Release Notes For GenBank Release 162
GBREL.TXT Genetic Sequence Data Bank
October 15 2007
NCBI-GenBank Flat File Release 162.0
Distribution Release Notes
77632813 loci, 81563399765 bases, from 77632813 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 162.0
1.2 Cutoff Date
1.3 Important Changes in Release 162.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 162.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 162.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 162.0, incorporates data available to the collaborating
databases as of October 19, 2007 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 162.0
1.3.1 Sequences moved from SYN division to GSS division
Due to a timing problem in the deployment of a software change,
264,607 GSS (Genome Survey Sequence) sequences were mistakenly
included in the SYN-division sequence files for GenBank Release 161.0 .
The GSS sequences involved are labelled with a /transgenic qualifier
on their source features (see EF711103 for an example). The presence
of that qualifier normally indicates that the SYN division is the most
appropriate place for a record. But this is not the case for GSS records.
Although a software change was made to accomodate transgenic GSS
records on July 2, the flatfiles had already been generated and stored
in the database that is used to build GenBank releases. Hence they
were dumped to the SYN-division files for August's Release 161.0.
We have resolved this problem for Release 162.0, and as a result,
the number of SYN-division sequence files has decreased from five
back to two. All the records involved are now in the GSS-division
sequence files.
Our thanks to the informatics group at The Jackson Laboratory for
reporting this problem.
1.3.2 CON division organizational changes
As mentioned in the release notes for GenBank 161.0, procedures
for processing the ASN.1 version of CON ('constructed') division
records have been updated such that a much larger number (119) of
smaller (approximately 260MB) gbcon*.aso files are now generated.
This change parallels a similar change which was made for the
processing of CON division flatfiles (gbcon*.seq) for Release 161.0.
For further details, please see the GenBank 161.0 release notes:
ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb161.release.notes
1.3.3 Organizational changes
The total number of sequence data files increased by 25 with this release:
- the BCT division is now comprised of 25 files (+1)
- the CON division is now comprised of 83 files (+1)
- the ENV division is now comprised of 7 files (+1)
- the EST division is now comprised of 649 files (+14)
- the GSS division is now comprised of 269 files (+5)
- the HTG division is now comprised of 102 files (+4)
- the MAM division is now comprised of 4 files (+1)
- the PAT division is now comprised of 31 files (+1)
- the SYN division is now comprised of 2 files (-3) (See Section 1.3.1)
The total number of index files increased by 1 with this release:
- the AUT (Author Name) index is now comprised of 48 files (+1)
1.3.4 Structured /specimen_voucher qualifiers
As of October 2007, the content of the /specimen_voucher qualifier can
support a structured value consisting of an institution code, a collection
code, and a specimen identifier, as well as the existing unstructured values.
Here is the new definition of the qualifier:
Qualifier /specimen_voucher=
Definition identifier for the specimen from which the nucleic acid
sequenced was obtained
Value format /specimen_voucher="[<institution-code>:[<collection-code>:]]<specimen_id>"
Example /specimen_voucher="UAM:Mamm:52179"
/specimen_voucher="AMCC:101706"
/specimen_voucher="USNM:field series 8798"
/specimen_voucher="personal collection:Dan Janzen:99-SRNP-2003"
/specimen_voucher="99-SRNP-2003"
Comment the /specimen_voucher qualifier is intended to annotate a
reference to the physical specimen that remains after the
sequence has been obtained;
if the specimen was destroyed in the process of sequencing,
electronic images (e-vouchers) are an adequate substitute for a
physical voucher specimen; ideally the specimens will be
deposited in a curated museum, herbarium, or frozen tissue
collection, but often they will remain in a personal or
laboratory collection for some time before they are deposited in
a curated collection;
there are three forms of specimen_voucher qualifiers; if the
text of the qualifier includes one or more colons it is a
'structured voucher'; structured vouchers include
institution-codes (and optional collection-codes) taken from a
controlled vocabulary that denotes the museum or herbarium
collection where the specimen resides;
1.3.5 /operon qualifiers for protein_bind features
Due to an oversight, the /operon qualifier was not listed as a legal
qualifier for the protein_bind feature. This has been corrected as of
October 2007, with an update to the Feature Table document which includes
the qualifier among those that are legal for protein_bind.
1.3.6 Alignment as EVIDENCE_BASIS for the /inference qualifier
Several algorithms exist which allow mRNAs to be aligned to genomic
sequence, taking into account introns and splice signals. In order to
document the use of such algorithms for the structured /inference
qualifier, a new class of EVIDENCE_BASIS will be introduced:
alignment
This addition to the controlled vocabulary of the /inference qualifier
is legal as of this October 2007 release.
1.3.7 New ncRNA feature
A variety of new types of RNA features have been introduced in
recent years. snRNA, snoRNA, and scRNA are some examples.
Because the number of non-coding RNA families is quite likely to
continue to expand, a new ncRNA feature has been created, so that
they can be accomodated more flexibly.
This new feature utilizes a new qualifier called /ncRNA_class,
with a controlled vocabulary to indicate what type of non-coding
RNA is being represented.
Here are the definitions of the ncRNA feature and /ncRNA_class :
Feature Key ncRNA
Definition a non-protein-coding gene, other than ribosomal RNA and
transfer RNA, the functional molecule of which is the RNA
transcript;
Mandatory qualifiers /ncRNA_class="TYPE"
Optional qualifiers /allele="text"
/citation=[number]
/db_xref="<database>:<identifier>"
/experiment="text"
/function="text"
/gene="text"
/inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
/label=feature_label
/locus_tag="text" (single token)
/map="text"
/note="text"
/old_locus_tag="text" (single token)
/product="text"
/pseudo
/standard_name="text"
/trans_splicing
/operon="text"
Comment the ncRNA feature is not used for ribosomal and transfer
RNA annotation, for which the rRNA and tRNA feature keys
should be used, respectively;
Qualifier /ncRNA_class=
Definition a structured description of the classification of the
non-coding RNA described by the ncRNA parent key
Value format "TYPE"
Example /ncRNA_class="miRNA"
/ncRNA_class="siRNA"
/ncRNA_class="scRNA"
Comment TYPE is a term taken from the INSDC controlled vocabulary for ncRNA
classes; on 15-Oct-2007, the following terms were valid:
"antisense_RNA"
"autocatalytically_spliced_intron"
"hammerhead_ribozyme"
"RNase_P_RNA"
"RNase_MRP_RNA"
"telomerase_RNA"
"guide_RNA"
"rasiRNA"
"scRNA"
"siRNA"
"miRNA"
"piRNA"
"snoRNA"
"snRNA"
"SRP_RNA"
"vault_RNA"
"Y_RNA"
"other"
ncRNA classes not yet in the INSDC /ncRNA_class controlled
vocabulary can be annotated by entering
'/ncRNA_class="other"' with '/note="[brief explanation of
novel ncRNA_class]"';
1.3.8 /organism no longer to be used for misc_recomb
The /organism qualifier had been legal for misc_recomb
features. But a review of the existing cases in the database
indicated that all could be better annotated through the use
of multiple source features.
That work was completed in October 2007, and at this point
the /organism qualifier is no longer allowed for the misc_recomb
feature key.
1.3.9 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.10 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped from the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
forty-eight of the GSS flatfiles in Release 162.0. Consider gbgss222.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
October 15 2007
NCBI-GenBank Flat File Release 162.0
GSS Sequences (Part 1)
86842 loci, 64244408 bases, from 86842 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "222" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 New /culture_collection and /bio_material qualifiers
As of the December 2007 GenBank release, new qualifiers /culture_collection
and /bio_material qualifiers will be legal for the source feature. These
qualifiers will utilize the same format as /speciment_voucher (see Section
1.4.1 of these release notes). Their preliminary definitions are:
Qualifier /culture_collection=
Definition institution code and identifier for the culture from which the
nucleic acid sequenced was obtained, with optional collection
code.
Value format "<institution-code>:[<collection-code>:]<culture_id>"
Example /culture_collection="ATCC:26370"
Comment the /culture_collection qualifier should be used to annotate
live microbial and viral cultures, and cell lines that have been
deposited in curated culture collections; microbial cultures in
personal or laboratory collections should be annotated in strain
qualifiers;
annotation with a culture_collection qualifier implies that the
sequence was obtained from a sample retrieved (by the submitter
or a collaborator) from the indicated culture collection, or
that the sequence was obtained from a sample that was deposited
(by the submitter or a collaborator) in the indicated culture
collection; annotation with more than one culture_collection
qualifier indicates that the sequence was obtained from a sample
that was deposited (by the submitter or a collaborator) in more
than one culture collection.
culture_id and institution_code are mandatory, collection_code
is optional;
the /culture_collection qualifier becomes legal on 15-Dec-2007;
Qualifier /bio_material=
Definition identifier for the biological material from which the nucleic
acid sequenced was obtained, with optional institution code and
collection code for the place where it is currently stored.
Value format "[<institution-code>:[<collection-code>:]]<material_id>"
Example /bio_material="CGC:CB3912" <- Caenorhabditis stock centre
Comment the bio_material qualifier should be used to annotate the
identifiers of material in biological collections that are not
appropriate to annotate as either /specimen_voucher or
/culture_collection; these include zoos and aquaria, stock
centres, seed banks, germplasm repositories and DNA banks;
material_id is mandatory, institution_code and collection_code
are optional; institution code is mandatory where collection
code is present;
the /bio_material qualifier becomes legal on 15-Dec-2007;
1.4.2 New tmRNA feature and /peptide_tag qualifier
To support the annotation of a class of RNAs that have dual
tRNA-like and mRNA-like behaviors, a new tmRNA feature will be
legal for the Feature Table as of December 2007. The "tmRNA Website"
at Indiana University provides some background information about
the unusual biology of tmRNAs :
http://www.indiana.edu/~tmrna/
Here is the definition of the new tmRNA feature:
Feature Key tmRNA
Definition transfer messenger RNA; tmRNA acts as a tRNA first,
and then as an mRNA that encodes a peptide tag; the
ribosome translates this mRNA region of tmRNA and attaches
the encoded peptide tag to the C-terminus of the
unfinished protein; this attached tag targets the protein for
destruction or proteolysis;
Optional qualifiers /allele="text"
/citation=[number]
/db_xref="<database>:<identifier>"
/experiment="text"
/function="text"
/gene="text"
/inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
/label=feature_label
/locus_tag="text" (single token)
/map="text"
/note="text"
/old_locus_tag="text" (single token)
/product="text"
/pseudo
/standard_name="text"
/tag_peptide=<base_range>
Comment the tmRNA feature key will become valid on 15-Dec-2007
To indicate the nucleotide region encoding the proteolysis tag
peptide, a new /tag_peptide qualifier will be introduced for
use with the tmRNA feature. The definition of /tag_peptide is:
Qualifier /tag_peptide=
Definition base location encoding the polypeptide for proteolysis tag of
tmRNA and its termination codon;
Value format <base_range>
Example /tag_peptide=90..122
Comment it is recommended that the amino acid sequence corresponding
to the /tag_peptide be annotated by describing a 5' partial
CDS feature; e.g. CDS <90..122;
the /tag_peptide qualifier (and tmRNA feature) will become
valid on 15-Dec-2007
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1386 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut5.idx - Index of the entries according to author name, part 5.
48. gbaut6.idx - Index of the entries according to author name, part 6.
49. gbaut7.idx - Index of the entries according to author name, part 7.
50. gbaut8.idx - Index of the entries according to author name, part 8.
51. gbaut9.idx - Index of the entries according to author name, part 9.
52. gbbct1.seq - Bacterial sequence entries, part 1.
53. gbbct10.seq - Bacterial sequence entries, part 10.
54. gbbct11.seq - Bacterial sequence entries, part 11.
55. gbbct12.seq - Bacterial sequence entries, part 12.
56. gbbct13.seq - Bacterial sequence entries, part 13.
57. gbbct14.seq - Bacterial sequence entries, part 14.
58. gbbct15.seq - Bacterial sequence entries, part 15.
59. gbbct16.seq - Bacterial sequence entries, part 16.
60. gbbct17.seq - Bacterial sequence entries, part 17.
61. gbbct18.seq - Bacterial sequence entries, part 18.
62. gbbct19.seq - Bacterial sequence entries, part 19.
63. gbbct2.seq - Bacterial sequence entries, part 2.
64. gbbct20.seq - Bacterial sequence entries, part 20.
65. gbbct21.seq - Bacterial sequence entries, part 21.
66. gbbct22.seq - Bacterial sequence entries, part 22.
67. gbbct23.seq - Bacterial sequence entries, part 23.
68. gbbct24.seq - Bacterial sequence entries, part 24.
69. gbbct25.seq - Bacterial sequence entries, part 25.
70. gbbct3.seq - Bacterial sequence entries, part 3.
71. gbbct4.seq - Bacterial sequence entries, part 4.
72. gbbct5.seq - Bacterial sequence entries, part 5.
73. gbbct6.seq - Bacterial sequence entries, part 6.
74. gbbct7.seq - Bacterial sequence entries, part 7.
75. gbbct8.seq - Bacterial sequence entries, part 8.
76. gbbct9.seq - Bacterial sequence entries, part 9.
77. gbchg.txt - Accession numbers of entries updated since the previous release.
78. gbcon1.seq - Constructed sequence entries, part 1.
79. gbcon10.seq - Constructed sequence entries, part 10.
80. gbcon11.seq - Constructed sequence entries, part 11.
81. gbcon12.seq - Constructed sequence entries, part 12.
82. gbcon13.seq - Constructed sequence entries, part 13.
83. gbcon14.seq - Constructed sequence entries, part 14.
84. gbcon15.seq - Constructed sequence entries, part 15.
85. gbcon16.seq - Constructed sequence entries, part 16.
86. gbcon17.seq - Constructed sequence entries, part 17.
87. gbcon18.seq - Constructed sequence entries, part 18.
88. gbcon19.seq - Constructed sequence entries, part 19.
89. gbcon2.seq - Constructed sequence entries, part 2.
90. gbcon20.seq - Constructed sequence entries, part 20.
91. gbcon21.seq - Constructed sequence entries, part 21.
92. gbcon22.seq - Constructed sequence entries, part 22.
93. gbcon23.seq - Constructed sequence entries, part 23.
94. gbcon24.seq - Constructed sequence entries, part 24.
95. gbcon25.seq - Constructed sequence entries, part 25.
96. gbcon26.seq - Constructed sequence entries, part 26.
97. gbcon27.seq - Constructed sequence entries, part 27.
98. gbcon28.seq - Constructed sequence entries, part 28.
99. gbcon29.seq - Constructed sequence entries, part 29.
