Release Notes For GenBank Release 163
GBREL.TXT Genetic Sequence Data Bank
December 15 2007
NCBI-GenBank Flat File Release 163.0
Distribution Release Notes
80388382 loci, 83874179730 bases, from 80388382 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 163.0
1.2 Cutoff Date
1.3 Important Changes in Release 163.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 163.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 163.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 163.0, incorporates data available to the collaborating
databases as of December 17, 2007 at approximately 1:30am EST. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 163.0
1.3.1 CON division changes and impact on FASTA file
The changes to the processing of CON (CONstructed) division ASN.1 files
(gbcon*.aso) which occurred for GenBank Release 162.0 significantly
impacted the size of the protein FASTA file which accompanies our releases
(for example: rel163.fsa_aa.gz) .
The many proteins associated with CON records for the AACY WGS project
caused the size of the FASTA file to double, from 2GB to over 4GB .
Some users have less interest in CON-division proteins, so an additional
file has been made available for their use:
compressed uncompressed ratio uncompressed_name
876480857 2158008959 59.4% no_CON.rel163.fsa_aa
A longer term solution will involve the generation of separate protein
FASTA files for the various divisions of GenBank, similar to what is now
done for Quality Score files. That step will be taken for the February 2008
GenBank releaase. Support for the 'monolithic' protein FASTA files will
then be discontinued, but not before August 2008.
For further details about the changes to CON-division processing, please
see Section 1.3 of these release notes:
ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb161.release.notes
ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb162.release.notes
1.3.2 Organizational changes
The total number of sequence data files increased by 25 with this release:
- the BCT division is now comprised of 26 files (+1)
- the CON division is now comprised of 84 files (+1)
- the EST division is now comprised of 675 files (+26)
- the GSS division is now comprised of 295 files (+26)
- the HTG division is now comprised of 105 files (+3)
- the PAT division is now comprised of 34 files (+3)
- the PLN division is now comprised of 27 files (+1)
- the VRT division is now comprised of 15 files (+1)
The total number of index files increased by 1 with this release:
- the JOU (JOURNAL Citation) index is now comprised of 5 files (+1)
1.3.3 New /culture_collection and /bio_material qualifiers
As of the December 2007 GenBank release, new qualifiers /culture_collection
and /bio_material qualifiers are legal for the source feature. Their
definitions are:
Qualifier /culture_collection=
Definition institution code and identifier for the culture from which the
nucleic acid sequenced was obtained, with optional collection
code.
Value format "<institution-code>:[<collection-code>:]<culture_id>"
Example /culture_collection="ATCC:26370"
Comment the /culture_collection qualifier should be used to annotate
live microbial and viral cultures, and cell lines that have been
deposited in curated culture collections; microbial cultures in
personal or laboratory collections should be annotated in strain
qualifiers;
annotation with a culture_collection qualifier implies that the
sequence was obtained from a sample retrieved (by the submitter
or a collaborator) from the indicated culture collection, or
that the sequence was obtained from a sample that was deposited
(by the submitter or a collaborator) in the indicated culture
collection; annotation with more than one culture_collection
qualifier indicates that the sequence was obtained from a sample
that was deposited (by the submitter or a collaborator) in more
than one culture collection.
culture_id and institution_code are mandatory, collection_code
is optional;
the /culture_collection qualifier becomes legal on 15-Dec-2007;
Qualifier /bio_material=
Definition identifier for the biological material from which the nucleic
acid sequenced was obtained, with optional institution code and
collection code for the place where it is currently stored.
Value format "[<institution-code>:[<collection-code>:]]<material_id>"
Example /bio_material="CGC:CB3912" <- Caenorhabditis stock centre
Comment the bio_material qualifier should be used to annotate the
identifiers of material in biological collections that are not
appropriate to annotate as either /specimen_voucher or
/culture_collection; these include zoos and aquaria, stock
centres, seed banks, germplasm repositories and DNA banks;
material_id is mandatory, institution_code and collection_code
are optional; institution code is mandatory where collection
code is present;
the /bio_material qualifier becomes legal on 15-Dec-2007;
1.3.4 New tmRNA feature and /peptide_tag qualifier
To support the annotation of a class of RNAs that have dual
tRNA-like and mRNA-like behaviors, a new tmRNA feature has been
added to the Feature Table as of December 2007. The "tmRNA Website"
at Indiana University provides some background information about
the unusual biology of tmRNAs :
http://www.indiana.edu/~tmrna/
Here is the definition of the new tmRNA feature:
Feature Key tmRNA
Definition transfer messenger RNA; tmRNA acts as a tRNA first,
and then as an mRNA that encodes a peptide tag; the
ribosome translates this mRNA region of tmRNA and attaches
the encoded peptide tag to the C-terminus of the
unfinished protein; this attached tag targets the protein for
destruction or proteolysis;
Optional qualifiers /allele="text"
/citation=[number]
/db_xref="<database>:<identifier>"
/experiment="text"
/function="text"
/gene="text"
/inference="TYPE[ (same species)][:EVIDENCE_BASIS]"
/label=feature_label
/locus_tag="text" (single token)
/map="text"
/note="text"
/old_locus_tag="text" (single token)
/product="text"
/pseudo
/standard_name="text"
/tag_peptide=<base_range>
Comment the tmRNA feature key will become valid on 15-Dec-2007
To indicate the nucleotide region encoding the proteolysis tag
peptide, a new /tag_peptide qualifier has been introduced for
use with the tmRNA feature. The definition of /tag_peptide is:
Qualifier /tag_peptide=
Definition base location encoding the polypeptide for proteolysis tag of
tmRNA and its termination codon;
Value format <base_range>
Example /tag_peptide=90..122
Comment it is recommended that the amino acid sequence corresponding
to the /tag_peptide be annotated by describing a 5' partial
CDS feature; e.g. CDS <90..122;
the /tag_peptide qualifier (and tmRNA feature) will become
valid on 15-Dec-2007
1.3.5 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.6 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
forty-eight of the GSS flatfiles in Release 163.0. Consider gbgss248.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
December 15 2007
NCBI-GenBank Flat File Release 163.0
GSS Sequences (Part 1)
86843 loci, 64232072 bases, from 86843 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "248" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 Divisional protein FASTA files
As a convenience for users, separate protein FASTA files for the various
divisions of GenBank will be generated as of the February 2008 release.
These files will be placed in a new subdirectory ( aa_fasta/ ), and will
utilize this file-naming convention:
gb*.aa_fsa.gz
The current, single, protein FASTA file (relxxx.aa_fsa.gz) now exceeds 4GB
in size, and has become too unwieldy for users to process.
This change is similar to what is now being done for Quality Score files
in the quality_scores/ subdirectory.
