553 25261985
EST552 84292 8741880
EST553 108192 49123772
EST554 128115 62556053
EST555 85151 47236105
EST556 65032 42199789
EST557 72105 46040126
EST558 78346 51985212
EST559 72015 46171920
EST56 104577 54784126
EST560 77913 45318679
EST561 66723 51384287
EST562 83399 54516053
EST563 67455 42371219
EST564 62495 45919038
EST565 93200 58185586
EST566 91653 53810878
EST567 75277 43089450
EST568 82139 41465846
EST569 88844 47480737
EST57 96472 47914384
EST570 87736 47819579
EST571 68420 50321274
EST572 82549 56906990
EST573 89927 55086203
EST574 84951 57062039
EST575 78569 47338742
EST576 76797 38706364
EST577 70074 48703420
EST578 61817 38611122
EST579 90610 26206799
EST58 77086 33228702
EST580 76274 44993697
EST581 50591 33415805
EST582 51413 32549876
EST583 50425 35860490
EST584 74540 49312350
EST585 69110 49717260
EST586 96512 30936764
EST587 122591 11125353
EST588 118234 14519090
EST589 122483 11289585
EST59 67100 29337769
EST590 121657 11919405
EST591 69337 49729685
EST592 67269 52305926
EST593 76723 54115478
EST594 69673 48897774
EST595 73760 44667741
EST596 67476 43895086
EST597 66737 42684611
EST598 77844 39359482
EST599 76582 44776889
EST6 54921 17444496
EST60 73061 32181446
EST600 63806 57140824
EST601 85796 48297790
EST602 78517 37475606
EST603 71158 25629067
EST604 72190 26999487
EST605 73429 26101745
EST606 72068 26104634
EST607 77303 26017315
EST608 71432 28931646
EST609 69855 26295017
EST61 69569 29335923
EST62 82291 33072451
EST63 74545 29909100
EST64 68979 28094898
EST65 66005 29392237
EST66 76357 35544908
EST67 74298 32882446
EST68 74879 28515347
EST69 77627 28384042
EST7 74545 29358198
EST70 81409 37673935
EST71 40532 11649606
EST72 40430 11036116
EST73 40407 12533230
EST74 40789 12683081
EST75 40856 12314808
EST76 40725 12899287
EST77 40598 12793822
EST78 40466 12137595
EST79 40166 12104532
EST8 75833 30592306
EST80 41021 12671434
EST81 41324 11881597
EST82 41031 13054531
EST83 40848 13062778
EST84 42707 12735930
EST85 46223 18122571
EST86 42506 26652207
EST87 42423 18940136
EST88 48863 20093205
EST89 50688 21861624
EST9 77569 29868098
EST90 50429 21732527
EST91 83799 49422287
EST92 77206 37759004
EST93 73322 28068866
EST94 74116 29098186
EST95 74942 41299249
EST96 77286 40694533
EST97 76253 43524906
EST98 76260 34990800
EST99 74382 43258942
GSS1 90402 38650542
GSS10 74873 43594696
GSS100 80664 51903963
GSS101 74567 42664327
GSS102 73358 45723102
GSS103 73691 44884337
GSS104 73270 45649406
GSS105 73258 44839955
GSS106 75266 45640861
GSS107 81312 54661078
GSS108 83844 55515226
GSS109 80877 52549610
GSS11 70608 35929964
GSS110 82482 50218185
GSS111 84199 57805831
GSS112 80139 59814121
GSS113 90981 46136505
GSS114 90186 53567268
GSS115 73547 50024947
GSS116 89781 65307076
GSS117 82196 58897995
GSS118 75952 42225369
GSS119 81753 50639973
GSS12 72867 38288960
GSS120 95080 53332060
GSS121 84392 55609045
GSS122 84948 54772792
GSS123 82520 56164248
GSS124 76059 69621452
GSS125 76814 66081571
GSS126 79580 56124854
GSS127 78698 54671583
GSS128 79068 54060772
GSS129 79353 53688522
GSS13 76701 38974355
GSS130 78316 55286531
GSS131 82600 55940613