100. gbcon3.seq - Constructed sequence entries, part 3.
101. gbcon30.seq - Constructed sequence entries, part 30.
102. gbcon31.seq - Constructed sequence entries, part 31.
103. gbcon32.seq - Constructed sequence entries, part 32.
104. gbcon33.seq - Constructed sequence entries, part 33.
105. gbcon34.seq - Constructed sequence entries, part 34.
106. gbcon35.seq - Constructed sequence entries, part 35.
107. gbcon36.seq - Constructed sequence entries, part 36.
108. gbcon37.seq - Constructed sequence entries, part 37.
109. gbcon38.seq - Constructed sequence entries, part 38.
110. gbcon39.seq - Constructed sequence entries, part 39.
111. gbcon4.seq - Constructed sequence entries, part 4.
112. gbcon40.seq - Constructed sequence entries, part 40.
113. gbcon41.seq - Constructed sequence entries, part 41.
114. gbcon42.seq - Constructed sequence entries, part 42.
115. gbcon43.seq - Constructed sequence entries, part 43.
116. gbcon44.seq - Constructed sequence entries, part 44.
117. gbcon45.seq - Constructed sequence entries, part 45.
118. gbcon46.seq - Constructed sequence entries, part 46.
119. gbcon47.seq - Constructed sequence entries, part 47.
120. gbcon48.seq - Constructed sequence entries, part 48.
121. gbcon49.seq - Constructed sequence entries, part 49.
122. gbcon5.seq - Constructed sequence entries, part 5.
123. gbcon50.seq - Constructed sequence entries, part 50.
124. gbcon51.seq - Constructed sequence entries, part 51.
125. gbcon52.seq - Constructed sequence entries, part 52.
126. gbcon53.seq - Constructed sequence entries, part 53.
127. gbcon54.seq - Constructed sequence entries, part 54.
128. gbcon55.seq - Constructed sequence entries, part 55.
129. gbcon56.seq - Constructed sequence entries, part 56.
130. gbcon57.seq - Constructed sequence entries, part 57.
131. gbcon58.seq - Constructed sequence entries, part 58.
132. gbcon59.seq - Constructed sequence entries, part 59.
133. gbcon6.seq - Constructed sequence entries, part 6.
134. gbcon60.seq - Constructed sequence entries, part 60.
135. gbcon61.seq - Constructed sequence entries, part 61.
136. gbcon62.seq - Constructed sequence entries, part 62.
137. gbcon63.seq - Constructed sequence entries, part 63.
138. gbcon64.seq - Constructed sequence entries, part 64.
139. gbcon65.seq - Constructed sequence entries, part 65.
140. gbcon66.seq - Constructed sequence entries, part 66.
141. gbcon67.seq - Constructed sequence entries, part 67.
142. gbcon68.seq - Constructed sequence entries, part 68.
143. gbcon69.seq - Constructed sequence entries, part 69.
144. gbcon7.seq - Constructed sequence entries, part 7.
145. gbcon70.seq - Constructed sequence entries, part 70.
146. gbcon71.seq - Constructed sequence entries, part 71.
147. gbcon72.seq - Constructed sequence entries, part 72.
148. gbcon73.seq - Constructed sequence entries, part 73.
149. gbcon74.seq - Constructed sequence entries, part 74.
150. gbcon75.seq - Constructed sequence entries, part 75.
151. gbcon76.seq - Constructed sequence entries, part 76.
152. gbcon77.seq - Constructed sequence entries, part 77.
153. gbcon78.seq - Constructed sequence entries, part 78.
154. gbcon79.seq - Constructed sequence entries, part 79.
155. gbcon8.seq - Constructed sequence entries, part 8.
156. gbcon80.seq - Constructed sequence entries, part 80.
157. gbcon81.seq - Constructed sequence entries, part 81.
158. gbcon82.seq - Constructed sequence entries, part 82.
159. gbcon83.seq - Constructed sequence entries, part 83.
160. gbcon9.seq - Constructed sequence entries, part 9.
161. gbdel.txt - Accession numbers of entries deleted since the previous release.
162. gbenv1.seq - Environmental sampling sequence entries, part 1.
163. gbenv2.seq - Environmental sampling sequence entries, part 2.
164. gbenv3.seq - Environmental sampling sequence entries, part 3.
165. gbenv4.seq - Environmental sampling sequence entries, part 4.
166. gbenv5.seq - Environmental sampling sequence entries, part 5.
167. gbenv6.seq - Environmental sampling sequence entries, part 6.
168. gbenv7.seq - Environmental sampling sequence entries, part 7.
169. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
170. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
171. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
172. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
173. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
174. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
175. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
176. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
177. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
178. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
179. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
180. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
181. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
182. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
183. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
184. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
185. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
186. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
187. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
188. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
189. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
190. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
191. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
192. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
193. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
194. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
195. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
196. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
197. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
198. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
199. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
200. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
201. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
202. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
203. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
204. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
205. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
206. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
207. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
208. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
209. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
210. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
211. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
212. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
213. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
214. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
215. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
216. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
217. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
218. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
219. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
220. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
221. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
222. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
223. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
224. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
225. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
226. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
227. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
228. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
229. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
230. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
231. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
232. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
233. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
234. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
235. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
236. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
237. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
238. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
239. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
240. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
241. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
242. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
243. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
244. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
245. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
246. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
247. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
248. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
249. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
250. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
251. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
252. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
253. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
254. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
255. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
256. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
257. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
258. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
259. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
260. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
261. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
262. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
263. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
264. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
265. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
266. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
267. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
268. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
269. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
270. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
271. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
272. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
273. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
274. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
275. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
276. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
277. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
278. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
279. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
280. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
281. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
282. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
283. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
284. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
285. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
286. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
287. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
288. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
289. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
290. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
291. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
292. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
293. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
294. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
295. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
296. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
297. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
298. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
299. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
300. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
301. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
302. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
303. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
304. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
305. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
306. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
307. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
308. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
309. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
310. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
311. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
312. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
313. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
314. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
315. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
316. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
317. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
318. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
319. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
320. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
321. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
322. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
323. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
324. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
325. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
326. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
327. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
328. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
329. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
330. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
331. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
332. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
333. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
334. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
335. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
336. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
337. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
338. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
339. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
340. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
341. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
342. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
343. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
344. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
345. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
346. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
347. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
348. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
349. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
350. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
351. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
352. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
353. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
354. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
355. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
356. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
357. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
358. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
359. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
360. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
361. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
362. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
363. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
364. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
365. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
366. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
367. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
368. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
369. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
370. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
371. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
372. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
373. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
374. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
375. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
376. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
377. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
378. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
379. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
380. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
381. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
382. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
383. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
384. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
385. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
386. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
387. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
388. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
389. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
390. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
391. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
392. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
393. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
394. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
395. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
396. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
397. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
398. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
399. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
400. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
401. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
402. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
403. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
404. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
405. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
406. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
407. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
408. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
409. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
410. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
411. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
412. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
413. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
414. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
415. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
416. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
417. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
418. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
419. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
420. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
421. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
422. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
423. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
424. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
425. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
426. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
427. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
428. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
429. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
430. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
431. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
432. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
433. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
434. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
435. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
436. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
437. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
438. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
439. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
440. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
441. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
442. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
443. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
444. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
445. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
446. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
447. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
448. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
449. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
450. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
451. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
452. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
453. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
454. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
455. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
456. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
457. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
458. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
459. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
460. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
461. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
462. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
463. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
464. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
465. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
466. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
467. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
468. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
469. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
470. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
471. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
472. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
473. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
474. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
475. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
476. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
477. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
478. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
479. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
480. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
481. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
482. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
483. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
484. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
485. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
486. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
487. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
488. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
489. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
490. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
491. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
492. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
493. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
494. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
495. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
496. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
497. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
498. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
499. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
500. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
501. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
502. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
503. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
504. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
505. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
506. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
507. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
508. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
509. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
510. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
511. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
512. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
513. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
514. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
515. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
516. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
517. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
518. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
519. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
520. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
521. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
522. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
523. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
524. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
525. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
526. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
527. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
528. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
529. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
530. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
531. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
532. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
533. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
534. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
535. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
536. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
537. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
538. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
539. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
540. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
541. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
542. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
543. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
544. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
545. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
546. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
547. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
548. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
549. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
550. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
551. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
552. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
553. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
554. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
555. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
556. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
557. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
558. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
559. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
560. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
561. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
562. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
563. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
564. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
565. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
566. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
567. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
568. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
569. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
570. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
571. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
572. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
573. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
574. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
575. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
576. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
577. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
578. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
579. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
580. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
581. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
582. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
583. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
584. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
585. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
586. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
587. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
588. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
589. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
590. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
591. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
592. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
593. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
594. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
595. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
596. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
597. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
598. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
599. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
600. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
601. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
602. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
603. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
604. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
605. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
606. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
607. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
608. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
609. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
610. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
611. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
612. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
613. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
614. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
615. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
616. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
617. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
618. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
619. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
620. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
621. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
622. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
623. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
624. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
625. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
626. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
627. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
628. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
629. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
630. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
631. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
632. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
633. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
634. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
635. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
636. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
637. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
638. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
639. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
640. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
641. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
642. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
643. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
644. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
645. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
646. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
647. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
648. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
649. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
650. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
651. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
652. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
653. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
654. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
655. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
656. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
657. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
658. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
659. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
660. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
661. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
662. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
663. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
664. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
665. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
666. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
667. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
668. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
669. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
670. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
671. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
672. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
673. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
674. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
675. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
676. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
677. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
678. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
679. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
680. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
681. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
682. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
683. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
684. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
685. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
686. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
687. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
688. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
689. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
690. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
691. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
692. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
693. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
694. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
695. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
696. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
697. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
698. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
699. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
700. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
701. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
702. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
703. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
704. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
705. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
706. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
707. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
708. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
709. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
710. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
711. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
712. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
713. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
714. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
715. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
716. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
717. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
718. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
719. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
720. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
721. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
722. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
723. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
724. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
725. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
726. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
727. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
728. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
729. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
730. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
731. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
732. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
733. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
734. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
735. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
736. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
737. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
738. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
739. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
740. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
741. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
742. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
743. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
744. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
745. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
746. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
747. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
748. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
749. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
750. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
751. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
752. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
753. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
754. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
755. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
756. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
757. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
758. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
759. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
760. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
761. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
762. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
763. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
764. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
765. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
766. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
767. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
768. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
769. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
770. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
771. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
772. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
773. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
774. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
775. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
776. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
777. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
778. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
779. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
780. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
781. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
782. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
783. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
784. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
785. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
786. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
787. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
788. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
789. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
790. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
791. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
792. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
793. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
794. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
795. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
796. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
797. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
798. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
799. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
800. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
801. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
802. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
803. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
804. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
805. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
806. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
807. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
808. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
809. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
810. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
811. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
812. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
813. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
814. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
815. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
816. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
817. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
818. gbgen.idx - Index of the entries according to gene symbols.
819. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
820. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
821. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
822. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
823. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
824. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
825. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
826. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
827. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
828. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
829. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
830. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
831. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
832. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
833. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
834. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
835. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
836. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
837. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
838. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
839. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
840. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
841. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
842. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
843. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
844. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
845. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
846. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
847. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
848. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
849. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
850. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
851. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
852. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
853. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
854. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
855. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
856. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
857. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
858. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
859. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
860. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
861. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
862. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
863. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
864. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
865. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
866. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
867. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
868. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
869. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
870. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
871. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
872. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
873. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
874. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
875. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
876. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
877. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
878. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
879. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
880. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
881. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
882. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
883. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
884. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
885. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
886. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
887. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
888. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
889. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
890. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
891. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
892. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
893. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
894. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
895. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
896. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
897. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
898. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
899. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
900. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
901. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
902. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
903. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
904. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
905. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
906. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
907. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
908. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
909. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
910. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
911. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
912. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
913. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
914. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
915. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
916. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
917. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
918. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
919. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
920. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
921. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
922. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
923. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
924. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
925. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
926. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
927. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
928. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
929. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
930. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
931. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
932. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
933. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
934. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
935. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
936. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
937. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
938. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
939. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
940. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
941. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
942. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
943. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
944. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
945. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
946. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
947. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
948. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
949. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
950. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
951. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
952. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
953. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
954. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
955. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
956. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
957. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
958. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
959. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
960. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
961. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
962. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
963. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
964. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
965. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
966. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
967. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
968. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
969. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
970. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
971. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
972. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
973. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
974. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
975. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
976. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
977. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
978. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
979. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
980. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
981. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
982. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
983. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
984. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
985. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
986. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
987. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
988. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
989. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
990. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
991. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
992. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
993. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
994. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
995. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
996. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
997. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
998. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
999. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1000. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1001. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1002. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1003. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1004. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1005. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1006. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1007. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1008. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1009. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1010. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1011. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1012. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1013. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1014. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1015. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1016. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1017. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1018. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1019. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1020. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1021. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1022. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1023. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1024. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1025. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1026. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1027. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1028. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1029. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1030. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1031. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1032. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1033. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1034. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1035. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1036. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1037. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1038. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1039. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1040. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1041. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1042. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1043. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1044. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1045. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1046. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1047. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1048. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1049. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1050. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1051. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1052. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1053. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1054. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1055. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1056. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1057. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1058. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1059. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1060. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1061. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1062. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1063. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1064. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1065. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1066. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1067. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1068. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1069. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1070. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1071. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1072. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1073. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1074. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1075. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1076. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1077. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1078. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1079. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1080. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1081. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1082. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1083. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1084. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1085. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1086. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1087. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1088. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1089. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1090. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1091. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1092. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1093. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1094. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1095. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1096. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1097. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1098. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1099. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1100. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1101. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1102. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1103. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1104. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1105. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1106. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1107. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1108. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1109. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1110. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1111. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1112. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1113. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1114. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1115. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1116. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1117. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1118. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1119. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1120. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1121. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1122. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1123. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1124. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1125. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1126. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1127. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1128. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1129. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1130. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1131. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1132. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1133. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1134. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1135. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1136. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1137. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1138. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1139. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1140. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1141. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1142. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1143. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1144. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1145. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1146. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1147. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1148. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1149. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1150. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1151. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1152. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1153. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1154. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1155. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1156. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1157. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1158. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1159. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1160. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1161. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1162. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1163. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1164. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1165. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1166. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1167. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1168. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1169. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1170. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1171. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1172. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1173. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1174. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1175. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1176. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1177. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1178. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1179. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1180. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1181. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1182. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1183. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1184. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1185. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1186. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1187. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1188. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1189. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1190. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1191. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1192. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1193. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1194. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1195. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1196. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1197. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1198. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1199. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1200. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1201. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1202. gbinv1.seq - Invertebrate sequence entries, part 1.