Support for the single protein FASTA file will be discontinued, but not
before August of 2008. If that timetable poses problems, please let us know
at the NCBI Service Desk:
[email protected]
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1449 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut5.idx - Index of the entries according to author name, part 5.
48. gbaut6.idx - Index of the entries according to author name, part 6.
49. gbaut7.idx - Index of the entries according to author name, part 7.
50. gbaut8.idx - Index of the entries according to author name, part 8.
51. gbaut9.idx - Index of the entries according to author name, part 9.
52. gbbct1.seq - Bacterial sequence entries, part 1.
53. gbbct10.seq - Bacterial sequence entries, part 10.
54. gbbct11.seq - Bacterial sequence entries, part 11.
55. gbbct12.seq - Bacterial sequence entries, part 12.
56. gbbct13.seq - Bacterial sequence entries, part 13.
57. gbbct14.seq - Bacterial sequence entries, part 14.
58. gbbct15.seq - Bacterial sequence entries, part 15.
59. gbbct16.seq - Bacterial sequence entries, part 16.
60. gbbct17.seq - Bacterial sequence entries, part 17.
61. gbbct18.seq - Bacterial sequence entries, part 18.
62. gbbct19.seq - Bacterial sequence entries, part 19.
63. gbbct2.seq - Bacterial sequence entries, part 2.
64. gbbct20.seq - Bacterial sequence entries, part 20.
65. gbbct21.seq - Bacterial sequence entries, part 21.
66. gbbct22.seq - Bacterial sequence entries, part 22.
67. gbbct23.seq - Bacterial sequence entries, part 23.
68. gbbct24.seq - Bacterial sequence entries, part 24.
69. gbbct25.seq - Bacterial sequence entries, part 25.
70. gbbct26.seq - Bacterial sequence entries, part 26.
71. gbbct3.seq - Bacterial sequence entries, part 3.
72. gbbct4.seq - Bacterial sequence entries, part 4.
73. gbbct5.seq - Bacterial sequence entries, part 5.
74. gbbct6.seq - Bacterial sequence entries, part 6.
75. gbbct7.seq - Bacterial sequence entries, part 7.
76. gbbct8.seq - Bacterial sequence entries, part 8.
77. gbbct9.seq - Bacterial sequence entries, part 9.
78. gbchg.txt - Accession numbers of entries updated since the previous release.
79. gbcon1.seq - Constructed sequence entries, part 1.
80. gbcon10.seq - Constructed sequence entries, part 10.
81. gbcon11.seq - Constructed sequence entries, part 11.
82. gbcon12.seq - Constructed sequence entries, part 12.
83. gbcon13.seq - Constructed sequence entries, part 13.
84. gbcon14.seq - Constructed sequence entries, part 14.
85. gbcon15.seq - Constructed sequence entries, part 15.
86. gbcon16.seq - Constructed sequence entries, part 16.
87. gbcon17.seq - Constructed sequence entries, part 17.
88. gbcon18.seq - Constructed sequence entries, part 18.
89. gbcon19.seq - Constructed sequence entries, part 19.
90. gbcon2.seq - Constructed sequence entries, part 2.
91. gbcon20.seq - Constructed sequence entries, part 20.
92. gbcon21.seq - Constructed sequence entries, part 21.
93. gbcon22.seq - Constructed sequence entries, part 22.
94. gbcon23.seq - Constructed sequence entries, part 23.
95. gbcon24.seq - Constructed sequence entries, part 24.
96. gbcon25.seq - Constructed sequence entries, part 25.
97. gbcon26.seq - Constructed sequence entries, part 26.
98. gbcon27.seq - Constructed sequence entries, part 27.
99. gbcon28.seq - Constructed sequence entries, part 28.
100. gbcon29.seq - Constructed sequence entries, part 29.
101. gbcon3.seq - Constructed sequence entries, part 3.
102. gbcon30.seq - Constructed sequence entries, part 30.
103. gbcon31.seq - Constructed sequence entries, part 31.
104. gbcon32.seq - Constructed sequence entries, part 32.
105. gbcon33.seq - Constructed sequence entries, part 33.
106. gbcon34.seq - Constructed sequence entries, part 34.
107. gbcon35.seq - Constructed sequence entries, part 35.
108. gbcon36.seq - Constructed sequence entries, part 36.
109. gbcon37.seq - Constructed sequence entries, part 37.
110. gbcon38.seq - Constructed sequence entries, part 38.
111. gbcon39.seq - Constructed sequence entries, part 39.
112. gbcon4.seq - Constructed sequence entries, part 4.
113. gbcon40.seq - Constructed sequence entries, part 40.
114. gbcon41.seq - Constructed sequence entries, part 41.
115. gbcon42.seq - Constructed sequence entries, part 42.
116. gbcon43.seq - Constructed sequence entries, part 43.
117. gbcon44.seq - Constructed sequence entries, part 44.
118. gbcon45.seq - Constructed sequence entries, part 45.
119. gbcon46.seq - Constructed sequence entries, part 46.
120. gbcon47.seq - Constructed sequence entries, part 47.
121. gbcon48.seq - Constructed sequence entries, part 48.
122. gbcon49.seq - Constructed sequence entries, part 49.
123. gbcon5.seq - Constructed sequence entries, part 5.
124. gbcon50.seq - Constructed sequence entries, part 50.
125. gbcon51.seq - Constructed sequence entries, part 51.
126. gbcon52.seq - Constructed sequence entries, part 52.
127. gbcon53.seq - Constructed sequence entries, part 53.
128. gbcon54.seq - Constructed sequence entries, part 54.
129. gbcon55.seq - Constructed sequence entries, part 55.
130. gbcon56.seq - Constructed sequence entries, part 56.
131. gbcon57.seq - Constructed sequence entries, part 57.
132. gbcon58.seq - Constructed sequence entries, part 58.
133. gbcon59.seq - Constructed sequence entries, part 59.
134. gbcon6.seq - Constructed sequence entries, part 6.
135. gbcon60.seq - Constructed sequence entries, part 60.
136. gbcon61.seq - Constructed sequence entries, part 61.
137. gbcon62.seq - Constructed sequence entries, part 62.
138. gbcon63.seq - Constructed sequence entries, part 63.
139. gbcon64.seq - Constructed sequence entries, part 64.
140. gbcon65.seq - Constructed sequence entries, part 65.
141. gbcon66.seq - Constructed sequence entries, part 66.
142. gbcon67.seq - Constructed sequence entries, part 67.
143. gbcon68.seq - Constructed sequence entries, part 68.
144. gbcon69.seq - Constructed sequence entries, part 69.