GSS132 84351 57436642
GSS133 80337 60421096
GSS134 58661 56683817
GSS135 78783 58813199
GSS136 75744 69156145
GSS137 76833 56328211
GSS138 78487 49995148
GSS139 92874 59388698
GSS14 71317 32131319
GSS140 94651 58128798
GSS141 86679 54570954
GSS142 86146 54910790
GSS143 78656 59527101
GSS144 95929 54898918
GSS145 115808 59172362
GSS146 100381 60998639
GSS147 76134 51421879
GSS148 53127 34214597
GSS149 72560 55176489
GSS15 70050 34744561
GSS150 72990 55905923
GSS151 72995 55897543
GSS152 73006 55878429
GSS153 72989 55905402
GSS154 72974 55933161
GSS155 77157 56620673
GSS156 76449 47248580
GSS157 85720 51228359
GSS158 91385 61755956
GSS159 81870 64722019
GSS16 78481 46288404
GSS160 94101 58400665
GSS161 80869 54393178
GSS162 87902 57201319
GSS163 94668 59260505
GSS164 84716 62770763
GSS165 93225 43223840
GSS166 116911 10728751
GSS167 83328 59630901
GSS168 55397 40216193
GSS169 51210 39249582
GSS17 70907 33296681
GSS170 61523 50961382
GSS171 59053 45384671
GSS172 57672 48568108
GSS173 57499 48762789
GSS174 58236 46459123
GSS175 58448 45820350
GSS176 58842 48479266
GSS177 58951 48415295
GSS178 58631 49401619
GSS179 58199 48365491
GSS18 59084 27955789
GSS180 58627 46114096
GSS181 58863 49463418
GSS182 60164 50142155
GSS183 60260 49906408
GSS184 60526 49107721
GSS185 60406 49468122
GSS186 60500 49184425
GSS187 59925 46864505
GSS188 59168 45304596
GSS189 58436 47610161
GSS19 56793 29073346
GSS190 58951 45999175
GSS191 58840 46346120
GSS192 58316 47986440
GSS193 58248 48200681
GSS194 58308 48548945
GSS195 60103 50079963
GSS196 59867 50789488
GSS197 59865 49245811
GSS198 60698 45685264
GSS199 60171 47314232
GSS2 88922 39302491
GSS20 57668 26711767
GSS200 59441 49573722
GSS201 59512 49358808
GSS202 59546 49252553
GSS203 59464 49504973
GSS204 59606 49070115
GSS205 59507 49371712
GSS206 59733 48686321
GSS207 59643 48956902
GSS208 59830 48304260
GSS209 58898 45871316
GSS21 61407 28964145
GSS210 58817 46158193
GSS211 58365 47726719
GSS212 58241 48162604
GSS213 58731 46214939
GSS214 57888 47995244
GSS215 64725 54652577
GSS216 64818 54767267
GSS217 99221 64438802
GSS218 16894 11281370
GSS219 86834 64340568
GSS22 64809 38246378
GSS220 83577 62754431
GSS221 103078 48150623
GSS222 68607 58517212
GSS223 68308 58775321
GSS224 69367 56630326
GSS225 69630 56119809
GSS226 70347 55379222
GSS227 85863 73179663
GSS228 86399 44944094
GSS229 88633 47125238
GSS23 57539 27055103
GSS230 85063 64770849
GSS231 70303 58967171
GSS232 69830 59920636
GSS233 63571 60896148
GSS234 81782 47152519
GSS235 87374 35525792
GSS236 107287 82097194
GSS237 105510 69614480
GSS238 84077 34011474
GSS239 120025 73824844
GSS24 66073 42002515
GSS240 120084 73762028
GSS241 115988 75258477
GSS242 94681 51364940
GSS243 87315 55418085
GSS244 98977 65364214
GSS245 107931 77900829
GSS246 107178 78840239
GSS247 105841 80272292
GSS248 97195 72722877
GSS249 83558 54678662
GSS25 68295 28341565
GSS250 110401 67135871
GSS251 110251 65959610
GSS252 104854 56801717
GSS253 75989 43357707
GSS254 105713 50476898
GSS255 86712 63966357
GSS256 95248 68681160
GSS257 95883 36586543
GSS258 95438 37237367
GSS259 96614 35260960
GSS26 58182 25340079