1203. gbinv10.seq - Invertebrate sequence entries, part 10.
1204. gbinv11.seq - Invertebrate sequence entries, part 11.
1205. gbinv2.seq - Invertebrate sequence entries, part 2.
1206. gbinv3.seq - Invertebrate sequence entries, part 3.
1207. gbinv4.seq - Invertebrate sequence entries, part 4.
1208. gbinv5.seq - Invertebrate sequence entries, part 5.
1209. gbinv6.seq - Invertebrate sequence entries, part 6.
1210. gbinv7.seq - Invertebrate sequence entries, part 7.
1211. gbinv8.seq - Invertebrate sequence entries, part 8.
1212. gbinv9.seq - Invertebrate sequence entries, part 9.
1213. gbjou1.idx - Index of the entries according to journal citation, part 1.
1214. gbjou2.idx - Index of the entries according to journal citation, part 2.
1215. gbjou3.idx - Index of the entries according to journal citation, part 3.
1216. gbjou4.idx - Index of the entries according to journal citation, part 4.
1217. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1218. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1219. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1220. gbmam1.seq - Other mammalian sequence entries, part 1.
1221. gbmam2.seq - Other mammalian sequence entries, part 2.
1222. gbmam3.seq - Other mammalian sequence entries, part 3.
1223. gbmam4.seq - Other mammalian sequence entries, part 4.
1224. gbnew.txt - Accession numbers of entries new since the previous release.
1225. gbpat1.seq - Patent sequence entries, part 1.
1226. gbpat10.seq - Patent sequence entries, part 10.
1227. gbpat11.seq - Patent sequence entries, part 11.
1228. gbpat12.seq - Patent sequence entries, part 12.
1229. gbpat13.seq - Patent sequence entries, part 13.
1230. gbpat14.seq - Patent sequence entries, part 14.
1231. gbpat15.seq - Patent sequence entries, part 15.
1232. gbpat16.seq - Patent sequence entries, part 16.
1233. gbpat17.seq - Patent sequence entries, part 17.
1234. gbpat18.seq - Patent sequence entries, part 18.
1235. gbpat19.seq - Patent sequence entries, part 19.
1236. gbpat2.seq - Patent sequence entries, part 2.
1237. gbpat20.seq - Patent sequence entries, part 20.
1238. gbpat21.seq - Patent sequence entries, part 21.
1239. gbpat22.seq - Patent sequence entries, part 22.
1240. gbpat23.seq - Patent sequence entries, part 23.
1241. gbpat24.seq - Patent sequence entries, part 24.
1242. gbpat25.seq - Patent sequence entries, part 25.
1243. gbpat26.seq - Patent sequence entries, part 26.
1244. gbpat27.seq - Patent sequence entries, part 27.
1245. gbpat28.seq - Patent sequence entries, part 28.
1246. gbpat29.seq - Patent sequence entries, part 29.
1247. gbpat3.seq - Patent sequence entries, part 3.
1248. gbpat30.seq - Patent sequence entries, part 30.
1249. gbpat31.seq - Patent sequence entries, part 31.
1250. gbpat4.seq - Patent sequence entries, part 4.
1251. gbpat5.seq - Patent sequence entries, part 5.
1252. gbpat6.seq - Patent sequence entries, part 6.
1253. gbpat7.seq - Patent sequence entries, part 7.
1254. gbpat8.seq - Patent sequence entries, part 8.
1255. gbpat9.seq - Patent sequence entries, part 9.
1256. gbphg.seq - Phage sequence entries.
1257. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1258. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1259. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1260. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1261. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1262. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1263. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1264. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1265. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1266. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1267. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1268. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1269. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1270. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1271. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1272. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1273. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1274. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1275. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1276. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1277. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1278. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1279. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1280. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1281. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1282. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1283. gbpri1.seq - Primate sequence entries, part 1.
1284. gbpri10.seq - Primate sequence entries, part 10.
1285. gbpri11.seq - Primate sequence entries, part 11.
1286. gbpri12.seq - Primate sequence entries, part 12.
1287. gbpri13.seq - Primate sequence entries, part 13.
1288. gbpri14.seq - Primate sequence entries, part 14.
1289. gbpri15.seq - Primate sequence entries, part 15.
1290. gbpri16.seq - Primate sequence entries, part 16.
1291. gbpri17.seq - Primate sequence entries, part 17.
1292. gbpri18.seq - Primate sequence entries, part 18.
1293. gbpri19.seq - Primate sequence entries, part 19.
1294. gbpri2.seq - Primate sequence entries, part 2.
1295. gbpri20.seq - Primate sequence entries, part 20.
1296. gbpri21.seq - Primate sequence entries, part 21.
1297. gbpri22.seq - Primate sequence entries, part 22.
1298. gbpri23.seq - Primate sequence entries, part 23.
1299. gbpri24.seq - Primate sequence entries, part 24.
1300. gbpri25.seq - Primate sequence entries, part 25.
1301. gbpri26.seq - Primate sequence entries, part 26.
1302. gbpri27.seq - Primate sequence entries, part 27.
1303. gbpri28.seq - Primate sequence entries, part 28.
1304. gbpri29.seq - Primate sequence entries, part 29.
1305. gbpri3.seq - Primate sequence entries, part 3.
1306. gbpri30.seq - Primate sequence entries, part 30.
1307. gbpri31.seq - Primate sequence entries, part 31.
1308. gbpri32.seq - Primate sequence entries, part 32.
1309. gbpri33.seq - Primate sequence entries, part 33.
1310. gbpri34.seq - Primate sequence entries, part 34.
1311. gbpri4.seq - Primate sequence entries, part 4.
1312. gbpri5.seq - Primate sequence entries, part 5.
1313. gbpri6.seq - Primate sequence entries, part 6.
1314. gbpri7.seq - Primate sequence entries, part 7.
1315. gbpri8.seq - Primate sequence entries, part 8.
1316. gbpri9.seq - Primate sequence entries, part 9.
1317. gbrel.txt - Release notes (this document).
1318. gbrod1.seq - Rodent sequence entries, part 1.
1319. gbrod10.seq - Rodent sequence entries, part 10.
1320. gbrod11.seq - Rodent sequence entries, part 11.
1321. gbrod12.seq - Rodent sequence entries, part 12.
1322. gbrod13.seq - Rodent sequence entries, part 13.
1323. gbrod14.seq - Rodent sequence entries, part 14.
1324. gbrod15.seq - Rodent sequence entries, part 15.
1325. gbrod16.seq - Rodent sequence entries, part 16.
1326. gbrod17.seq - Rodent sequence entries, part 17.
1327. gbrod18.seq - Rodent sequence entries, part 18.
1328. gbrod19.seq - Rodent sequence entries, part 19.
1329. gbrod2.seq - Rodent sequence entries, part 2.
1330. gbrod20.seq - Rodent sequence entries, part 20.
1331. gbrod21.seq - Rodent sequence entries, part 21.
1332. gbrod22.seq - Rodent sequence entries, part 22.
1333. gbrod23.seq - Rodent sequence entries, part 23.
1334. gbrod24.seq - Rodent sequence entries, part 24.
1335. gbrod25.seq - Rodent sequence entries, part 25.
1336. gbrod26.seq - Rodent sequence entries, part 26.
1337. gbrod3.seq - Rodent sequence entries, part 3.
1338. gbrod4.seq - Rodent sequence entries, part 4.
1339. gbrod5.seq - Rodent sequence entries, part 5.
1340. gbrod6.seq - Rodent sequence entries, part 6.
1341. gbrod7.seq - Rodent sequence entries, part 7.
1342. gbrod8.seq - Rodent sequence entries, part 8.
1343. gbrod9.seq - Rodent sequence entries, part 9.
1344. gbsdr1.txt - Short directory of the data bank, part 1.
1345. gbsdr2.txt - Short directory of the data bank, part 2.
1346. gbsdr3.txt - Short directory of the data bank, part 3.
1347. gbsec.idx - Index of the entries according to secondary accession number.
1348. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1349. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1350. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1351. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1352. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1353. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1354. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1355. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1356. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1357. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1358. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1359. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1360. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1361. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1362. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1363. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1364. gbuna.seq - Unannotated sequence entries.
1365. gbvrl1.seq - Viral sequence entries, part 1.
1366. gbvrl2.seq - Viral sequence entries, part 2.
1367. gbvrl3.seq - Viral sequence entries, part 3.
1368. gbvrl4.seq - Viral sequence entries, part 4.
1369. gbvrl5.seq - Viral sequence entries, part 5.
1370. gbvrl6.seq - Viral sequence entries, part 6.
1371. gbvrl7.seq - Viral sequence entries, part 7.
1372. gbvrl8.seq - Viral sequence entries, part 8.
1373. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1374. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1375. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1376. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1377. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1378. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1379. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1380. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1381. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1382. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1383. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1384. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1385. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1386. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 162.0 flatfiles require roughly 305 GB (sequence
files only) or 325 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
608098410 gbacc1.idx
1529890932 gbacc2.idx
553472211 gbacc3.idx
185316620 gbaut1.idx
194263722 gbaut10.idx
250131113 gbaut11.idx
185120979 gbaut12.idx
183729826 gbaut13.idx
185077070 gbaut14.idx
185979662 gbaut15.idx
184352545 gbaut16.idx
183577509 gbaut17.idx
184098448 gbaut18.idx
190492233 gbaut19.idx
185358422 gbaut2.idx
223975571 gbaut20.idx
185491115 gbaut21.idx
184005221 gbaut22.idx
228948743 gbaut23.idx
198072862 gbaut24.idx
202221773 gbaut25.idx
183873564 gbaut26.idx
183658687 gbaut27.idx
237139550 gbaut28.idx
184270263 gbaut29.idx
215187600 gbaut3.idx
185133713 gbaut30.idx
186548610 gbaut31.idx
191757313 gbaut32.idx
184096460 gbaut33.idx
184536371 gbaut34.idx
184132003 gbaut35.idx
183819992 gbaut36.idx
183984365 gbaut37.idx
185218892 gbaut38.idx
202763047 gbaut39.idx
185231205 gbaut4.idx
185440877 gbaut40.idx
200478352 gbaut41.idx
251405982 gbaut42.idx
184168266 gbaut43.idx
183694635 gbaut44.idx
230770649 gbaut45.idx
183773972 gbaut46.idx
251136309 gbaut47.idx
84550229 gbaut48.idx
183618182 gbaut5.idx
189092927 gbaut6.idx
186318901 gbaut7.idx