145. gbcon7.seq - Constructed sequence entries, part 7.
146. gbcon70.seq - Constructed sequence entries, part 70.
147. gbcon71.seq - Constructed sequence entries, part 71.
148. gbcon72.seq - Constructed sequence entries, part 72.
149. gbcon73.seq - Constructed sequence entries, part 73.
150. gbcon74.seq - Constructed sequence entries, part 74.
151. gbcon75.seq - Constructed sequence entries, part 75.
152. gbcon76.seq - Constructed sequence entries, part 76.
153. gbcon77.seq - Constructed sequence entries, part 77.
154. gbcon78.seq - Constructed sequence entries, part 78.
155. gbcon79.seq - Constructed sequence entries, part 79.
156. gbcon8.seq - Constructed sequence entries, part 8.
157. gbcon80.seq - Constructed sequence entries, part 80.
158. gbcon81.seq - Constructed sequence entries, part 81.
159. gbcon82.seq - Constructed sequence entries, part 82.
160. gbcon83.seq - Constructed sequence entries, part 83.
161. gbcon84.seq - Constructed sequence entries, part 84.
162. gbcon9.seq - Constructed sequence entries, part 9.
163. gbdel.txt - Accession numbers of entries deleted since the previous release.
164. gbenv1.seq - Environmental sampling sequence entries, part 1.
165. gbenv2.seq - Environmental sampling sequence entries, part 2.
166. gbenv3.seq - Environmental sampling sequence entries, part 3.
167. gbenv4.seq - Environmental sampling sequence entries, part 4.
168. gbenv5.seq - Environmental sampling sequence entries, part 5.
169. gbenv6.seq - Environmental sampling sequence entries, part 6.
170. gbenv7.seq - Environmental sampling sequence entries, part 7.
171. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
172. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
173. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
174. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
175. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
176. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
177. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
178. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
179. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
180. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
181. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
182. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
183. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
184. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
185. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
186. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
187. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
188. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
189. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
190. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
191. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
192. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
193. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
194. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
195. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
196. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
197. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
198. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
199. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
200. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
201. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
202. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
203. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
204. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
205. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
206. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
207. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
208. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
209. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
210. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
211. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
212. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
213. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
214. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
215. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
216. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
217. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
218. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
219. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
220. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
221. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
222. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
223. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
224. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
225. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
226. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
227. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
228. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
229. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
230. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
231. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
232. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
233. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
234. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
235. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
236. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
237. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
238. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
239. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
240. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
241. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
242. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
243. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
244. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
245. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
246. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
247. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
248. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
249. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
250. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
251. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
252. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
253. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
254. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
255. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
256. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
257. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
258. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
259. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
260. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
261. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
262. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
263. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
264. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
265. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
266. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
267. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
268. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
269. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
270. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
271. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
272. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
273. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
274. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
275. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
276. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
277. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
278. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
279. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
280. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
281. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
282. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
283. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
284. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
285. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
286. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
287. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
288. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
289. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
290. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
291. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
292. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
293. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
294. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
295. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
296. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
297. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
298. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
299. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
300. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
301. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
302. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
303. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
304. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
305. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
306. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
307. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
308. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
309. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
310. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
311. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
312. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
313. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
314. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
315. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
316. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
317. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
318. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
319. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
320. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
321. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
322. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
323. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
324. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
325. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
326. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
327. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
328. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
329. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
330. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
331. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
332. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
333. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
334. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
335. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
336. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
337. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
338. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
339. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
340. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
341. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
342. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
343. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
344. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
345. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
346. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
347. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
348. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
349. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
350. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
351. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
352. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
353. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
354. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
355. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
356. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
357. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
358. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
359. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
360. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
361. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
362. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
363. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
364. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
365. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
366. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
367. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
368. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
369. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
370. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
371. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
372. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
373. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
374. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
375. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
376. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
377. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
378. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
379. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
380. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
381. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
382. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
383. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
384. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
385. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
386. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
387. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
388. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
389. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
390. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
391. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
392. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
393. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
394. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
395. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
396. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
397. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
398. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
399. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
400. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
401. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
402. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
403. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
404. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
405. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
406. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
407. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
408. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
409. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
410. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
411. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
412. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
413. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
414. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
415. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
416. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
417. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
418. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
419. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
420. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
421. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
422. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
423. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
424. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
425. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
426. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
427. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
428. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
429. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
430. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
431. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
432. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
433. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
434. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
435. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
436. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
437. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
438. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
439. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
440. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
441. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
442. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
443. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
444. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
445. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
446. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
447. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
448. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
449. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
450. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
451. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
452. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
453. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
454. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
455. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
456. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
457. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
458. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
459. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
460. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
461. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
462. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
463. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
464. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
465. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
466. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
467. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
468. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
469. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
470. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
471. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
472. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
473. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
474. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
475. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
476. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
477. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
478. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
479. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
480. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
481. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
482. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
483. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
484. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
485. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
486. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
487. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
488. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
489. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
490. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
491. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
492. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
493. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
494. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
495. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
496. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
497. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
498. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
499. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
500. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
501. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
502. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
503. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
504. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
505. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
506. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
507. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
508. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
509. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
510. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
511. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
512. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
513. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
514. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
515. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
516. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
517. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
518. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
519. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
520. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
521. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
522. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
523. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
524. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
525. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
526. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
527. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
528. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
529. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
530. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
531. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
532. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
533. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
534. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
535. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
536. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
537. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
538. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
539. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
540. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
541. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
542. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
543. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
544. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
545. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
546. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
547. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
548. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
549. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
550. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
551. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
552. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
553. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
554. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
555. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
556. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
557. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
558. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
559. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
560. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
561. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
562. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
563. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
564. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
565. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
566. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
567. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
568. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
569. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
570. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
571. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
572. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
573. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
574. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
575. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
576. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
577. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
578. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
579. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
580. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
581. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
582. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
583. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
584. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
585. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
586. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
587. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
588. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
589. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
590. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
591. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
592. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
593. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
594. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
595. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
596. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
597. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
598. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
599. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
600. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
601. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
602. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
603. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
604. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
605. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
606. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
607. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
608. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
609. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
610. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
611. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
612. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
613. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
614. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
615. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
616. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
617. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
618. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
619. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
620. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
621. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
622. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
623. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
624. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
625. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
626. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
627. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
628. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
629. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
630. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
631. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
632. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
633. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
634. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
635. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
636. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
637. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
638. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
639. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
640. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
641. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
642. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
643. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
644. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
645. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
646. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
647. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
648. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
649. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
650. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
651. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
652. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
653. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
654. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
655. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
656. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
657. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
658. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
659. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
660. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
661. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
662. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
663. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
664. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
665. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
666. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
667. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
668. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
669. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
670. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
671. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
672. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
673. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
674. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
675. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
676. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
677. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
678. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
679. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
680. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
681. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
682. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
683. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
684. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
685. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
686. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
687. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
688. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
689. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
690. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
691. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
692. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
693. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
694. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
695. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
696. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
697. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
698. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
699. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
700. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
701. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
702. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
703. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
704. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
705. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
706. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
707. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
708. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
709. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
710. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
711. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
712. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
713. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
714. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
715. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
716. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
717. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
718. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
719. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
720. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
721. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
722. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
723. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
724. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
725. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
726. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
727. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
728. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
729. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
730. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
731. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
732. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
733. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
734. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
735. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
736. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
737. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
738. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
739. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
740. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
741. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
742. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
743. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
744. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
745. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
746. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
747. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
748. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
749. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
750. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
751. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
752. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
753. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
754. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
755. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
756. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
757. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
758. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
759. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
760. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
761. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
762. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
763. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
764. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
765. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
766. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
767. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
768. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
769. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
770. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
771. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
772. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
773. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
774. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
775. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
776. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
777. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
778. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
779. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
780. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
781. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
782. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
783. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
784. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
785. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
786. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
787. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
788. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
789. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
790. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
791. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
792. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
793. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
794. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
795. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
796. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
797. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
798. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
799. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
800. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
801. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
802. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
803. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
804. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
805. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
806. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
807. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
808. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
809. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
810. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
811. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
812. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
813. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
814. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
815. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
816. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
817. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
818. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
819. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
820. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
821. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
822. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
823. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
824. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
825. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
826. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
827. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
828. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
829. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
830. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
831. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
832. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
833. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
834. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
835. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
836. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
837. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
838. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
839. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
840. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
841. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
842. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
843. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
844. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
845. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
846. gbgen.idx - Index of the entries according to gene symbols.
847. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
848. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
849. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
850. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
851. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
852. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
853. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
854. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
855. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
856. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
857. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
858. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
859. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
860. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
861. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
862. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
863. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
864. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
865. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
866. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
867. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
868. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
869. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
870. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
871. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
872. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
873. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
874. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
875. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
876. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
877. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
878. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
879. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
880. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
881. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
882. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
883. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
884. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
885. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
886. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
887. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
888. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
889. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
890. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
891. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
892. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
893. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
894. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
895. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
896. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
897. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
898. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
899. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
900. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
901. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
902. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
903. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
904. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
905. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
906. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
907. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
908. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
909. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
910. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
911. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
912. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
913. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
914. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
915. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
916. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
917. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
918. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
919. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
920. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
921. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
922. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
923. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
924. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
925. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
926. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
927. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
928. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
929. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
930. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
931. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
932. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
933. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
934. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
935. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
936. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
937. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
938. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
939. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
940. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
941. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
942. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
943. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
944. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
945. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
946. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
947. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
948. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
949. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
950. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
951. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
952. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
953. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
954. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
955. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
956. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
957. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
958. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
959. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
960. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
961. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
962. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
963. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
964. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
965. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
966. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
967. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
968. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
969. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
970. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
971. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
972. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
973. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
974. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
975. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
976. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
977. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
978. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
979. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
980. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
981. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
982. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
983. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
984. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
985. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
986. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
987. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
988. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
989. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
990. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
991. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
992. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
993. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
994. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
995. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
996. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
997. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
998. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
999. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1000. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1001. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1002. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1003. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1004. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1005. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1006. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1007. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1008. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1009. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1010. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1011. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1012. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1013. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1014. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1015. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1016. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1017. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1018. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1019. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1020. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1021. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1022. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1023. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1024. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1025. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1026. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1027. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1028. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1029. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1030. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1031. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1032. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1033. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1034. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1035. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1036. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1037. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1038. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1039. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1040. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1041. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1042. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1043. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1044. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1045. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1046. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1047. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1048. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1049. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1050. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1051. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1052. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1053. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1054. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1055. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1056. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1057. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1058. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1059. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1060. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1061. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1062. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1063. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1064. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1065. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1066. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1067. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1068. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1069. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1070. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1071. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1072. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1073. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1074. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1075. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1076. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1077. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1078. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1079. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1080. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1081. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1082. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1083. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1084. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1085. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1086. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1087. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1088. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1089. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1090. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1091. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1092. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1093. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1094. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1095. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1096. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1097. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1098. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1099. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1100. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1101. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1102. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1103. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1104. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1105. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1106. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1107. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1108. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1109. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1110. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1111. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1112. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1113. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1114. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1115. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1116. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1117. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1118. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1119. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1120. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1121. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1122. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1123. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1124. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1125. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1126. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1127. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1128. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1129. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1130. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1131. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1132. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1133. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1134. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1135. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1136. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1137. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1138. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1139. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1140. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1141. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1142. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1143. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1144. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1145. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1146. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1147. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1148. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1149. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1150. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1151. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1152. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1153. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1154. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1155. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1156. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1157. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1158. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1159. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1160. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1161. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1162. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1163. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1164. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1165. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1166. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1167. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1168. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1169. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1170. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1171. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1172. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1173. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1174. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1175. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1176. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1177. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1178. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1179. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1180. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1181. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1182. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1183. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1184. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1185. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1186. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1187. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1188. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1189. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1190. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1191. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1192. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1193. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1194. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1195. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1196. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1197. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1198. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1199. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1200. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1201. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1202. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1203. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1204. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1205. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1206. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1207. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1208. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1209. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1210. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1211. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1212. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1213. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1214. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1215. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1216. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1217. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1218. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1219. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1220. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1221. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1222. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1223. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1224. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1225. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1226. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1227. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1228. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1229. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1230. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1231. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1232. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1233. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1234. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1235. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1236. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1237. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1238. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1239. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1240. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1241. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1242. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1243. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1244. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1245. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1246. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1247. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1248. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1249. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1250. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1251. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1252. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1253. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1254. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1255. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1256. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1257. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1258. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1259. gbinv1.seq - Invertebrate sequence entries, part 1.
1260. gbinv10.seq - Invertebrate sequence entries, part 10.
1261. gbinv11.seq - Invertebrate sequence entries, part 11.
1262. gbinv2.seq - Invertebrate sequence entries, part 2.
1263. gbinv3.seq - Invertebrate sequence entries, part 3.
1264. gbinv4.seq - Invertebrate sequence entries, part 4.
1265. gbinv5.seq - Invertebrate sequence entries, part 5.
1266. gbinv6.seq - Invertebrate sequence entries, part 6.
1267. gbinv7.seq - Invertebrate sequence entries, part 7.
1268. gbinv8.seq - Invertebrate sequence entries, part 8.