GSS260 94603 38634146
GSS261 69152 46568683
GSS27 65220 31888550
GSS28 65628 32592309
GSS29 77075 39617102
GSS3 87408 41798969
GSS30 82956 39733779
GSS31 74196 40401765
GSS32 70532 48278668
GSS33 79797 37819342
GSS34 75878 40340353
GSS35 74093 40090935
GSS36 87332 56001711
GSS37 87599 58170691
GSS38 85511 44950336
GSS39 86886 50521408
GSS4 78863 41012944
GSS40 86223 40151318
GSS41 83188 31659555
GSS42 81245 56935950
GSS43 80202 58163560
GSS44 72026 47499906
GSS45 72032 47437870
GSS46 77658 45788350
GSS47 77835 38607911
GSS48 83194 57974420
GSS49 86561 64612389
GSS5 78780 40537254
GSS50 81571 54575927
GSS51 93902 59236455
GSS52 88545 58803062
GSS53 76735 42453380
GSS54 72692 40311507
GSS55 86587 47167330
GSS56 88049 58404630
GSS57 76575 64123858
GSS58 70896 78090279
GSS59 85693 69155916
GSS6 78152 38866862
GSS60 89533 60167677
GSS61 63444 44826689
GSS62 66063 45395589
GSS63 89645 67196317
GSS64 84956 58411339
GSS65 86106 53001111
GSS66 85506 55697832
GSS67 93375 57842769
GSS68 97854 52541165
GSS69 97525 52978247
GSS7 77741 39121259
GSS70 98231 52043295
GSS71 99181 50783240
GSS72 99215 50739328
GSS73 99072 50929048
GSS74 99684 50116950
GSS75 97772 52649984
GSS76 91855 64690230
GSS77 89861 70745330
GSS78 88911 70097938
GSS79 87853 69641604
GSS8 75713 38106019
GSS80 87885 63943229
GSS81 88277 44782123
GSS82 78272 23284467
GSS83 78150 23572326
GSS84 84150 49120906
GSS85 77313 45465324
GSS86 88952 56158697
GSS87 84315 58639539
GSS88 76357 76793830
GSS89 79379 73092546
GSS9 72102 37149999
GSS90 84492 46459055
GSS91 84778 49510897
GSS92 75625 41885111
GSS93 79333 56691265
GSS94 77180 56468742
GSS95 82097 54156207
GSS96 84748 58286670
GSS97 85366 57702247
GSS98 87367 52198860
GSS99 81439 67169874
HTC1 25064 27057244
HTC10 66720 81580196
HTC11 68222 59039782
HTC12 29423 37255284
HTC2 15992 36040161
HTC3 15968 36540083
HTC4 16191 35387639
HTC5 15926 40287252
HTC6 16011 37280168
HTC7 51319 28421323
HTC8 55941 71510037
HTC9 81456 70193596
HTG1 1318 188929277
HTG10 1300 186477873
HTG11 1437 184183182
HTG12 883 191867533
HTG13 751 192405888
HTG14 743 192375470
HTG15 782 192313879
HTG16 802 192010230
HTG17 768 192318086
HTG18 2050 171319873
HTG19 1054 187981982
HTG2 2465 186071856
HTG20 996 189097368
HTG21 782 192087293
HTG22 925 190510953
HTG23 901 190586664
HTG24 808 191507090
HTG25 780 192166174
HTG26 857 191368821
HTG27 889 190742228
HTG28 948 190117267
HTG29 897 191062364
HTG3 2517 185290576
HTG30 928 190475719
HTG31 872 191308892
HTG32 968 189758540
HTG33 877 191165426
HTG34 858 191667451
HTG35 827 191908957
HTG36 933 190184443
HTG37 934 190902995
HTG38 941 190379296
HTG39 1035 189345169
HTG4 2553 188532563
HTG40 1188 187252423
HTG41 1237 188154870
HTG42 1198 188301143
HTG43 1167 187143152
HTG44 1099 191590258
HTG45 1244 190876680
HTG46 1216 191054080
HTG47 1135 191226449
HTG48 1045 191129962
HTG49 930 189550761
HTG5 1284 185715991
HTG50 1053 189736105
HTG51 904 189535097
HTG52 1043 189532211
HTG53 925 189624939
HTG54 998 189545130
HTG55 917 189182807
HTG56 974 188907614
HTG57 1084 188755133
HTG58 981 189501845
HTG59 1097 185750811
HTG6 1274 185234665
HTG60 1096 189013789