244586771 gbaut8.idx
241026285 gbaut9.idx
250612071 gbbct1.seq
250546942 gbbct10.seq
252774999 gbbct11.seq
250862396 gbbct12.seq
252288626 gbbct13.seq
255282909 gbbct14.seq
253716331 gbbct15.seq
253525429 gbbct16.seq
259760166 gbbct17.seq
254726574 gbbct18.seq
254491542 gbbct19.seq
252215884 gbbct2.seq
257586609 gbbct20.seq
254787390 gbbct21.seq
267681950 gbbct22.seq
250182925 gbbct23.seq
250004071 gbbct24.seq
65803029 gbbct25.seq
260945998 gbbct3.seq
250000534 gbbct4.seq
250003371 gbbct5.seq
253417404 gbbct6.seq
254138138 gbbct7.seq
250002352 gbbct8.seq
266597750 gbbct9.seq
9551549 gbchg.txt
250616620 gbcon1.seq
250025495 gbcon10.seq
250004273 gbcon11.seq
250001389 gbcon12.seq
250001262 gbcon13.seq
250002821 gbcon14.seq
249689550 gbcon15.seq
249929199 gbcon16.seq
249941067 gbcon17.seq
250004480 gbcon18.seq
250000272 gbcon19.seq
251258493 gbcon2.seq
250004092 gbcon20.seq
250001267 gbcon21.seq
250001930 gbcon22.seq
250001335 gbcon23.seq
250000718 gbcon24.seq
250003687 gbcon25.seq
250002796 gbcon26.seq
250000581 gbcon27.seq
250001799 gbcon28.seq
250001907 gbcon29.seq
250379220 gbcon3.seq
250001098 gbcon30.seq
250001017 gbcon31.seq
250002918 gbcon32.seq
250002969 gbcon33.seq
250004565 gbcon34.seq
250002912 gbcon35.seq
250003337 gbcon36.seq
250000913 gbcon37.seq
250001468 gbcon38.seq
250002785 gbcon39.seq
250001411 gbcon4.seq
250001616 gbcon40.seq
250002452 gbcon41.seq
250000958 gbcon42.seq
250003276 gbcon43.seq
250001402 gbcon44.seq
250001305 gbcon45.seq
250002090 gbcon46.seq
250002618 gbcon47.seq
250003788 gbcon48.seq
250000529 gbcon49.seq
250000611 gbcon5.seq
250003550 gbcon50.seq
250001674 gbcon51.seq
250003976 gbcon52.seq
250001172 gbcon53.seq
250003472 gbcon54.seq
250001874 gbcon55.seq
250003819 gbcon56.seq
250006173 gbcon57.seq
250000869 gbcon58.seq
250003697 gbcon59.seq
250002457 gbcon6.seq
250001356 gbcon60.seq
250003809 gbcon61.seq
250001845 gbcon62.seq
250002937 gbcon63.seq
250003354 gbcon64.seq
250005811 gbcon65.seq
250003580 gbcon66.seq
250000650 gbcon67.seq
250002696 gbcon68.seq
250000564 gbcon69.seq
250002666 gbcon7.seq
250004005 gbcon70.seq
250001204 gbcon71.seq
250001809 gbcon72.seq
250004552 gbcon73.seq
250002912 gbcon74.seq
250004274 gbcon75.seq
250002110 gbcon76.seq
250000354 gbcon77.seq
250002866 gbcon78.seq
250001402 gbcon79.seq
223123817 gbcon8.seq
250002903 gbcon80.seq
250001764 gbcon81.seq
239305086 gbcon82.seq
21163313 gbcon83.seq
250185874 gbcon9.seq
307743 gbdel.txt
250001898 gbenv1.seq
250002579 gbenv2.seq
250002097 gbenv3.seq
250000806 gbenv4.seq
250000297 gbenv5.seq
250001604 gbenv6.seq
129346982 gbenv7.seq
230688948 gbest1.seq
230688888 gbest10.seq
230689896 gbest100.seq
230689655 gbest101.seq
230688327 gbest102.seq
230689396 gbest103.seq
230688332 gbest104.seq
230688015 gbest105.seq
230688266 gbest106.seq
230690026 gbest107.seq
230690762 gbest108.seq
230689436 gbest109.seq
230687810 gbest11.seq
230688893 gbest110.seq
230690458 gbest111.seq
230687933 gbest112.seq
230687798 gbest113.seq
230689686 gbest114.seq
230689614 gbest115.seq
230688936 gbest116.seq
230690494 gbest117.seq
230689489 gbest118.seq
230689408 gbest119.seq
230688314 gbest12.seq
230688701 gbest120.seq
230689363 gbest121.seq
230687491 gbest122.seq
230687831 gbest123.seq
230688586 gbest124.seq
230690898 gbest125.seq
230690443 gbest126.seq
230688826 gbest127.seq
230689078 gbest128.seq
230689869 gbest129.seq
230689562 gbest13.seq
230689598 gbest130.seq
230688726 gbest131.seq
230689628 gbest132.seq
230688185 gbest133.seq
230688600 gbest134.seq
230689084 gbest135.seq
230690483 gbest136.seq
230689142 gbest137.seq
230688238 gbest138.seq
230688451 gbest139.seq
230689037 gbest14.seq
230687965 gbest140.seq
230689001 gbest141.seq
230688980 gbest142.seq
230688154 gbest143.seq
230689258 gbest144.seq
230687766 gbest145.seq
230689552 gbest146.seq
230688473 gbest147.seq
230688132 gbest148.seq
230690071 gbest149.seq
230689056 gbest15.seq
230689440 gbest150.seq
230689155 gbest151.seq
230689618 gbest152.seq
230688071 gbest153.seq
230689655 gbest154.seq
230688980 gbest155.seq
230688115 gbest156.seq
230688694 gbest157.seq
230688131 gbest158.seq
230691123 gbest159.seq
230687506 gbest16.seq
230688256 gbest160.seq
230688051 gbest161.seq
230687464 gbest162.seq
230689643 gbest163.seq
230692032 gbest164.seq
230687824 gbest165.seq
230688536 gbest166.seq
230687719 gbest167.seq
230689581 gbest168.seq
230687868 gbest169.seq
230689942 gbest17.seq
230688516 gbest170.seq
230690052 gbest171.seq
230688625 gbest172.seq
230688080 gbest173.seq
230689470 gbest174.seq
230689058 gbest175.seq
230687599 gbest176.seq
230687691 gbest177.seq
230688934 gbest178.seq
230687610 gbest179.seq
230689143 gbest18.seq
222093431 gbest180.seq
230687961 gbest181.seq
230687739 gbest182.seq
230687619 gbest183.seq
230688776 gbest184.seq
230688383 gbest185.seq
230689609 gbest186.seq
230688049 gbest187.seq
230688216 gbest188.seq
230688009 gbest189.seq
230687626 gbest19.seq
230689223 gbest190.seq
230690019 gbest191.seq
230689528 gbest192.seq
230689854 gbest193.seq
230690154 gbest194.seq
230689264 gbest195.seq
230687670 gbest196.seq
230688229 gbest197.seq
230688316 gbest198.seq
230690304 gbest199.seq
230690014 gbest2.seq
230688433 gbest20.seq
230689842 gbest200.seq
230688764 gbest201.seq
230690061 gbest202.seq
230687580 gbest203.seq
230689820 gbest204.seq
230690382 gbest205.seq
230688961 gbest206.seq
230689520 gbest207.seq
230687776 gbest208.seq
230692017 gbest209.seq
230687848 gbest21.seq
230688533 gbest210.seq
230688783 gbest211.seq
230689262 gbest212.seq
230687583 gbest213.seq
230688365 gbest214.seq
230687941 gbest215.seq
230687445 gbest216.seq
230687991 gbest217.seq
230689877 gbest218.seq
230689193 gbest219.seq
230689284 gbest22.seq
230688143 gbest220.seq
230689704 gbest221.seq
230688820 gbest222.seq
230690427 gbest223.seq
230689294 gbest224.seq
230690250 gbest225.seq
230687620 gbest226.seq
230689473 gbest227.seq
230688857 gbest228.seq
230688037 gbest229.seq
230689178 gbest23.seq
219022729 gbest230.seq
163087948 gbest231.seq
162274219 gbest232.seq
169398444 gbest233.seq
168264354 gbest234.seq
167203150 gbest235.seq
165527045 gbest236.seq
164895066 gbest237.seq
164460583 gbest238.seq
164404631 gbest239.seq
230688547 gbest24.seq
164270947 gbest240.seq
164448098 gbest241.seq
163419136 gbest242.seq
167055846 gbest243.seq
164631609 gbest244.seq
161933104 gbest245.seq
165246729 gbest246.seq
168617936 gbest247.seq
166686307 gbest248.seq
165648896 gbest249.seq
230690622 gbest25.seq
165852300 gbest250.seq
165119710 gbest251.seq
164711055 gbest252.seq
164238943 gbest253.seq
164606967 gbest254.seq
165313608 gbest255.seq
174027996 gbest256.seq
176701208 gbest257.seq
174001580 gbest258.seq
230689418 gbest259.seq
230690312 gbest26.seq
230690098 gbest260.seq
230689182 gbest261.seq
230689469 gbest262.seq
230688796 gbest263.seq
230687624 gbest264.seq
230688636 gbest265.seq
230689919 gbest266.seq
230691127 gbest267.seq
230688299 gbest268.seq
230688031 gbest269.seq
230689294 gbest27.seq
230688825 gbest270.seq
230688738 gbest271.seq
230690667 gbest272.seq
230689830 gbest273.seq
230689884 gbest274.seq
230687598 gbest275.seq
230689813 gbest276.seq
230690929 gbest277.seq
230688464 gbest278.seq
230688940 gbest279.seq
230687981 gbest28.seq
230688257 gbest280.seq
230689105 gbest281.seq
230688813 gbest282.seq
230690314 gbest283.seq
230689862 gbest284.seq
230687545 gbest285.seq
230689432 gbest286.seq
230690645 gbest287.seq
230688200 gbest288.seq
230688018 gbest289.seq
230688034 gbest29.seq
215130724 gbest290.seq
230690037 gbest291.seq
230689463 gbest292.seq
230688139 gbest293.seq
230688471 gbest294.seq
230689039 gbest295.seq
230688188 gbest296.seq
230690224 gbest297.seq
230687752 gbest298.seq
230688969 gbest299.seq
230690086 gbest3.seq
230689399 gbest30.seq
230688825 gbest300.seq
230687924 gbest301.seq
230688139 gbest302.seq
230688148 gbest303.seq
230689568 gbest304.seq
230690678 gbest305.seq
230689180 gbest306.seq
230690331 gbest307.seq
230692319 gbest308.seq
230690547 gbest309.seq
230689798 gbest31.seq
230688385 gbest310.seq
230689269 gbest311.seq
230688632 gbest312.seq
230688009 gbest313.seq
230689637 gbest314.seq
230690394 gbest315.seq
230690052 gbest316.seq
230687912 gbest317.seq
230690473 gbest318.seq
230687924 gbest319.seq
230688754 gbest32.seq
230689376 gbest320.seq
230690147 gbest321.seq
230690237 gbest322.seq
230691242 gbest323.seq
230688967 gbest324.seq
230689469 gbest325.seq
230690894 gbest326.seq
230689070 gbest327.seq
230689113 gbest328.seq
230687767 gbest329.seq
230687853 gbest33.seq
230689947 gbest330.seq
230689501 gbest331.seq
230689507 gbest332.seq
230689110 gbest333.seq
230688315 gbest334.seq
230688923 gbest335.seq
230688211 gbest336.seq
230688780 gbest337.seq
230688988 gbest338.seq
230688434 gbest339.seq
230689243 gbest34.seq
230689510 gbest340.seq
230690886 gbest341.seq
201304814 gbest342.seq
230688202 gbest343.seq
230689347 gbest344.seq
230687597 gbest345.seq
230690491 gbest346.seq
230688829 gbest347.seq
230689335 gbest348.seq
143379510 gbest349.seq
230689934 gbest35.seq
185676956 gbest350.seq
230688317 gbest351.seq
230690564 gbest352.seq
230689403 gbest353.seq
230691018 gbest354.seq
230687685 gbest355.seq
230688326 gbest356.seq
230687790 gbest357.seq
230687834 gbest358.seq
230689198 gbest359.seq
230688951 gbest36.seq
230688648 gbest360.seq
230689554 gbest361.seq
230690188 gbest362.seq
230688701 gbest363.seq
230688125 gbest364.seq
230688725 gbest365.seq
230691501 gbest366.seq
230687745 gbest367.seq
230688447 gbest368.seq
230687829 gbest369.seq
230687469 gbest37.seq
230688231 gbest370.seq
230690350 gbest371.seq
230690561 gbest372.seq
230690266 gbest373.seq
230687649 gbest374.seq
230688476 gbest375.seq
230688001 gbest376.seq
230690634 gbest377.seq
230690730 gbest378.seq
230689647 gbest379.seq
230689550 gbest38.seq
230687625 gbest380.seq
230688478 gbest381.seq
230687569 gbest382.seq
230690767 gbest383.seq
230687455 gbest384.seq
230689062 gbest385.seq
230689049 gbest386.seq
230691884 gbest387.seq
230687751 gbest388.seq
230687815 gbest389.seq
230688220 gbest39.seq
230689032 gbest390.seq
230689726 gbest391.seq
230689631 gbest392.seq
230689489 gbest393.seq
230687590 gbest394.seq
230689035 gbest395.seq
230691741 gbest396.seq
230690419 gbest397.seq
230303281 gbest398.seq
230689270 gbest399.seq
230687863 gbest4.seq
230689239 gbest40.seq
230688324 gbest400.seq
230689758 gbest401.seq
230690664 gbest402.seq
230688388 gbest403.seq
230690861 gbest404.seq
230688411 gbest405.seq
206749232 gbest406.seq
230688535 gbest407.seq
230688393 gbest408.seq
230689437 gbest409.seq
230688891 gbest41.seq
230688765 gbest410.seq
230687836 gbest411.seq
230689155 gbest412.seq
230690660 gbest413.seq
230690548 gbest414.seq
230689794 gbest415.seq
230690379 gbest416.seq
230687945 gbest417.seq
230688020 gbest418.seq
230689531 gbest419.seq
230690213 gbest42.seq
230690192 gbest420.seq
230687673 gbest421.seq
230691303 gbest422.seq
230688275 gbest423.seq
210576284 gbest424.seq
210248243 gbest425.seq
210125779 gbest426.seq
210418122 gbest427.seq
210287280 gbest428.seq
210441714 gbest429.seq
230688417 gbest43.seq
211432929 gbest430.seq
211742704 gbest431.seq
211099666 gbest432.seq
212442651 gbest433.seq
213284367 gbest434.seq
211277289 gbest435.seq
210857436 gbest436.seq
210812933 gbest437.seq
210421990 gbest438.seq
210172572 gbest439.seq
230687683 gbest44.seq
210212361 gbest440.seq
210227477 gbest441.seq
210089082 gbest442.seq
225896416 gbest443.seq
230689824 gbest444.seq
230689541 gbest445.seq
230688717 gbest446.seq
230689203 gbest447.seq
230689066 gbest448.seq
230688614 gbest449.seq
219146879 gbest45.seq
230688777 gbest450.seq
230688312 gbest451.seq