1269. gbinv9.seq - Invertebrate sequence entries, part 9.
1270. gbjou1.idx - Index of the entries according to journal citation, part 1.
1271. gbjou2.idx - Index of the entries according to journal citation, part 2.
1272. gbjou3.idx - Index of the entries according to journal citation, part 3.
1273. gbjou4.idx - Index of the entries according to journal citation, part 4.
1274. gbjou5.idx - Index of the entries according to journal citation, part 5.
1275. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1276. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1277. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1278. gbmam1.seq - Other mammalian sequence entries, part 1.
1279. gbmam2.seq - Other mammalian sequence entries, part 2.
1280. gbmam3.seq - Other mammalian sequence entries, part 3.
1281. gbmam4.seq - Other mammalian sequence entries, part 4.
1282. gbnew.txt - Accession numbers of entries new since the previous release.
1283. gbpat1.seq - Patent sequence entries, part 1.
1284. gbpat10.seq - Patent sequence entries, part 10.
1285. gbpat11.seq - Patent sequence entries, part 11.
1286. gbpat12.seq - Patent sequence entries, part 12.
1287. gbpat13.seq - Patent sequence entries, part 13.
1288. gbpat14.seq - Patent sequence entries, part 14.
1289. gbpat15.seq - Patent sequence entries, part 15.
1290. gbpat16.seq - Patent sequence entries, part 16.
1291. gbpat17.seq - Patent sequence entries, part 17.
1292. gbpat18.seq - Patent sequence entries, part 18.
1293. gbpat19.seq - Patent sequence entries, part 19.
1294. gbpat2.seq - Patent sequence entries, part 2.
1295. gbpat20.seq - Patent sequence entries, part 20.
1296. gbpat21.seq - Patent sequence entries, part 21.
1297. gbpat22.seq - Patent sequence entries, part 22.
1298. gbpat23.seq - Patent sequence entries, part 23.
1299. gbpat24.seq - Patent sequence entries, part 24.
1300. gbpat25.seq - Patent sequence entries, part 25.
1301. gbpat26.seq - Patent sequence entries, part 26.
1302. gbpat27.seq - Patent sequence entries, part 27.
1303. gbpat28.seq - Patent sequence entries, part 28.
1304. gbpat29.seq - Patent sequence entries, part 29.
1305. gbpat3.seq - Patent sequence entries, part 3.
1306. gbpat30.seq - Patent sequence entries, part 30.
1307. gbpat31.seq - Patent sequence entries, part 31.
1308. gbpat32.seq - Patent sequence entries, part 32.
1309. gbpat33.seq - Patent sequence entries, part 33.
1310. gbpat34.seq - Patent sequence entries, part 34.
1311. gbpat4.seq - Patent sequence entries, part 4.
1312. gbpat5.seq - Patent sequence entries, part 5.
1313. gbpat6.seq - Patent sequence entries, part 6.
1314. gbpat7.seq - Patent sequence entries, part 7.
1315. gbpat8.seq - Patent sequence entries, part 8.
1316. gbpat9.seq - Patent sequence entries, part 9.
1317. gbphg.seq - Phage sequence entries.
1318. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1319. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1320. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1321. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1322. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1323. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1324. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1325. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1326. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1327. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1328. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1329. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1330. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1331. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1332. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1333. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1334. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1335. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1336. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1337. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1338. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1339. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1340. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1341. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1342. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1343. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1344. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1345. gbpri1.seq - Primate sequence entries, part 1.
1346. gbpri10.seq - Primate sequence entries, part 10.
1347. gbpri11.seq - Primate sequence entries, part 11.
1348. gbpri12.seq - Primate sequence entries, part 12.
1349. gbpri13.seq - Primate sequence entries, part 13.
1350. gbpri14.seq - Primate sequence entries, part 14.
1351. gbpri15.seq - Primate sequence entries, part 15.
1352. gbpri16.seq - Primate sequence entries, part 16.
1353. gbpri17.seq - Primate sequence entries, part 17.
1354. gbpri18.seq - Primate sequence entries, part 18.
1355. gbpri19.seq - Primate sequence entries, part 19.
1356. gbpri2.seq - Primate sequence entries, part 2.
1357. gbpri20.seq - Primate sequence entries, part 20.
1358. gbpri21.seq - Primate sequence entries, part 21.
1359. gbpri22.seq - Primate sequence entries, part 22.
1360. gbpri23.seq - Primate sequence entries, part 23.
1361. gbpri24.seq - Primate sequence entries, part 24.
1362. gbpri25.seq - Primate sequence entries, part 25.
1363. gbpri26.seq - Primate sequence entries, part 26.
1364. gbpri27.seq - Primate sequence entries, part 27.
1365. gbpri28.seq - Primate sequence entries, part 28.
1366. gbpri29.seq - Primate sequence entries, part 29.
1367. gbpri3.seq - Primate sequence entries, part 3.
1368. gbpri30.seq - Primate sequence entries, part 30.
1369. gbpri31.seq - Primate sequence entries, part 31.
1370. gbpri32.seq - Primate sequence entries, part 32.
1371. gbpri33.seq - Primate sequence entries, part 33.
1372. gbpri34.seq - Primate sequence entries, part 34.
1373. gbpri4.seq - Primate sequence entries, part 4.
1374. gbpri5.seq - Primate sequence entries, part 5.
1375. gbpri6.seq - Primate sequence entries, part 6.
1376. gbpri7.seq - Primate sequence entries, part 7.
1377. gbpri8.seq - Primate sequence entries, part 8.
1378. gbpri9.seq - Primate sequence entries, part 9.
1379. gbrel.txt - Release notes (this document).
1380. gbrod1.seq - Rodent sequence entries, part 1.
1381. gbrod10.seq - Rodent sequence entries, part 10.
1382. gbrod11.seq - Rodent sequence entries, part 11.
1383. gbrod12.seq - Rodent sequence entries, part 12.
1384. gbrod13.seq - Rodent sequence entries, part 13.
1385. gbrod14.seq - Rodent sequence entries, part 14.
1386. gbrod15.seq - Rodent sequence entries, part 15.
1387. gbrod16.seq - Rodent sequence entries, part 16.
1388. gbrod17.seq - Rodent sequence entries, part 17.
1389. gbrod18.seq - Rodent sequence entries, part 18.
1390. gbrod19.seq - Rodent sequence entries, part 19.
1391. gbrod2.seq - Rodent sequence entries, part 2.
1392. gbrod20.seq - Rodent sequence entries, part 20.
1393. gbrod21.seq - Rodent sequence entries, part 21.
1394. gbrod22.seq - Rodent sequence entries, part 22.