HTG61 989 189296974
HTG62 1013 188879420
HTG63 977 189274183
HTG64 1115 188780023
HTG65 1111 187863402
HTG66 1292 184433881
HTG67 1235 185487613
HTG68 1235 184699619
HTG69 1252 184766282
HTG7 1277 185414872
HTG70 1208 186425569
HTG71 1426 186918415
HTG72 1254 188846392
HTG73 1114 191437750
HTG74 1198 191924250
HTG75 1157 191330635
HTG76 1147 191472384
HTG77 1183 191633891
HTG78 1143 191528959
HTG79 1217 191133373
HTG8 1459 184762119
HTG80 1167 191453724
HTG81 1140 191527768
HTG82 1131 191322933
HTG83 1337 186967029
HTG84 1248 190380070
HTG85 1296 189801859
HTG86 1261 189156458
HTG87 1148 190611802
HTG88 1142 187124040
HTG89 1467 188488753
HTG9 1200 186999351
HTG90 980 193507512
HTG91 750 169259295
HTG92 1095 193977343
HTG93 1111 192344011
HTG94 1088 192747894
HTG95 1114 188698558
HTG96 415 51014860
INV1 38798 129243007
INV10 26734 93283379
INV2 1764 197338358
INV3 13987 137917251
INV4 78152 73765484
INV5 40726 111437881
INV6 62245 84484008
INV7 80672 71117406
INV8 63348 83286490
INV9 83972 69320479
MAM1 23229 152539651
MAM2 60814 87343762
MAM3 54926 75890228
PAT1 222610 70141260
PAT10 125437 99521476
PAT11 141741 62606569
PAT12 105796 59940607
PAT13 103556 50226950
PAT14 121472 53276251
PAT15 113046 61292641
PAT16 145017 54899720
PAT17 155516 69895616
PAT18 97490 122599302
PAT19 147596 87374532
PAT2 194518 84655123
PAT20 117413 104539537
PAT21 123723 103466459
PAT22 119269 106142975
PAT23 111058 93498111
PAT24 106407 73282841
PAT25 99530 77220773
PAT26 118191 68940722
PAT27 103602 77183408
PAT28 161225 102636210
PAT29 15504 3688565
PAT3 171984 95898893
PAT4 153750 106059356
PAT5 184018 85619906
PAT6 156357 93378139
PAT7 152402 81705870
PAT8 104671 119400828
PAT9 143544 89226980
PHG 3416 23721605
PLN1 48046 106127030
PLN10 20464 147535126
PLN11 18492 152306961
PLN12 18274 152591029
PLN13 13330 155170451
PLN14 1263 166194087
PLN15 1045 167464813
PLN16 5 168115057
PLN17 82 167115265
PLN18 63247 68995331
PLN19 78038 76759014
PLN2 1411 165225540
PLN20 74675 77529188
PLN21 16491 124141483
PLN22 52878 114326669
PLN23 76164 78697888
PLN24 103148 57511552
PLN25 41450 75371947
PLN3 1481 165802738
PLN4 19231 144433763
PLN5 75713 79324350
PLN6 74133 76501492
PLN7 40955 53089054
PLN8 28653 84722395
PLN9 12677 133595487
PRI1 29626 121811553
PRI10 1469 182922219
PRI11 1271 178875524
PRI12 1461 178405231
PRI13 1608 179863163
PRI14 1620 182196738
PRI15 1231 192469478
PRI16 1135 194165271
PRI17 1145 193895895
PRI18 37806 128911128
PRI19 66480 83974390
PRI2 1628 172508918
PRI20 28873 105303455
PRI21 2640 179225422
PRI22 2070 182602115
PRI23 1643 183270722
PRI24 2065 182511065
PRI25 2204 180290494
PRI26 11784 161273514
PRI27 12380 159025768
PRI28 55927 86387840
PRI29 33178 63830643
PRI3 1333 184493188
PRI30 16637 139425411
PRI31 40687 127410754
PRI32 74141 80389359
PRI33 31007 57890101
PRI4 1313 184869596
PRI5 1195 181623048
PRI6 1192 179043100
PRI7 1233 181332288
PRI8 1313 175202833
PRI9 1241 175392969
ROD1 10812 166887245
ROD10 975 182154265
ROD11 1030 186610793
ROD12 960 183545752
ROD13 1024 187504897
ROD14 954 181258569
ROD15 964 182163546
ROD16 1035 186307834