230688780 gbest452.seq
230689339 gbest453.seq
230689275 gbest454.seq
230688939 gbest455.seq
230690483 gbest456.seq
230691727 gbest457.seq
230687539 gbest458.seq
230689709 gbest459.seq
192261097 gbest46.seq
230688270 gbest460.seq
230688922 gbest461.seq
230695140 gbest462.seq
230690450 gbest463.seq
230689347 gbest464.seq
230692645 gbest465.seq
230689258 gbest466.seq
230688217 gbest467.seq
230688614 gbest468.seq
230687706 gbest469.seq
192008752 gbest47.seq
224332786 gbest470.seq
230689477 gbest471.seq
230688965 gbest472.seq
230690130 gbest473.seq
230687843 gbest474.seq
230689410 gbest475.seq
230689042 gbest476.seq
230688798 gbest477.seq
230690995 gbest478.seq
230690566 gbest479.seq
216498591 gbest48.seq
230690024 gbest480.seq
230688014 gbest481.seq
230691411 gbest482.seq
230690414 gbest483.seq
230690774 gbest484.seq
230687905 gbest485.seq
230689650 gbest486.seq
230690799 gbest487.seq
230688239 gbest488.seq
230689393 gbest489.seq
216220710 gbest49.seq
230690040 gbest490.seq
229932808 gbest491.seq
230690185 gbest492.seq
230690970 gbest493.seq
230688924 gbest494.seq
230690545 gbest495.seq
230687519 gbest496.seq
230689688 gbest497.seq
230688602 gbest498.seq
230688144 gbest499.seq
164122792 gbest5.seq
215876077 gbest50.seq
230689313 gbest500.seq
230691630 gbest501.seq
230688087 gbest502.seq
230688809 gbest503.seq
230689750 gbest504.seq
230689608 gbest505.seq
230691217 gbest506.seq
230689828 gbest507.seq
230688172 gbest508.seq
230689396 gbest509.seq
216913883 gbest51.seq
230689725 gbest510.seq
226040330 gbest511.seq
230688714 gbest512.seq
230689270 gbest513.seq
230690762 gbest514.seq
230690283 gbest515.seq
230687530 gbest516.seq
230689009 gbest517.seq
230687754 gbest518.seq
230688123 gbest519.seq
230688486 gbest52.seq
230688709 gbest520.seq
230691581 gbest521.seq
230688332 gbest522.seq
230689622 gbest523.seq
230687866 gbest524.seq
230688508 gbest525.seq
196049260 gbest526.seq
196033118 gbest527.seq
230690689 gbest528.seq
230689046 gbest529.seq
230689446 gbest53.seq
230688239 gbest530.seq
230688621 gbest531.seq
230690469 gbest532.seq
230688100 gbest533.seq
230687457 gbest534.seq
230689245 gbest535.seq
230689530 gbest536.seq
230688316 gbest537.seq
230689205 gbest538.seq
230687733 gbest539.seq
230688438 gbest54.seq
230688513 gbest540.seq
222463735 gbest541.seq
230688964 gbest542.seq
230689758 gbest543.seq
230689215 gbest544.seq
230688865 gbest545.seq
230688270 gbest546.seq
230687553 gbest547.seq
225020145 gbest548.seq
215154750 gbest549.seq
225035271 gbest55.seq
230687613 gbest550.seq
230690375 gbest551.seq
230689667 gbest552.seq
230687998 gbest553.seq
230687664 gbest554.seq
230689764 gbest555.seq
230687949 gbest556.seq
230689476 gbest557.seq
230689938 gbest558.seq
230690013 gbest559.seq
230687600 gbest56.seq
230690139 gbest560.seq
230689830 gbest561.seq
230689529 gbest562.seq
230687463 gbest563.seq
230690018 gbest564.seq
230689726 gbest565.seq
230688726 gbest566.seq
230688022 gbest567.seq
230689429 gbest568.seq
230687633 gbest569.seq
230688032 gbest57.seq
230687802 gbest570.seq
230688408 gbest571.seq
230690036 gbest572.seq
230687958 gbest573.seq
230689911 gbest574.seq
230689032 gbest575.seq
230688162 gbest576.seq
230688266 gbest577.seq
230688337 gbest578.seq
230687583 gbest579.seq
230691372 gbest58.seq
230690028 gbest580.seq
230384170 gbest581.seq
230690714 gbest582.seq
230688747 gbest583.seq
230689641 gbest584.seq
230691704 gbest585.seq
230688555 gbest586.seq
230689021 gbest587.seq
230687661 gbest588.seq
230689329 gbest589.seq
230687531 gbest59.seq
230688934 gbest590.seq
230688934 gbest591.seq
230687964 gbest592.seq
230689079 gbest593.seq
230687630 gbest594.seq
230689282 gbest595.seq
230688328 gbest596.seq
230688370 gbest597.seq
230690135 gbest598.seq
230689303 gbest599.seq
177439121 gbest6.seq
230690771 gbest60.seq
230688164 gbest600.seq
230688637 gbest601.seq
230689883 gbest602.seq
230688126 gbest603.seq
230688527 gbest604.seq
230690833 gbest605.seq
230687951 gbest606.seq
230689959 gbest607.seq
230687791 gbest608.seq
230689839 gbest609.seq
230689876 gbest61.seq
230688969 gbest610.seq
230689326 gbest611.seq
230689682 gbest612.seq
230688480 gbest613.seq
230688948 gbest614.seq
229079168 gbest615.seq
230688751 gbest616.seq
230690832 gbest617.seq
228351321 gbest618.seq
217270068 gbest619.seq
230689479 gbest62.seq
230689357 gbest620.seq
224216997 gbest621.seq
189317178 gbest622.seq
189187380 gbest623.seq
192208885 gbest624.seq
190798039 gbest625.seq
190406934 gbest626.seq
189917264 gbest627.seq
192189432 gbest628.seq
190304223 gbest629.seq
230687898 gbest63.seq
190055254 gbest630.seq
191468757 gbest631.seq
230688432 gbest632.seq
230689682 gbest633.seq
230687609 gbest634.seq
230687703 gbest635.seq
230689824 gbest636.seq
230687523 gbest637.seq
230689109 gbest638.seq
230688145 gbest639.seq
230687890 gbest64.seq
230688425 gbest640.seq
230688557 gbest641.seq
230687662 gbest642.seq
230689520 gbest643.seq
230688704 gbest644.seq
230690136 gbest645.seq
230688558 gbest646.seq
218995909 gbest647.seq
230690483 gbest648.seq
181346965 gbest649.seq
230690106 gbest65.seq
230690189 gbest66.seq
230688040 gbest67.seq
230690690 gbest68.seq
230688682 gbest69.seq
230689869 gbest7.seq
230689234 gbest70.seq
230691771 gbest71.seq
209403792 gbest72.seq
209434778 gbest73.seq
208565052 gbest74.seq
209103912 gbest75.seq
209732667 gbest76.seq
210370023 gbest77.seq
209766358 gbest78.seq
208259457 gbest79.seq
230687935 gbest8.seq
210228195 gbest80.seq
208581327 gbest81.seq
205330078 gbest82.seq
208570208 gbest83.seq
207857402 gbest84.seq
210917058 gbest85.seq
225496185 gbest86.seq
230688801 gbest87.seq
230688637 gbest88.seq
221402255 gbest89.seq
230688178 gbest9.seq
214526016 gbest90.seq
213979065 gbest91.seq
230689498 gbest92.seq
230688349 gbest93.seq
230689854 gbest94.seq
230688925 gbest95.seq
230690360 gbest96.seq
230688292 gbest97.seq
230687809 gbest98.seq
230689136 gbest99.seq
72456745 gbgen.idx
230689941 gbgss1.seq
230688990 gbgss10.seq
230690229 gbgss100.seq
227755793 gbgss101.seq
228841479 gbgss102.seq
228541374 gbgss103.seq
228595875 gbgss104.seq
227721818 gbgss105.seq
230687977 gbgss106.seq
230688913 gbgss107.seq
230688620 gbgss108.seq
230688423 gbgss109.seq
230687697 gbgss11.seq
230690189 gbgss110.seq
230690194 gbgss111.seq
230690069 gbgss112.seq
230688846 gbgss113.seq
230687531 gbgss114.seq
230688700 gbgss115.seq
230688921 gbgss116.seq
230688996 gbgss117.seq
230687888 gbgss118.seq
230688574 gbgss119.seq
230688133 gbgss12.seq
230688155 gbgss120.seq
230687771 gbgss121.seq
230689432 gbgss122.seq
230688540 gbgss123.seq
230688340 gbgss124.seq
230688423 gbgss125.seq
230688215 gbgss126.seq
230687766 gbgss127.seq
230689462 gbgss128.seq
230689489 gbgss129.seq
230689916 gbgss13.seq
230690586 gbgss130.seq
230687962 gbgss131.seq
230689638 gbgss132.seq
230689035 gbgss133.seq
230687502 gbgss134.seq
230687664 gbgss135.seq
230689319 gbgss136.seq
230690154 gbgss137.seq
230689549 gbgss138.seq
230688991 gbgss139.seq
230687590 gbgss14.seq
230688920 gbgss140.seq
230688833 gbgss141.seq
230687795 gbgss142.seq
230688337 gbgss143.seq
230689244 gbgss144.seq
224503101 gbgss145.seq
230687517 gbgss146.seq
230687600 gbgss147.seq
197563866 gbgss148.seq
230690222 gbgss149.seq
230689087 gbgss15.seq
230690499 gbgss150.seq
230687904 gbgss151.seq
230689917 gbgss152.seq
230689907 gbgss153.seq
230688586 gbgss154.seq
230690640 gbgss155.seq
230687631 gbgss156.seq
230688118 gbgss157.seq
230689170 gbgss158.seq
230688632 gbgss159.seq
230689755 gbgss16.seq
230689223 gbgss160.seq
230688216 gbgss161.seq
230689363 gbgss162.seq
230689562 gbgss163.seq
230688828 gbgss164.seq
230688527 gbgss165.seq
230688292 gbgss166.seq
230687616 gbgss167.seq
230688705 gbgss168.seq
230688137 gbgss169.seq
230690225 gbgss17.seq
230690796 gbgss170.seq
230689922 gbgss171.seq
208050853 gbgss172.seq
208682758 gbgss173.seq
210729411 gbgss174.seq
210151596 gbgss175.seq
209283408 gbgss176.seq
208498592 gbgss177.seq
207526496 gbgss178.seq
207371939 gbgss179.seq
230687922 gbgss18.seq
208176558 gbgss180.seq
209779179 gbgss181.seq
209807318 gbgss182.seq
206143611 gbgss183.seq
205631754 gbgss184.seq
205473769 gbgss185.seq
205558345 gbgss186.seq
205293339 gbgss187.seq
204767111 gbgss188.seq
208051987 gbgss189.seq
230690376 gbgss19.seq
207842755 gbgss190.seq
208167166 gbgss191.seq
207825143 gbgss192.seq
208523250 gbgss193.seq
208794800 gbgss194.seq
208807915 gbgss195.seq
207138904 gbgss196.seq
206132463 gbgss197.seq
206154511 gbgss198.seq
205747245 gbgss199.seq
230687773 gbgss2.seq
230691590 gbgss20.seq
205514899 gbgss200.seq
207413920 gbgss201.seq
207037983 gbgss202.seq
207271669 gbgss203.seq
207098948 gbgss204.seq
207301763 gbgss205.seq
206903396 gbgss206.seq
206962397 gbgss207.seq
206980829 gbgss208.seq
206824323 gbgss209.seq
230689903 gbgss21.seq
207267826 gbgss210.seq
207610302 gbgss211.seq
208727680 gbgss212.seq
210122284 gbgss213.seq
209532659 gbgss214.seq
209988557 gbgss215.seq
214351214 gbgss216.seq
218857529 gbgss217.seq
230688547 gbgss218.seq
230688448 gbgss219.seq
230689122 gbgss22.seq
230687614 gbgss220.seq
164241319 gbgss221.seq
250002714 gbgss222.seq
250002997 gbgss223.seq
250000929 gbgss224.seq
250003202 gbgss225.seq
250002860 gbgss226.seq
250000990 gbgss227.seq
250001999 gbgss228.seq
250000855 gbgss229.seq
230688286 gbgss23.seq
250003058 gbgss230.seq
250002221 gbgss231.seq
250002954 gbgss232.seq
250003096 gbgss233.seq
250000693 gbgss234.seq
250003040 gbgss235.seq
250003778 gbgss236.seq
250000228 gbgss237.seq
250000784 gbgss238.seq
250004620 gbgss239.seq
230688682 gbgss24.seq
250001902 gbgss240.seq
250001444 gbgss241.seq
250001995 gbgss242.seq
250000515 gbgss243.seq
250000325 gbgss244.seq
250002773 gbgss245.seq
250000778 gbgss246.seq
250001928 gbgss247.seq
250000695 gbgss248.seq
250000653 gbgss249.seq
230687623 gbgss25.seq
250001151 gbgss250.seq
250000703 gbgss251.seq
250001468 gbgss252.seq
250000993 gbgss253.seq
250000789 gbgss254.seq
250001404 gbgss255.seq
250002074 gbgss256.seq
250001528 gbgss257.seq
250002101 gbgss258.seq
250000418 gbgss259.seq
230690034 gbgss26.seq
250002399 gbgss260.seq
250001619 gbgss261.seq
250002456 gbgss262.seq
250001493 gbgss263.seq
250001131 gbgss264.seq
250002552 gbgss265.seq
250000714 gbgss266.seq
250001187 gbgss267.seq
250002104 gbgss268.seq
110124714 gbgss269.seq
230689447 gbgss27.seq
230690553 gbgss28.seq
230689597 gbgss29.seq
230690517 gbgss3.seq
230690445 gbgss30.seq
230690124 gbgss31.seq
230688264 gbgss32.seq
230687499 gbgss33.seq
230689148 gbgss34.seq
230687994 gbgss35.seq
230687902 gbgss36.seq
230688853 gbgss37.seq
230688577 gbgss38.seq
230690882 gbgss39.seq
230690055 gbgss4.seq
230689221 gbgss40.seq
230687676 gbgss41.seq
230688331 gbgss42.seq
230689651 gbgss43.seq
230689254 gbgss44.seq
230687497 gbgss45.seq
230690057 gbgss46.seq
230690193 gbgss47.seq
230688343 gbgss48.seq
230687941 gbgss49.seq
230687548 gbgss5.seq
230688364 gbgss50.seq
230688240 gbgss51.seq
230687647 gbgss52.seq
230690714 gbgss53.seq
230688927 gbgss54.seq
230688056 gbgss55.seq
230687818 gbgss56.seq
230688122 gbgss57.seq
230690458 gbgss58.seq
230688776 gbgss59.seq
230689498 gbgss6.seq
230688135 gbgss60.seq
228959773 gbgss61.seq
230689859 gbgss62.seq
230689037 gbgss63.seq
230688318 gbgss64.seq
230688993 gbgss65.seq
230689232 gbgss66.seq
230687519 gbgss67.seq
230689355 gbgss68.seq
230689404 gbgss69.seq
230690186 gbgss7.seq
230688251 gbgss70.seq
230689522 gbgss71.seq
230687868 gbgss72.seq
230688170 gbgss73.seq
230688451 gbgss74.seq
230688210 gbgss75.seq
230689551 gbgss76.seq
230689525 gbgss77.seq
230689413 gbgss78.seq
230688711 gbgss79.seq
230689868 gbgss8.seq
230689643 gbgss80.seq
225890913 gbgss81.seq
194150557 gbgss82.seq