1395. gbrod23.seq - Rodent sequence entries, part 23.
1396. gbrod24.seq - Rodent sequence entries, part 24.
1397. gbrod25.seq - Rodent sequence entries, part 25.
1398. gbrod26.seq - Rodent sequence entries, part 26.
1399. gbrod3.seq - Rodent sequence entries, part 3.
1400. gbrod4.seq - Rodent sequence entries, part 4.
1401. gbrod5.seq - Rodent sequence entries, part 5.
1402. gbrod6.seq - Rodent sequence entries, part 6.
1403. gbrod7.seq - Rodent sequence entries, part 7.
1404. gbrod8.seq - Rodent sequence entries, part 8.
1405. gbrod9.seq - Rodent sequence entries, part 9.
1406. gbsdr1.txt - Short directory of the data bank, part 1.
1407. gbsdr2.txt - Short directory of the data bank, part 2.
1408. gbsdr3.txt - Short directory of the data bank, part 3.
1409. gbsec.idx - Index of the entries according to secondary accession number.
1410. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1411. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1412. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1413. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1414. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1415. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1416. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1417. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1418. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1419. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1420. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1421. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1422. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1423. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1424. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1425. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1426. gbuna.seq - Unannotated sequence entries.
1427. gbvrl1.seq - Viral sequence entries, part 1.
1428. gbvrl2.seq - Viral sequence entries, part 2.
1429. gbvrl3.seq - Viral sequence entries, part 3.
1430. gbvrl4.seq - Viral sequence entries, part 4.
1431. gbvrl5.seq - Viral sequence entries, part 5.
1432. gbvrl6.seq - Viral sequence entries, part 6.
1433. gbvrl7.seq - Viral sequence entries, part 7.
1434. gbvrl8.seq - Viral sequence entries, part 8.
1435. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1436. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1437. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1438. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1439. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1440. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1441. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1442. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1443. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1444. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1445. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1446. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1447. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1448. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1449. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 163.0 flatfiles require roughly 314 GB (sequence
files only) or 335 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
637205221 gbacc1.idx
1585355418 gbacc2.idx
562397622 gbacc3.idx
185011463 gbaut1.idx
222720442 gbaut10.idx
217800884 gbaut11.idx
217691553 gbaut12.idx
217374724 gbaut13.idx
224888958 gbaut14.idx
239984287 gbaut15.idx
223329638 gbaut16.idx
230505475 gbaut17.idx
218501762 gbaut18.idx
216049623 gbaut19.idx
253891974 gbaut2.idx
215056149 gbaut20.idx
216138612 gbaut21.idx
218997339 gbaut22.idx
222766299 gbaut23.idx
183382699 gbaut24.idx
184047823 gbaut25.idx
184565825 gbaut26.idx
184127702 gbaut27.idx
185687350 gbaut28.idx
188015837 gbaut29.idx
207119303 gbaut3.idx
183860588 gbaut30.idx
184192748 gbaut31.idx
184432341 gbaut32.idx
184096696 gbaut33.idx
183782527 gbaut34.idx
183510010 gbaut35.idx
183369486 gbaut36.idx
183691681 gbaut37.idx
183320219 gbaut38.idx
183426400 gbaut39.idx
246338956 gbaut4.idx
184755310 gbaut40.idx
183276533 gbaut41.idx
194086532 gbaut42.idx
190617023 gbaut43.idx
183442211 gbaut44.idx
184239477 gbaut45.idx
185060035 gbaut46.idx
183578910 gbaut47.idx
11892371 gbaut48.idx
184486048 gbaut5.idx
227665507 gbaut6.idx
215611192 gbaut7.idx
221952243 gbaut8.idx
219242825 gbaut9.idx
250481621 gbbct1.seq
251737887 gbbct10.seq
254082970 gbbct11.seq
251890180 gbbct12.seq
251780454 gbbct13.seq
252235852 gbbct14.seq
257623798 gbbct15.seq
253126448 gbbct16.seq
253516184 gbbct17.seq
255437350 gbbct18.seq
254820810 gbbct19.seq
255999842 gbbct2.seq
257217508 gbbct20.seq
267175021 gbbct21.seq
252636436 gbbct22.seq
250000320 gbbct23.seq
250002390 gbbct24.seq
250008705 gbbct25.seq
47600264 gbbct26.seq
251607956 gbbct3.seq
250000786 gbbct4.seq
256119921 gbbct5.seq
257889319 gbbct6.seq
252683022 gbbct7.seq
250000706 gbbct8.seq
252617921 gbbct9.seq
10322781 gbchg.txt
250095967 gbcon1.seq
250002136 gbcon10.seq
250000682 gbcon11.seq
250001715 gbcon12.seq
250001501 gbcon13.seq
250001298 gbcon14.seq
250009365 gbcon15.seq
250002598 gbcon16.seq
250002307 gbcon17.seq
250037752 gbcon18.seq
250005780 gbcon19.seq
251081426 gbcon2.seq
250002936 gbcon20.seq
250000132 gbcon21.seq
250001451 gbcon22.seq
250001075 gbcon23.seq
250004274 gbcon24.seq
250005690 gbcon25.seq
250001137 gbcon26.seq
250004667 gbcon27.seq
250003863 gbcon28.seq
250004340 gbcon29.seq
250434441 gbcon3.seq
250006948 gbcon30.seq
250000279 gbcon31.seq
250000515 gbcon32.seq