ROD17 23664 153318050
ROD18 13435 160635072
ROD19 1163 185608690
ROD2 925 174124404
ROD20 1178 185659573
ROD21 29877 132778430
ROD22 31683 67281232
ROD23 5556 173368549
ROD24 90229 93651118
ROD25 100051 46686798
ROD3 907 173817152
ROD4 905 174095592
ROD5 926 173972238
ROD6 985 181119091
ROD7 971 179736279
ROD8 987 181779730
ROD9 1010 182973926
STS1 82739 35271111
STS10 57923 44595779
STS11 57912 43615295
STS12 65651 42721019
STS13 86618 34268481
STS14 63489 28547756
STS2 85313 48520780
STS3 68499 26956248
STS4 78224 37482332
STS5 54815 32117290
STS6 54828 31989465
STS7 54669 32194056
STS8 55796 36332134
STS9 57855 44563441
SYN 51314 69077963
UNA 211 114018
VRL1 72067 66079823
VRL2 71493 63056989
VRL3 70929 66861677
VRL4 68584 67996002
VRL5 61228 72131788
VRL6 62112 74519912
VRL7 58255 56404550
VRT1 18620 163989832
VRT10 11619 177031363
VRT11 7872 180039184
VRT12 29151 147988517
VRT13 81387 68942064
VRT2 58503 106626532
VRT3 15205 164843314
VRT4 70596 82940878
VRT5 49964 65335138
VRT6 16467 137780719
VRT7 1235 191506964
VRT8 1290 191180295
VRT9 8913 179224438
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 160.0 (excluding chloroplast
and mitochondrial sequences, metagenomic sequences, and Whole Genome Shotgun
sequences):
Entries Bases Species
11103627 12649896894 Homo sapiens
6900531 8191906517 Mus musculus
1268979 5748815391 Rattus norvegicus
1856645 3693385829 Bos taurus
2837151 3315419379 Zea mays
1550369 2746510155 Danio rerio
1170719 1514103647 Oryza sativa (japonica cultivar-group)
1286174 1424141849 Sus scrofa
227652 1352195825 Strongylocentrotus purpuratus
1401024 1125373076 Xenopus tropicalis
211999 934298402 Pan troglodytes
719188 889539202 Drosophila melanogaster
1949245 879228118 Arabidopsis thaliana
802323 855887010 Gallus gallus
497528 810255328 Vitis vinifera
75710 688075766 Macaca mulatta
1220121 685124541 Canis lupus familiaris
1006205 657600968 Sorghum bicolor
1101600 647624511 Triticum aestivum
401462 514485883 Medicago truncatula
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files, CON-division sequence files, and the
lists of new, changed, and deleted accession numbers, each of the files of a
GenBank release begins with the same header, except for the first line, which
contains the file name, and the sixth line, which contains the title of
the file. The first line of the file contains the file name in character
positions 1 to 9 and the full database name (Genetic Sequence Data Bank,
aka 'GenBank') starting in column 22. The brief names of the files in this
release are listed in section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 June 2007
NCBI-GenBank Flat File Release 160.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 160.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Manzour Hazbon, Anjanette Johnston, Mark Landree,
Richard McVeigh, Leonie Misquitta, Ilene Mizrachi, DeAnne Olsen Cravaritis,
Chris O'Sullivan, Leigh Riley, Gert Roosen, Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko
Database Administration
Slava Khotomliansky, Joe Pepersack, Ben Slade
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