194331515 gbgss83.seq
230689523 gbgss84.seq
230688236 gbgss85.seq
230688491 gbgss86.seq
230689152 gbgss87.seq
230688371 gbgss88.seq
230689177 gbgss89.seq
230688713 gbgss9.seq
230688664 gbgss90.seq
230689991 gbgss91.seq
230688271 gbgss92.seq
230690194 gbgss93.seq
230688059 gbgss94.seq
230690022 gbgss95.seq
230687853 gbgss96.seq
230687605 gbgss97.seq
230688510 gbgss98.seq
230688876 gbgss99.seq
250013395 gbhtc1.seq
250002604 gbhtc10.seq
250004081 gbhtc11.seq
176008653 gbhtc12.seq
250001930 gbhtc2.seq
250005704 gbhtc3.seq
250002242 gbhtc4.seq
250012527 gbhtc5.seq
250007117 gbhtc6.seq
250000761 gbhtc7.seq
250003379 gbhtc8.seq
250000452 gbhtc9.seq
250096213 gbhtg1.seq
250059722 gbhtg10.seq
250012262 gbhtg100.seq
250251687 gbhtg101.seq
111468007 gbhtg102.seq
250129717 gbhtg11.seq
250028716 gbhtg12.seq
250231891 gbhtg13.seq
250115977 gbhtg14.seq
250265760 gbhtg15.seq
250201586 gbhtg16.seq
250201829 gbhtg17.seq
250155315 gbhtg18.seq
250028301 gbhtg19.seq
250020784 gbhtg2.seq
250033810 gbhtg20.seq
250164025 gbhtg21.seq
250242948 gbhtg22.seq
250144020 gbhtg23.seq
250088982 gbhtg24.seq
250032540 gbhtg25.seq
250181202 gbhtg26.seq
250195979 gbhtg27.seq
250051909 gbhtg28.seq
250111976 gbhtg29.seq
250039037 gbhtg3.seq
250120353 gbhtg30.seq
250202904 gbhtg31.seq
250220445 gbhtg32.seq
250269348 gbhtg33.seq
250031905 gbhtg34.seq
250168461 gbhtg35.seq
250228372 gbhtg36.seq
250007538 gbhtg37.seq
250080524 gbhtg38.seq
250248959 gbhtg39.seq
250101894 gbhtg4.seq
250080112 gbhtg40.seq
250013497 gbhtg41.seq
250194918 gbhtg42.seq
250061347 gbhtg43.seq
250153143 gbhtg44.seq
250008843 gbhtg45.seq
250185139 gbhtg46.seq
250163367 gbhtg47.seq
250029684 gbhtg48.seq
250227281 gbhtg49.seq
250209185 gbhtg5.seq
250347332 gbhtg50.seq
250004404 gbhtg51.seq
250344147 gbhtg52.seq
250126601 gbhtg53.seq
250111662 gbhtg54.seq
250179867 gbhtg55.seq
250342508 gbhtg56.seq
250095525 gbhtg57.seq
250052591 gbhtg58.seq
250018393 gbhtg59.seq
250053402 gbhtg6.seq
250390350 gbhtg60.seq
250114943 gbhtg61.seq
250049269 gbhtg62.seq
250098597 gbhtg63.seq
250413852 gbhtg64.seq
250089584 gbhtg65.seq
250036347 gbhtg66.seq
250023856 gbhtg67.seq
250140937 gbhtg68.seq
250026889 gbhtg69.seq
250004219 gbhtg7.seq
250052472 gbhtg70.seq
250024225 gbhtg71.seq
250211422 gbhtg72.seq
250121800 gbhtg73.seq
250040008 gbhtg74.seq
250126514 gbhtg75.seq
250030722 gbhtg76.seq
250037539 gbhtg77.seq
250136519 gbhtg78.seq
250109157 gbhtg79.seq
250124023 gbhtg8.seq
250037962 gbhtg80.seq
250102012 gbhtg81.seq
250347134 gbhtg82.seq
250137794 gbhtg83.seq
250011257 gbhtg84.seq
250050722 gbhtg85.seq
250217448 gbhtg86.seq
250255022 gbhtg87.seq
250136660 gbhtg88.seq
250044793 gbhtg89.seq
250009914 gbhtg9.seq
250094093 gbhtg90.seq
250131009 gbhtg91.seq
250081623 gbhtg92.seq
250097217 gbhtg93.seq
250034633 gbhtg94.seq
250276912 gbhtg95.seq
250152823 gbhtg96.seq
250236933 gbhtg97.seq
250188941 gbhtg98.seq
250037995 gbhtg99.seq
250028918 gbinv1.seq
250002384 gbinv10.seq
129121020 gbinv11.seq
250061855 gbinv2.seq
250025704 gbinv3.seq
250001211 gbinv4.seq
250656718 gbinv5.seq
250000017 gbinv6.seq
250002838 gbinv7.seq
250001555 gbinv8.seq
250003016 gbinv9.seq
148904813 gbjou1.idx
139114667 gbjou2.idx
232753391 gbjou3.idx
242060780 gbjou4.idx
186532683 gbkey1.idx
204449587 gbkey2.idx
4995311 gbkey3.idx
250001295 gbmam1.seq
250000988 gbmam2.seq
250000082 gbmam3.seq
15274804 gbmam4.seq
23996536 gbnew.txt
250000400 gbpat1.seq
250001056 gbpat10.seq
250000357 gbpat11.seq
250001287 gbpat12.seq
250000753 gbpat13.seq
250000248 gbpat14.seq
250001401 gbpat15.seq
250001581 gbpat16.seq
250002042 gbpat17.seq
250000091 gbpat18.seq
250000017 gbpat19.seq
250000203 gbpat2.seq
250002120 gbpat20.seq
250000609 gbpat21.seq
250169779 gbpat22.seq
250020331 gbpat23.seq
250000577 gbpat24.seq
250001698 gbpat25.seq
250003375 gbpat26.seq
250000034 gbpat27.seq
250000695 gbpat28.seq
250001560 gbpat29.seq
250003352 gbpat3.seq
250000676 gbpat30.seq
41902507 gbpat31.seq
250002405 gbpat4.seq
250000083 gbpat5.seq
250000202 gbpat6.seq
250001518 gbpat7.seq
250002702 gbpat8.seq
250000010 gbpat9.seq
63926113 gbphg.seq
250109396 gbpln1.seq
250001239 gbpln10.seq
250002815 gbpln11.seq
250103434 gbpln12.seq
250084985 gbpln13.seq
250189632 gbpln14.seq
252519817 gbpln15.seq
263382270 gbpln16.seq
290699279 gbpln17.seq
250002100 gbpln18.seq
250001276 gbpln19.seq
250067699 gbpln2.seq
250002548 gbpln20.seq
250244139 gbpln21.seq
250004549 gbpln22.seq
250001471 gbpln23.seq
250001584 gbpln24.seq
250005101 gbpln25.seq
177899028 gbpln26.seq
250134051 gbpln3.seq
250002011 gbpln4.seq
250004311 gbpln5.seq
250000298 gbpln6.seq
250000884 gbpln7.seq
250000142 gbpln8.seq
250124328 gbpln9.seq
250102031 gbpri1.seq
250108027 gbpri10.seq
250057206 gbpri11.seq
250028034 gbpri12.seq
250196483 gbpri13.seq
250044348 gbpri14.seq
250198667 gbpri15.seq
250033380 gbpri16.seq
250166539 gbpri17.seq
250092863 gbpri18.seq
250033271 gbpri19.seq
250016809 gbpri2.seq
250007022 gbpri20.seq
250034814 gbpri21.seq
250077976 gbpri22.seq
250061697 gbpri23.seq
250001640 gbpri24.seq
250202266 gbpri25.seq
250095097 gbpri26.seq
250171769 gbpri27.seq
250033743 gbpri28.seq
250007664 gbpri29.seq
250222749 gbpri3.seq
250004811 gbpri30.seq
250216793 gbpri31.seq
250002106 gbpri32.seq
250080487 gbpri33.seq
159684266 gbpri34.seq
250186989 gbpri4.seq
250056497 gbpri5.seq
250068489 gbpri6.seq
250066849 gbpri7.seq
250220625 gbpri8.seq
250189001 gbpri9.seq
284217 gbrel.txt
250096286 gbrod1.seq
250043721 gbrod10.seq
250088631 gbrod11.seq
250213826 gbrod12.seq
250042314 gbrod13.seq
250077796 gbrod14.seq
250093898 gbrod15.seq
250056282 gbrod16.seq
250021036 gbrod17.seq
250138647 gbrod18.seq
250076458 gbrod19.seq
250192792 gbrod2.seq
250318541 gbrod20.seq
250005297 gbrod21.seq
250003649 gbrod22.seq
250250968 gbrod23.seq
250000742 gbrod24.seq
250010324 gbrod25.seq
40554732 gbrod26.seq
250282909 gbrod3.seq
250123910 gbrod4.seq
250130651 gbrod5.seq
250196160 gbrod6.seq
250219341 gbrod7.seq
250156513 gbrod8.seq
250159153 gbrod9.seq
1135747121 gbsdr1.txt
3718906513 gbsdr2.txt
1689252349 gbsdr3.txt
96652999 gbsec.idx
250001829 gbsts1.seq
250003224 gbsts10.seq
250002816 gbsts11.seq
250002166 gbsts12.seq
250002430 gbsts13.seq
195245268 gbsts14.seq
250002617 gbsts2.seq
250000191 gbsts3.seq
250003129 gbsts4.seq
250001709 gbsts5.seq
250003957 gbsts6.seq
250000749 gbsts7.seq
250003682 gbsts8.seq
250000423 gbsts9.seq
250000231 gbsyn1.seq
14518150 gbsyn2.seq
422715 gbuna.seq
250002102 gbvrl1.seq
250001860 gbvrl2.seq
250001372 gbvrl3.seq
250003978 gbvrl4.seq
250002179 gbvrl5.seq
250003021 gbvrl6.seq
250000620 gbvrl7.seq
85648222 gbvrl8.seq
250162714 gbvrt1.seq
250141031 gbvrt10.seq
250003644 gbvrt11.seq
250018582 gbvrt12.seq
250000967 gbvrt13.seq
186014805 gbvrt14.seq
250001097 gbvrt2.seq
250026014 gbvrt3.seq
250000559 gbvrt4.seq
250003347 gbvrt5.seq
250096637 gbvrt6.seq
250081085 gbvrt7.seq
250014706 gbvrt8.seq
250261372 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 31806 101567702
BCT10 163 100712006
BCT11 110 106854351
BCT12 51 112690832
BCT13 54 113679202
BCT14 51 118892891
BCT15 64 115725611
BCT16 59 112706292
BCT17 38 114247144
BCT18 61 112101133
BCT19 67 113469653
BCT2 4004 109586144
BCT20 58 112829080
BCT21 52 109948086
BCT22 243 112196253
BCT23 69896 85489325
BCT24 57647 88150956
BCT25 10832 24167230
BCT3 159 115987743
BCT4 22461 103647695
BCT5 54712 86800908
BCT6 5513 95573058
BCT7 14746 101019676
BCT8 33583 100989461
BCT9 36138 106741529
ENV1 91140 70832239
ENV2 96287 71349143
ENV3 86294 82873177
ENV4 91539 83319927
ENV5 135938 29105904
ENV6 99292 66167823
ENV7 50302 37869046
EST1 68126 26289737
EST10 76542 29845796
EST100 74757 43490420
EST101 70433 36387971
EST102 75739 34899007
EST103 72228 43523399
EST104 73901 35444701
EST105 72244 41293528
EST106 67984 36694776
EST107 73243 36063598
EST108 72540 49334498
EST109 72351 42765046
EST11 75113 28769858
EST110 69343 45251980
EST111 73588 33064572
EST112 70774 29714781
EST113 65001 33747011
EST114 67787 39246525
EST115 69895 39858792
EST116 71408 40376709
EST117 75368 34200664
EST118 74346 27482940
EST119 74624 30706581
EST12 77564 30748087
EST120 72157 38159401
EST121 65964 33625949
EST122 79204 47096164
EST123 78635 44243777
EST124 69938 47677626
EST125 69264 39428905
EST126 72788 49796064
EST127 68292 42473698
EST128 74026 44820076
EST129 74276 45016521
EST13 76997 29271395
EST130 71094 48614553
EST131 74466 48090563
EST132 75791 45973580
EST133 77158 32793250
EST134 77691 30218821
EST135 79877 48260610
EST136 74741 42612896
EST137 64473 35118680
EST138 72808 37445558
EST139 66249 36513598
EST14 78533 31826188
EST140 66425 36337267
EST141 70868 43669020
EST142 72852 43977966
EST143 67841 40385771
EST144 67263 40168893
EST145 75745 44169147
EST146 68844 41956641
EST147 59653 33624255
EST148 97869 53249769
EST149 83693 48101929
EST15 74616 31539433
EST150 79944 41241378
EST151 102038 54928910
EST152 107491 57787103
EST153 98668 54568891
EST154 73451 45027038
EST155 94227 55437084
EST156 99469 59454165
EST157 90992 55985039
EST158 80845 43294718
EST159 69772 40423512
EST16 75821 33351173
EST160 65650 31338152
EST161 62266 28253984
EST162 56311 26814406
EST163 65421 31556085
EST164 57030 28939669
EST165 73804 44536952
EST166 68203 43890990
EST167 69895 49321453
EST168 76603 43932369
EST169 58154 29971753
EST17 82203 33930985
EST170 64029 32521061
EST171 65726 38582634
EST172 64415 45354616
EST173 62543 35880986
EST174 100105 46032278
EST175 86005 49307270
EST176 99867 56938770
EST177 99673 57709916
EST178 96864 51815108
EST179 82829 40631423
EST18 80825 32242803
EST180 90180 36782499
EST181 94842 50237684
EST182 89360 37680355
EST183 93546 40628393
EST184 70402 38297115
EST185 68292 43910734
EST186 64844 37238762
EST187 65086 42688728
EST188 68326 30810358
EST189 76318 31862041
EST19 78549 31803087
EST190 69472 43822283
EST191 82421 40923139
EST192 61704 32045132
EST193 67561 47816457
EST194 70409 46271196
EST195 67504 36641146
EST196 66780 44518314
EST197 70337 54374340
EST198 68337 32625917
EST199 72237 40247408
EST2 74651 28647346
EST20 74686 30676945
EST200 69151 58832851
EST201 66335 50265205
EST202 63736 46385774
EST203 63297 46848911
EST204 65037 45872143
EST205 64256 44595988
EST206 63488 48809214
EST207 62462 39259310
EST208 65169 33884687
EST209 63351 37360936
EST21 73849 34320100
EST210 83564 45450241
EST211 84467 54914585
EST212 66663 39776062
EST213 104653 66009522
EST214 108118 65304890
EST215 109306 64850368
EST216 103901 66338272
EST217 106021 61691890
EST218 108627 49607412
EST219 86777 52478293
EST22 75217 30151870
EST220 90180 44511977
EST221 91432 42458104
EST222 77318 50868842
EST223 66836 38886137
EST224 68259 56298182
EST225 68034 59122424
EST226 76113 45908394
EST227 81293 42401289
EST228 76009 52385683
EST229 71086 51493906
EST23 77353 32671483
EST230 57428 35691547
EST231 27773 10513451
EST232 27841 10352898
EST233 26642 9833624
EST234 26870 9351364
EST235 27094 9275333
EST236 27176 10217431
EST237 27181 9695981
EST238 27240 10169918
EST239 27193 11687071
EST24 74783 32879873
EST240 27198 11367270
EST241 27236 10474480
EST242 27543 9507273
EST243 26999 9006342
EST244 27539 11154656
EST245 27905 10748796
EST246 27383 11085350
EST247 26615 11776099
EST248 26895 11671092
EST249 27101 10677314
EST25 73935 31829331
EST250 26963 11478263
EST251 27117 11708886
EST252 27240 11281088
EST253 27270 10782016
EST254 27226 10751481
EST255 27138 10563004
EST256 25584 15836524
EST257 25126 16591450
EST258 30430 18346646
EST259 94497 41274118
EST26 75307 31121574
EST260 46448 29882463
EST261 100180 39656011
EST262 74059 39234073
EST263 68626 44367920