250002224 gbcon33.seq
250003898 gbcon34.seq
250002538 gbcon35.seq
250001911 gbcon36.seq
250000798 gbcon37.seq
250000126 gbcon38.seq
250004268 gbcon39.seq
250000250 gbcon4.seq
250004267 gbcon40.seq
250000474 gbcon41.seq
250002856 gbcon42.seq
250001056 gbcon43.seq
250004159 gbcon44.seq
250000800 gbcon45.seq
250004195 gbcon46.seq
250003695 gbcon47.seq
250002023 gbcon48.seq
250002963 gbcon49.seq
250000045 gbcon5.seq
250004905 gbcon50.seq
250000067 gbcon51.seq
250004232 gbcon52.seq
250001937 gbcon53.seq
250004818 gbcon54.seq
250002015 gbcon55.seq
250005631 gbcon56.seq
250000681 gbcon57.seq
250004440 gbcon58.seq
250002246 gbcon59.seq
250000777 gbcon6.seq
250003309 gbcon60.seq
250004097 gbcon61.seq
250004123 gbcon62.seq
250000326 gbcon63.seq
250002339 gbcon64.seq
250002520 gbcon65.seq
250001696 gbcon66.seq
250004425 gbcon67.seq
250004014 gbcon68.seq
250005222 gbcon69.seq
250000437 gbcon7.seq
250000584 gbcon70.seq
250006015 gbcon71.seq
250001180 gbcon72.seq
250000178 gbcon73.seq
250002415 gbcon74.seq
250010443 gbcon75.seq
250003313 gbcon76.seq
250001518 gbcon77.seq
250000927 gbcon78.seq
250003703 gbcon79.seq
250002259 gbcon8.seq
250003717 gbcon80.seq
250008035 gbcon81.seq
250006648 gbcon82.seq
224857151 gbcon83.seq
21177666 gbcon84.seq
250085224 gbcon9.seq
972691 gbdel.txt
250001370 gbenv1.seq
250002983 gbenv2.seq
250001173 gbenv3.seq
250001742 gbenv4.seq
250001275 gbenv5.seq
250000794 gbenv6.seq
213177748 gbenv7.seq
230688948 gbest1.seq
230690195 gbest10.seq
230689053 gbest100.seq
230691173 gbest101.seq
230690611 gbest102.seq
230687634 gbest103.seq
230688542 gbest104.seq
230690182 gbest105.seq
230690289 gbest106.seq
230688552 gbest107.seq
230690796 gbest108.seq
230689132 gbest109.seq
230688446 gbest11.seq
230689057 gbest110.seq
230689532 gbest111.seq
230690015 gbest112.seq
230690090 gbest113.seq
230688728 gbest114.seq
230689539 gbest115.seq
230689537 gbest116.seq
230689501 gbest117.seq
230689230 gbest118.seq
230689171 gbest119.seq
230689589 gbest12.seq
230691063 gbest120.seq
230689917 gbest121.seq
230689025 gbest122.seq
230687945 gbest123.seq
230689731 gbest124.seq
230688799 gbest125.seq
230689654 gbest126.seq
230688631 gbest127.seq
230689623 gbest128.seq
230689413 gbest129.seq
230687660 gbest13.seq
230689788 gbest130.seq
230689117 gbest131.seq
230689733 gbest132.seq
230689244 gbest133.seq
230687475 gbest134.seq
230688680 gbest135.seq
230690411 gbest136.seq
230688808 gbest137.seq
230689450 gbest138.seq
230690778 gbest139.seq
230689926 gbest14.seq
230690154 gbest140.seq
230690506 gbest141.seq
230689126 gbest142.seq
230689233 gbest143.seq
230689988 gbest144.seq
230688503 gbest145.seq
230689395 gbest146.seq
230687750 gbest147.seq
230688091 gbest148.seq
230688383 gbest149.seq
230689134 gbest15.seq
230689845 gbest150.seq
230688438 gbest151.seq
230687498 gbest152.seq
230688962 gbest153.seq
230687949 gbest154.seq
230688938 gbest155.seq
230688851 gbest156.seq
230688591 gbest157.seq
230691368 gbest158.seq
230690067 gbest159.seq
230688076 gbest16.seq
230691044 gbest160.seq
230690733 gbest161.seq
230688726 gbest162.seq
230688452 gbest163.seq
230696473 gbest164.seq
230687704 gbest165.seq
230690780 gbest166.seq
230688300 gbest167.seq
230688131 gbest168.seq
230688765 gbest169.seq
230688189 gbest17.seq
230688382 gbest170.seq
230691246 gbest171.seq
230689146 gbest172.seq
230690940 gbest173.seq
230688373 gbest174.seq
230688798 gbest175.seq
230689058 gbest176.seq
230688063 gbest177.seq
230688253 gbest178.seq
230688006 gbest179.seq
230689836 gbest18.seq
221974965 gbest180.seq
230688882 gbest181.seq
230688464 gbest182.seq
230687900 gbest183.seq
230688295 gbest184.seq
230688926 gbest185.seq
230689822 gbest186.seq
230687770 gbest187.seq
230690207 gbest188.seq
230689834 gbest189.seq
230688463 gbest19.seq
230689523 gbest190.seq
230688367 gbest191.seq
230690118 gbest192.seq
230690523 gbest193.seq
230690123 gbest194.seq
230688572 gbest195.seq
230690500 gbest196.seq
230688733 gbest197.seq
230688827 gbest198.seq
230688297 gbest199.seq
230690014 gbest2.seq
230687940 gbest20.seq
230687739 gbest200.seq
230689611 gbest201.seq
230687579 gbest202.seq
230690206 gbest203.seq
230689163 gbest204.seq
230688145 gbest205.seq
230690131 gbest206.seq
230688536 gbest207.seq
230688712 gbest208.seq
230688966 gbest209.seq
230691980 gbest21.seq
230689705 gbest210.seq
230688200 gbest211.seq
230690470 gbest212.seq
230688869 gbest213.seq
230688158 gbest214.seq
230689230 gbest215.seq
230687467 gbest216.seq
230688026 gbest217.seq
230689043 gbest218.seq
230687489 gbest219.seq
230687936 gbest22.seq
230688798 gbest220.seq
230689836 gbest221.seq
230690941 gbest222.seq
230691002 gbest223.seq
230687697 gbest224.seq
230688911 gbest225.seq
230690575 gbest226.seq
230688666 gbest227.seq
230689041 gbest228.seq
230689723 gbest229.seq
230689144 gbest23.seq
230690562 gbest230.seq
163269669 gbest231.seq
162068563 gbest232.seq
168085545 gbest233.seq
167786799 gbest234.seq
169548955 gbest235.seq
164886288 gbest236.seq
164935216 gbest237.seq
164502352 gbest238.seq
164364716 gbest239.seq
230687921 gbest24.seq
164397618 gbest240.seq
164607551 gbest241.seq
163494913 gbest242.seq
166112315 gbest243.seq
165194161 gbest244.seq
162031678 gbest245.seq
164319595 gbest246.seq
169151067 gbest247.seq
166862238 gbest248.seq
165634294 gbest249.seq
230691076 gbest25.seq
165769548 gbest250.seq
165371669 gbest251.seq
164833230 gbest252.seq
164219911 gbest253.seq
164361622 gbest254.seq
165525782 gbest255.seq
170817852 gbest256.seq
178034253 gbest257.seq
171500018 gbest258.seq