EST264 69347 44589589
EST265 68982 44631782
EST266 64597 38493281
EST267 79103 45208490
EST268 63009 45722817
EST269 66858 38173197
EST27 74464 32452326
EST270 66916 33695267
EST271 102320 47328749
EST272 81627 44763109
EST273 69658 36049012
EST274 65822 31619627
EST275 69306 41835363
EST276 70398 33960778
EST277 70309 33235369
EST278 76419 46247838
EST279 63832 37023860
EST28 108076 51161102
EST280 67901 39307227
EST281 76432 37521301
EST282 82153 45499371
EST283 73939 49197288
EST284 77886 53505330
EST285 100553 49695314
EST286 93706 45106529
EST287 76609 43414138
EST288 70199 46268966
EST289 74651 32829992
EST29 97079 45955830
EST290 70432 31294486
EST291 71895 36233828
EST292 64354 38544818
EST293 58665 37415180
EST294 73482 43578764
EST295 63368 43042309
EST296 62315 34515662
EST297 83561 44112998
EST298 83179 40832405
EST299 69529 44562969
EST3 73738 29918375
EST30 98323 53735898
EST300 103667 58728513
EST301 120667 47963392
EST302 86071 39591414
EST303 64471 35347663
EST304 71835 45123243
EST305 81590 41160853
EST306 70020 41776161
EST307 70172 41573727
EST308 65993 36600828
EST309 62249 37245973
EST31 83927 48617956
EST310 49827 27044624
EST311 73119 53422574
EST312 73453 42620017
EST313 72502 43968408
EST314 65742 35237461
EST315 65714 33861094
EST316 54020 27118164
EST317 53169 27389242
EST318 52958 28266643
EST319 51845 27583519
EST32 65450 46011243
EST320 52895 28538347
EST321 55874 23427961
EST322 55724 23891889
EST323 54212 22232706
EST324 55459 21638429
EST325 54768 21700282
EST326 56357 22785884
EST327 54961 21411079
EST328 56037 20441720
EST329 60504 26829158
EST33 72738 55112834
EST330 76920 40909041
EST331 74061 33985582
EST332 76428 31512722
EST333 74316 31366060
EST334 86645 52340980
EST335 72053 55614573
EST336 85947 53981608
EST337 93127 55954146
EST338 94473 56129988
EST339 101187 57098877
EST34 85388 48209607
EST340 98466 55206291
EST341 70140 37962978
EST342 68869 37787763
EST343 72891 45392227
EST344 63585 52920729
EST345 62948 46934792
EST346 63865 38226921
EST347 66096 42553223
EST348 71348 46244002
EST349 47836 23979677
EST35 86485 43975866
EST350 54264 26739309
EST351 74378 42024927
EST352 56868 28716914
EST353 64352 36258804
EST354 68877 43053044
EST355 82015 41014934
EST356 69635 42006813
EST357 69489 43115485
EST358 63962 37150257
EST359 70992 45858096
EST36 94930 51758166
EST360 88256 49052543
EST361 84555 50451399
EST362 73699 40392377
EST363 60643 36544313
EST364 72989 38541197
EST365 62895 32681595
EST366 47465 24401019
EST367 73207 42415653
EST368 76039 42011930
EST369 98288 46659346
EST37 84710 59000300
EST370 71568 49685951
EST371 68908 44362113
EST372 66728 42695558
EST373 64122 34845378
EST374 85664 37616150
EST375 72298 39850080
EST376 54300 38398251
EST377 63262 38579443
EST378 61084 39715301
EST379 95595 53570238
EST38 77036 53542712
EST380 79432 41986010
EST381 70661 47113764
EST382 71639 36760323
EST383 47751 29666272
EST384 44083 23090704
EST385 78598 52861052
EST386 80306 39597437
EST387 78753 47087798
EST388 75277 46128334
EST389 77515 48027220
EST39 89805 53372773
EST390 80195 52976635
EST391 83764 66636689
EST392 79869 65614999
EST393 82537 41900643
EST394 65648 38247400
EST395 63367 41464665
EST396 71646 38321804
EST397 54173 34753972
EST398 82071 27294820
EST399 81061 35496960
EST4 74566 28390659
EST40 63463 49906853
EST400 66800 39834544
EST401 65827 36973242
EST402 68646 38153452
EST403 74765 44007908
EST404 64084 45105176
EST405 61501 39130146
EST406 79871 46750217
EST407 56345 32112609
EST408 61948 38786755
EST409 79293 50226057
EST41 86195 49274469
EST410 85676 49544067
EST411 73453 42408922
EST412 58856 41203960
EST413 56927 40976226
EST414 57243 40510470
EST415 64243 39582215
EST416 73626 44610445
EST417 54986 34421714
EST418 60348 38835937
EST419 57934 40690096
EST42 102872 46026938
EST420 61361 41317145
EST421 55660 41893668
EST422 46886 33482630
EST423 93961 42303878
EST424 69455 38574376
EST425 69706 38352318
EST426 69862 38234698
EST427 69523 38799566
EST428 69618 38459154
EST429 69556 38761431
EST43 88538 45440545
EST430 68932 38347109
EST431 68826 39295143
EST432 69214 38321694
EST433 68088 37407570
EST434 67803 38809447
EST435 69387 39090552
EST436 69275 38210019
EST437 69407 38432983
EST438 69602 38019630
EST439 69842 38207021
EST44 101515 47449633
EST440 69701 38322771
EST441 69736 38361394
EST442 69989 37258304
EST443 85285 49071052
EST444 83942 43099215
EST445 81855 38679934
EST446 97767 56577879
EST447 79407 43206523
EST448 79494 50659785
EST449 89807 57295820
EST45 87653 33879985
EST450 97030 59300517
EST451 74050 43046864
EST452 86318 47155977
EST453 83512 48724682
EST454 52242 40131951
EST455 54921 42429797
EST456 75373 43016961
EST457 55208 33584824
EST458 88692 48867233
EST459 111232 58738215
EST46 68735 18416190
EST460 74313 46936461
EST461 79619 56831705
EST462 39326 21244534
EST463 50745 54921249
EST464 46768 58212373
EST465 77730 52457765
EST466 65145 37425009
EST467 73268 41830335
EST468 68301 42160448
EST469 70519 43399519
EST47 68637 18322481
EST470 60373 52544366
EST471 85602 43174157
EST472 109170 47908015
EST473 79270 53276311
EST474 60833 39401035
EST475 57198 40845502
EST476 57879 38842216
EST477 65768 49910561
EST478 64497 45126344
EST479 60565 43030372
EST48 62355 19027020
EST480 51905 38242986
EST481 53748 38040074
EST482 58707 42223672
EST483 67013 37388627
EST484 67611 44096747
EST485 57159 38027565
EST486 58862 40970054
EST487 61026 46676257
EST488 65164 48684525
EST489 63928 42247272
EST49 43705 11980620
EST490 51353 40439598
EST491 56607 37533629
EST492 53111 35923376
EST493 59047 38906088
EST494 64623 39402165
EST495 67584 44606476
EST496 72674 60521172
EST497 71669 50077376
EST498 65789 52207789
EST499 46895 56850918
EST5 48195 15294043
EST50 43302 11933283
EST500 59230 51163848
EST501 65815 42273374
EST502 66568 39770899
EST503 79610 48420885
EST504 82320 54359278
EST505 79382 49256405
EST506 66356 40683441
EST507 66531 40513837
EST508 73575 51435875
EST509 81659 47652385
EST51 43182 11438024
EST510 76343 63874463
EST511 69413 48527583
EST512 71827 47854038
EST513 67596 50458210
EST514 61756 46782836
EST515 63161 44833671
EST516 88514 46804888
EST517 84465 40345066
EST518 116371 43567574
EST519 96273 53935107
EST52 80572 33088833
EST520 67799 51605838
EST521 50569 49887076
EST522 78577 34652139
EST523 99624 11184304
EST524 99779 10924755
EST525 95388 36206621
EST526 86993 31686137
EST527 87007 31668178
EST528 68114 51025084
EST529 74140 58169407
EST53 90898 37167526
EST530 87169 51613551
EST531 78269 43535158
EST532 70517 49478977
EST533 72062 45751080
EST534 81368 53252747
EST535 79420 48082502
EST536 75469 54270485
EST537 64010 47560223
EST538 77498 56475242
EST539 90567 48900020
EST54 94329 42623984
EST540 81393 45104963
EST541 82599 42770355
EST542 80720 42136014
EST543 81256 48568387
EST544 77578 52595728
EST545 72597 55012002
EST546 70626 41559458
EST547 95950 50972563
EST548 109478 45837040
EST549 108461 48602431
EST55 91554 46239590
EST550 131307 56579979
EST551 120842 56369202
EST552 74297 54494090
EST553 80774 42523056
EST554 84288 8747748
EST555 84845 18794113
EST556 126040 62209084
EST557 119102 55444306
EST558 67388 44987931
EST559 69540 40547905
EST56 89617 42243492
EST560 70632 48770848
EST561 76114 46247129
EST562 72547 44712023
EST563 73224 46752633
EST564 69850 53472430
EST565 92925 54970719
EST566 97608 51373323
EST567 66758 35204501
EST568 63046 44595641
EST569 83523 54770187
EST57 102415 52212916
EST570 99276 58378807
EST571 75007 43761639
EST572 77632 40267952
EST573 88363 47221638
EST574 92548 46721962
EST575 70252 50727986
EST576 79579 55985637
EST577 88107 54301950
EST578 85283 56861460
EST579 84158 51243748
EST58 100324 51099642
EST580 76478 39946286
EST581 74494 46419490
EST582 63209 42457889
EST583 70193 34235057
EST584 103705 38774024
EST585 49960 34741440
EST586 51548 31602060
EST587 50695 35509286
EST588 68011 43001926
EST589 70590 49495847
EST59 76865 33180613
EST590 71303 49098487
EST591 122559 11172916
EST592 118193 14581907
EST593 122555 11181731
EST594 122483 11289402
EST595 94009 31898790
EST596 67953 51410133
EST597 74710 48686142
EST598 79415 54650127
EST599 69295 49445907
EST6 54920 17444122
EST60 66199 28700016
EST600 73103 44009172
EST601 67251 43773336
EST602 67920 41665913
EST603 78965 40907000
EST604 71965 46478120
EST605 71074 52568630
EST606 82920 46195372
EST607 88766 53062276
EST608 60043 34370554
EST609 71637 40320321
EST61 72842 32389595
EST610 78319 47797803
EST611 108759 49160147
EST612 77161 51336861
EST613 61412 48498390
EST614 66691 55079716
EST615 74353 37642399
EST616 85948 50897529
EST617 84937 51434409
EST618 75660 48980663
EST619 71487 46907585
EST62 70959 30035850
EST620 70137 51656212
EST621 91501 41770588
EST622 79205 26705619
EST623 79330 24985170
EST624 77036 29646311
EST625 78166 26827755
EST626 77942 29682123
EST627 78229 29322683
EST628 77092 29117534
EST629 78303 27910791
EST63 80265 32524166
EST630 78065 30413825
EST631 78492 29197718
EST632 80008 46996837
EST633 81831 60108226
EST634 81940 59811039
EST635 75585 44834668
EST636 62444 35002752
EST637 74088 45932697
EST638 60196 45000831
EST639 58373 45336530
EST64 74863 29534197
EST640 64697 46479199
EST641 86908 53195685
EST642 89991 44533164
EST643 69504 25472971
EST644 72937 27187864
EST645 73748 26085274
EST646 75798 27101543
EST647 72710 25046551
EST648 71120 29245577
EST649 59776 22073386
EST65 71014 28583450
EST66 64211 29592776
EST67 74858 33568216
EST68 77524 34643067
EST69 72879 28981069
EST7 74544 29357604
EST70 76117 25944101
EST71 86693 41608142
EST72 40647 11485451
EST73 40417 11119432
EST74 40374 12418877
EST75 40775 12592324
EST76 40819 12229820
EST77 40755 13108149
EST78 40506 12925599
EST79 40588 12086218
EST8 75832 30592480
EST80 40142 11969512
EST81 40853 12783050
EST82 41440 11769090
EST83 41006 13167641
EST84 40884 12774935
EST85 42146 13084996
EST86 45819 15388987
EST87 43043 27115919
EST88 42159 19949582
EST89 47603 19236078
EST9 77569 29868052
EST90 50754 22677298
EST91 51203 21532189
EST92 79404 46660022
EST93 77255 38149991
EST94 72052 27897915
EST95 75976 29568927
EST96 74291 39292243
EST97 76683 41590091
EST98 77563 44780007
EST99 75702 34662826
GSS1 90401 38650175
GSS10 74890 43604187
GSS100 80682 52426952
GSS101 74603 42575690
GSS102 73343 45759628
GSS103 73691 44884439
GSS104 73287 45619628
GSS105 73272 44804615
GSS106 75228 45659185
GSS107 81208 54535717
GSS108 83792 55524695
GSS109 80752 52730487
GSS11 70616 35924456
GSS110 82695 50149476
GSS111 84178 57290609
GSS112 79986 60363741
GSS113 90713 45904159
GSS114 90420 53751379
GSS115 73800 49906023
GSS116 89326 64910901
GSS117 82246 59216313
GSS118 75860 41659234
GSS119 81617 51036520
GSS12 72814 38256982
GSS120 95334 53233799
GSS121 84324 55709317
GSS122 84959 54757535
GSS123 82055 55420652
GSS124 76193 69486340
GSS125 76169 66903410
GSS126 79427 55411578
GSS127 72457 50191076
GSS128 72505 50091533
GSS129 73123 49059240
GSS13 76711 38985455
GSS130 72182 50691056
GSS131 74150 50385190
GSS132 84053 59900200
GSS133 80797 58678071
GSS134 69352 55920196
GSS135 71355 55437777
GSS136 75855 67842956
GSS137 75720 62415002
GSS138 77177 52454794
GSS139 86384 53687867
GSS14 71315 32132476
GSS140 94682 58087976
GSS141 93197 60032496
GSS142 81857 53641452
GSS143 88696 51262248
GSS144 74377 58452521
GSS145 114872 59716361
GSS146 110104 58695541
GSS147 86899 63131193
GSS148 52237 29990469
GSS149 67778 48213405
GSS15 70026 34720280
GSS150 73000 55888822
GSS151 72979 55923934
GSS152 73001 55887748
GSS153 73013 55865819
GSS154 72972 55936122
GSS155 72977 55929907
GSS156 75716 57531452
GSS157 83991 39610966
GSS158 88396 60280594
GSS159 85807 65768044
GSS16 78504 46313034
GSS160 88887 58894462
GSS161 87398 56742222
GSS162 85799 61166168
GSS163 82726 54296037
GSS164 93185 58717753
GSS165 88223 62505245
GSS166 84994 60390436
GSS167 114893 10559580
GSS168 90900 43422475
GSS169 72828 49299280
GSS17 70910 33291563
GSS170 46920 34292476
GSS171 64757 53637365
GSS172 58751 46322589
GSS173 58467 46819976
GSS174 57450 48918770
GSS175 57857 47631290
GSS176 58475 45730366
GSS177 58611 47132371
GSS178 58765 48990586
GSS179 58873 48656604
GSS18 59109 27963046
GSS180 58553 48909979
GSS181 58290 47160966
GSS182 58276 47231514
GSS183 59933 50535273
GSS184 60261 49876020
GSS185 60378 49555354
GSS186 60317 49735299
GSS187 60501 49183926
GSS188 60871 47927010
GSS189 58807 46426544
GSS19 56790 29081502
GSS190 58956 45979519
GSS191 58727 46698720
GSS192 58967 45949260
GSS193 58479 47477332
GSS194 58289 48071419
GSS195 58280 48098895
GSS196 59283 49368450
GSS197 59863 50801589
GSS198 59883 50473892
GSS199 60490 46318072
GSS2 88895 39291144
GSS20 57669 26710654
GSS200 60654 45819964
GSS201 59333 49895455
GSS202 59599 49093784
GSS203 59434 49593729
GSS204 59554 49228325
GSS205 59413 49660861
GSS206 59690 48814521
GSS207 59650 48937070
GSS208 59635 48981772
GSS209 59743 48652190
GSS21 61396 28908418
GSS210 59367 47025021
GSS211 59062 45359459
GSS212 58502 47209759
GSS213 58205 48275538
GSS214 58624 46963858
GSS215 58104 47541846
GSS216 61332 51099806
GSS217 64819 54766451
GSS218 81614 60031827
GSS219 94551 51072214
GSS22 64820 38304256
GSS220 76419 55171280
GSS221 58083 41512654
GSS222 86842 64244408
GSS223 83568 62773355
GSS224 103053 48151609
GSS225 68650 58534221
GSS226 68310 58772205
GSS227 69366 56632569
GSS228 69633 56114651
GSS229 70340 55385086
GSS23 57539 27052676
GSS230 85849 73194532
GSS231 86389 44988051
GSS232 88403 46749722
GSS233 85025 64872278
GSS234 70296 58979389
GSS235 69872 59837496
GSS236 63607 60977067
GSS237 81622 47098204
GSS238 87209 35427185
GSS239 107556 82017418
GSS24 66036 41986592
GSS240 105281 69753292
GSS241 84164 34109038
GSS242 119873 73717511
GSS243 120121 73724456
GSS244 116004 75289726
GSS245 94897 51453576
GSS246 87227 55368798
GSS247 98868 65301246
GSS248 107907 77930899
GSS249 107229 78784169
GSS25 68326 28371748
GSS250 105856 80256189
GSS251 97340 72912906
GSS252 83375 54566636
GSS253 110409 67141694
GSS254 110221 65995908
GSS255 104912 56835702
GSS256 75986 43313827
GSS257 105919 50543484
GSS258 89671 52586585
GSS259 95509 69129819
GSS26 58187 25327102
GSS260 95160 67465315
GSS261 95939 36482695
GSS262 95351 37383494
GSS263 96738 35052080
GSS264 94457 38879468
GSS265 90312 60586202
GSS266 83858 28316006
GSS267 84378 27360618
GSS268 85108 25882102
GSS269 37444 15064493
GSS27 65186 31867853
GSS28 65623 32569699
GSS29 76978 39592401
GSS3 87416 41795456
GSS30 83004 39735582
GSS31 74195 40404585
GSS32 70533 48274699
GSS33 79789 37825108
GSS34 75880 40336511
GSS35 74074 40136782
GSS36 87317 55909484
GSS37 87597 58174401
GSS38 85507 44951957
GSS39 86905 50545192
GSS4 78838 41008614
GSS40 86244 40182942
GSS41 83171 31604371
GSS42 81244 56937434
GSS43 80222 58198920
GSS44 72028 47495428
GSS45 72032 47436827
GSS46 77569 45748576
GSS47 77822 38557783
GSS48 83155 57943287
GSS49 86566 64537297
GSS5 78747 40519938
GSS50 81483 54638073
GSS51 93926 59204766
GSS52 88459 58725253
GSS53 76854 42642208
GSS54 72569 40124952
GSS55 86674 47379595
GSS56 88001 58235688
GSS57 76649 64030439
GSS58 70896 78092113
GSS59 85581 69204591
GSS6 78141 38864047
GSS60 89668 60323227
GSS61 63456 44763902
GSS62 65927 45345697
GSS63 89628 67158924
GSS64 84980 58459898
GSS65 86095 53001093
GSS66 85507 55706638
GSS67 93310 57873632
GSS68 97860 52533914
GSS69 97540 52958293
GSS7 77748 39090714
GSS70 98226 52049730
GSS71 99179 50787162
GSS72 99191 50770367
GSS73 99078 50921246
GSS74 99710 50082506
GSS75 97774 52646958
GSS76 91883 64612747
GSS77 89867 70738253
GSS78 88915 70112792
GSS79 87858 69635763
GSS8 75695 38114064
GSS80 87871 64029983
GSS81 88379 44981344
GSS82 78286 23247997
GSS83 78138 23604013
GSS84 84277 48814777
GSS85 77142 45683240
GSS86 88991 56037733
GSS87 84344 58665838
GSS88 76383 76702714
GSS89 79404 73243217
GSS9 72089 37168596
GSS90 84394 46535974
GSS91 84876 49467337
GSS92 75557 41818758
GSS93 79425 56644570
GSS94 77050 56484467
GSS95 81817 53524115
GSS96 84340 58507277
GSS97 85451 57660923
GSS98 87354 52202985
GSS99 81480 66890360
HTC1 24998 26954222
HTC10 64843 83528569
HTC11 68088 59318953
HTC12 46922 51530190
HTC2 15992 36011948
HTC3 15970 36547861
HTC4 16191 35357336
HTC5 15927 40313070
HTC6 16010 37271080
HTC7 51147 28230036
HTC8 81402 60491874
HTC9 75984 71601272
HTG1 1318 188929277
HTG10 1300 186477873
HTG100 1125 190505385
HTG101 1172 191198179
HTG102 671 84065768
HTG11 1437 184181984
HTG12 883 191839640
HTG13 751 192405888
HTG14 743 192235638
HTG15 782 192340544
HTG16 803 192110055
HTG17 768 192308108
HTG18 2056 171274467
HTG19 1050 187938699
HTG2 2465 186071856
HTG20 994 189114630
HTG21 782 191981791
HTG22 924 190472464
HTG23 903 190655876
HTG24 807 191465187
HTG25 779 192005274
HTG26 859 191462215
HTG27 888 190846826
HTG28 948 189939151
HTG29 897 191105192
HTG3 2517 185290576
HTG30 927 190434883
HTG31 874 191415178
HTG32 968 189728660
HTG33 878 191333161
HTG34 858 191433492
HTG35 826 191923499
HTG36 934 190318494
HTG37 938 190676343
HTG38 937 190378460
HTG39 1035 189487656
HTG4 2553 188532563
HTG40 1187 187235126
HTG41 1250 188074685
HTG42 1188 188224976
HTG43 1161 187342303
HTG44 1104 191576242
HTG45 1278 190787148
HTG46 1178 191117438
HTG47 1135 191255628
HTG48 1041 191160481
HTG49 928 189480596
HTG5 1284 185715991
HTG50 1055 189820926
HTG51 900 189594186
HTG52 1045 189744306
HTG53 925 189640581
HTG54 1000 189364350
HTG55 913 189302152
HTG56 974 189092354
HTG57 1082 188691536
HTG58 978 189470011
HTG59 1120 185699611
HTG6 1274 185234665
HTG60 1072 189098117
HTG61 1001 189166058
HTG62 997 188852206
HTG63 980 189147736
HTG64 1118 188925999
HTG65 1127 187464157
HTG66 1288 184414120
HTG67 1229 185445143
HTG68 1237 184701586
HTG69 1250 184650415
HTG7 1277 185414872
HTG70 1224 186848678
HTG71 1411 186369416
HTG72 1239 189366860
HTG73 1115 191205222
HTG74 1205 191731325
HTG75 1136 190981298
HTG76 1139 191201972
HTG77 1196 191002883
HTG78 1144 191362999
HTG79 1217 190738899
HTG8 1459 184762119
HTG80 1140 191038055
HTG81 1140 191415068
HTG82 1305 188890437
HTG83 1230 190051286
HTG84 1186 191379917
HTG85 1196 190915183
HTG86 1197 190366986
HTG87 1333 189758990
HTG88 1294 189615206
HTG89 1304 189838039
HTG9 1200 186999351
HTG90 1233 190301927
HTG91 1266 189942304
HTG92 1064 188878981
HTG93 1345 188557939
HTG94 1326 188927165
HTG95 1039 193049880
HTG96 770 169606657
HTG97 1062 193702378
HTG98 1114 192493006
HTG99 1043 189058888
INV1 41846 124153577
INV10 68876 82301068
INV11 14221 59703479
INV2 1725 181286224
INV3 2294 142669799
INV4 71802 80062529
INV5 59862 89018105
INV6 39018 106605304
INV7 81000 72193336
INV8 63263 85589575
INV9 86429 63869537
MAM1 19702 156968509
MAM2 66694 75678820
MAM3 58583 110064934
MAM4 4307 4854190
PAT1 222610 70141260
PAT10 125437 99518322
PAT11 141739 62608396
PAT12 105795 59941764
PAT13 103555 50226564
PAT14 121472 53274905
PAT15 113046 61292248
PAT16 145018 54899867
PAT17 155517 69893240
PAT18 97490 122598017
PAT19 147594 87373130
PAT2 194518 84655123
PAT20 117407 104542066
PAT21 123717 103465007
PAT22 119286 106149134
PAT23 126113 100478737
PAT24 97376 79764286
PAT25 95150 85871048
PAT26 117877 63591510
PAT27 97947 79983103
PAT28 124026 66183403
PAT29 134260 114801558
PAT3 171984 95898893
PAT30 177445 92934820
PAT31 43225 10448522
PAT4 153750 106059356
PAT5 184018 85619906
PAT6 156356 93378118
PAT7 152402 81705440
PAT8 104672 119401279
PAT9 143543 89226955
PHG 3544 25916110
PLN1 50811 102921297
PLN10 17614 135204576
PLN11 18532 152146359
PLN12 18379 152515202
PLN13 19424 150684272
PLN14 1292 165360818
PLN15 1321 168425220
PLN16 56 169476527
PLN17 7 192317431
PLN18 45901 90700303
PLN19 77795 78069623
PLN2 1456 168798438
PLN20 77741 76048998
PLN21 31202 108931821
PLN22 28254 136541799
PLN23 78804 75382536
PLN24 99609 59756798
PLN25 78877 78088450
PLN26 35550 67250920
PLN3 1676 182965345
PLN4 10212 161076381
PLN5 74882 80980465
PLN6 73502 77941968
PLN7 47664 55452220
PLN8 35880 68594657
PLN9 16335 138371611
PRI1 29743 121692971
PRI10 1469 183014562
PRI11 1270 178782324
PRI12 1459 178406528
PRI13 1604 179913583
PRI14 1620 182096882
PRI15 1231 192530290
PRI16 1137 193941234
PRI17 1121 194281336
PRI18 7677 180450875
PRI19 46392 115681984
PRI2 1628 172387506
PRI20 61556 78551610
PRI21 22705 123030996
PRI22 2673 179680973
PRI23 2068 182470066
PRI24 1631 182747330
PRI25 2113 182227812
PRI26 3634 177144863
PRI27 10333 162647266
PRI28 22742 143480868
PRI29 51455 81097207
PRI3 1334 184541565
PRI30 33031 63405324
PRI31 11649 160355259
PRI32 59392 106734894
PRI33 56890 91556540
PRI34 36844 66315037
PRI4 1313 184897615
PRI5 1194 181562480
PRI6 1192 178920777
PRI7 1233 181330805
PRI8 1314 175397424
PRI9 1241 175363425
ROD1 10968 166610663
ROD10 975 182155621
ROD11 1030 186498281
ROD12 959 183569550
ROD13 1023 187471174
ROD14 955 181076200
ROD15 964 182175547
ROD16 1034 186206096
ROD17 21566 156866157
ROD18 15518 156608852
ROD19 1159 184134049
ROD2 924 174227554
ROD20 1166 184084569
ROD21 28005 139434098
ROD22 31479 67871380
ROD23 8440 160892586
ROD24 60368 127551053
ROD25 122222 41715282
ROD26 10696 12899956
ROD3 909 173967764
ROD4 904 174052603
ROD5 926 173983771
ROD6 984 181059271
ROD7 973 179871005
ROD8 987 181761239
ROD9 1010 182995158
STS1 84179 36140922
STS10 57832 44837061
STS11 57928 43636816
STS12 64507 43021997
STS13 86587 36288945
STS14 69810 30946645
STS2 84042 48183190
STS3 69749 27467856
STS4 78991 37516123
STS5 54786 32165500
STS6 54865 31902640
STS7 54669 32203563
STS8 55688 35654923
STS9 57896 44459889
SYN1 51570 69304136
SYN2 2858 6201555
UNA 211 114018
VRL1 72267 65796916
VRL2 70886 63958030
VRL3 71087 66178902
VRL4 69673 67533219
VRL5 57650 73256123
VRL6 62201 72707766
VRL7 69737 69693428
VRL8 23970 23436449
VRT1 19586 162340859
VRT10 9830 179654592
VRT11 9223 178247119
VRT12 5056 185440302
VRT13 68649 87716093
VRT14 58603 53480631
VRT2 53748 113912125
VRT3 20018 157047405
VRT4 65438 90493007
VRT5 53293 65913173
VRT6 20743 119939640
VRT7 1222 191632682
VRT8 1276 191203470
VRT9 8905 179136574
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 162.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11160616 12761442950 Homo sapiens
7208491 8315316302 Mus musculus
1303312 5775613825 Rattus norvegicus
2863887 4010324625 Zea mays
2039264 3816951705 Bos taurus
1561283 2779172864 Danio rerio
2115431 2073935676 Sus scrofa
1183399 1522933162 Oryza sativa (japonica cultivar-group)
227838 1352480651 Strongylocentrotus purpuratus
1417896 1135837233 Xenopus tropicalis
212468 954048961 Pan troglodytes
736802 898809999 Drosophila melanogaster
1950853 880586059 Arabidopsis thaliana
802551 861683460 Gallus gallus
513445 829261560 Vitis vinifera
76143 753282513 Macaca mulatta
1221041 698061628 Canis lupus familiaris
1006311 657645257 Sorghum bicolor
1102789 655515953 Triticum aestivum
417424 526984387 Medicago truncatula
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2007
NCBI-GenBank Flat File Release 162.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 162.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko
Database Administration
Slava Khotomliansky, Ben Slade, Angela Tirone
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