229410561 gbest259.seq
230689141 gbest26.seq
230692604 gbest260.seq
230688317 gbest261.seq
230689583 gbest262.seq
230689987 gbest263.seq
230689841 gbest264.seq
230687754 gbest265.seq
230688961 gbest266.seq
230688930 gbest267.seq
230688958 gbest268.seq
230687949 gbest269.seq
230689065 gbest27.seq
230687646 gbest270.seq
230689370 gbest271.seq
230688292 gbest272.seq
230689824 gbest273.seq
230688902 gbest274.seq
230688775 gbest275.seq
230688646 gbest276.seq
230689527 gbest277.seq
230687945 gbest278.seq
230694715 gbest279.seq
230688661 gbest28.seq
230688229 gbest280.seq
230688934 gbest281.seq
230689207 gbest282.seq
230688074 gbest283.seq
230688955 gbest284.seq
230687768 gbest285.seq
230689468 gbest286.seq
230688318 gbest287.seq
230687832 gbest288.seq
230688704 gbest289.seq
230688942 gbest29.seq
215364416 gbest290.seq
228377342 gbest291.seq
230688453 gbest292.seq
230691126 gbest293.seq
230689789 gbest294.seq
230690944 gbest295.seq
230689626 gbest296.seq
230687568 gbest297.seq
230689582 gbest298.seq
230689508 gbest299.seq
230690086 gbest3.seq
230687897 gbest30.seq
230687441 gbest300.seq
230687539 gbest301.seq
230689715 gbest302.seq
230689649 gbest303.seq
230688668 gbest304.seq
230689254 gbest305.seq
230689599 gbest306.seq
230687783 gbest307.seq
230691285 gbest308.seq
230687505 gbest309.seq
230690340 gbest31.seq
230691630 gbest310.seq
230688548 gbest311.seq
230688506 gbest312.seq
230687787 gbest313.seq
230687990 gbest314.seq
230688075 gbest315.seq
230688910 gbest316.seq
230689631 gbest317.seq
230688491 gbest318.seq
230690515 gbest319.seq
230690174 gbest32.seq
230688599 gbest320.seq
230689595 gbest321.seq
230688723 gbest322.seq
230689013 gbest323.seq
230688810 gbest324.seq
230690326 gbest325.seq
230689237 gbest326.seq
230689037 gbest327.seq
230689913 gbest328.seq
230689620 gbest329.seq
230689388 gbest33.seq
230688552 gbest330.seq
230689550 gbest331.seq
230687841 gbest332.seq
230690538 gbest333.seq
230688386 gbest334.seq
230687695 gbest335.seq
230689318 gbest336.seq
230689077 gbest337.seq
230689492 gbest338.seq
230687660 gbest339.seq
230687674 gbest34.seq
230688776 gbest340.seq
230689902 gbest341.seq
201941926 gbest342.seq
230688027 gbest343.seq
230689249 gbest344.seq
230690512 gbest345.seq
230689552 gbest346.seq
230688783 gbest347.seq
230687791 gbest348.seq
143431614 gbest349.seq
230690004 gbest35.seq
178693153 gbest350.seq
230689265 gbest351.seq
230688689 gbest352.seq
230689057 gbest353.seq
230689207 gbest354.seq
230689155 gbest355.seq
230689961 gbest356.seq
230690792 gbest357.seq
230689996 gbest358.seq
230688835 gbest359.seq
230688054 gbest36.seq
230688201 gbest360.seq
230687608 gbest361.seq
230688370 gbest362.seq
230691026 gbest363.seq
230689602 gbest364.seq
230692232 gbest365.seq
230687895 gbest366.seq
230689386 gbest367.seq
230688431 gbest368.seq
230688973 gbest369.seq
230688767 gbest37.seq
230690256 gbest370.seq
230687509 gbest371.seq
230689039 gbest372.seq
230688358 gbest373.seq
230687565 gbest374.seq
230689418 gbest375.seq
230687555 gbest376.seq
230689807 gbest377.seq
230688751 gbest378.seq
230689598 gbest379.seq
230688489 gbest38.seq
230688063 gbest380.seq
230688074 gbest381.seq
230688161 gbest382.seq
230690494 gbest383.seq
230692333 gbest384.seq
230688994 gbest385.seq
230688138 gbest386.seq
230688832 gbest387.seq
230687990 gbest388.seq
230687789 gbest389.seq
230690684 gbest39.seq
230687586 gbest390.seq
230688374 gbest391.seq
230687524 gbest392.seq
230689973 gbest393.seq
230693338 gbest394.seq
230689367 gbest395.seq
230687697 gbest396.seq
230690580 gbest397.seq
230687513 gbest398.seq
230689114 gbest399.seq
230688808 gbest4.seq
230687582 gbest40.seq
230688411 gbest400.seq
230690604 gbest401.seq
230690391 gbest402.seq
230689195 gbest403.seq
230689015 gbest404.seq
230688792 gbest405.seq
212146428 gbest406.seq
230689632 gbest407.seq
230687614 gbest408.seq
230688114 gbest409.seq
230687740 gbest41.seq
230689084 gbest410.seq
230689186 gbest411.seq
230689702 gbest412.seq
230687649 gbest413.seq
230687957 gbest414.seq
230689318 gbest415.seq
230690255 gbest416.seq
230687971 gbest417.seq
230688777 gbest418.seq
230688629 gbest419.seq
230688937 gbest42.seq
230691440 gbest420.seq
230688164 gbest421.seq
230691362 gbest422.seq
230687652 gbest423.seq
210589455 gbest424.seq
210244821 gbest425.seq
210117964 gbest426.seq
210406230 gbest427.seq
210302493 gbest428.seq
210426285 gbest429.seq
230687695 gbest43.seq
211365579 gbest430.seq
211632839 gbest431.seq
211277669 gbest432.seq
212165582 gbest433.seq
213484997 gbest434.seq
211373792 gbest435.seq
210830068 gbest436.seq
210726920 gbest437.seq
210561672 gbest438.seq
210142253 gbest439.seq
230687623 gbest44.seq
210235366 gbest440.seq
210197562 gbest441.seq
210134763 gbest442.seq
222743086 gbest443.seq
230689459 gbest444.seq
230689120 gbest445.seq
230688536 gbest446.seq
230687915 gbest447.seq
230689026 gbest448.seq
230689494 gbest449.seq
223279853 gbest45.seq
230688650 gbest450.seq
230690488 gbest451.seq
230688803 gbest452.seq
230687809 gbest453.seq
230688241 gbest454.seq
230690162 gbest455.seq
230687788 gbest456.seq
230689530 gbest457.seq
230689122 gbest458.seq
230689003 gbest459.seq
192377589 gbest46.seq
230689182 gbest460.seq
230688231 gbest461.seq
230691579 gbest462.seq
230688528 gbest463.seq
230690782 gbest464.seq
230687517 gbest465.seq
230688332 gbest466.seq
230690175 gbest467.seq
230688498 gbest468.seq
230689512 gbest469.seq
191859528 gbest47.seq
230691027 gbest470.seq
227062714 gbest471.seq
230688208 gbest472.seq
230687526 gbest473.seq
230688633 gbest474.seq
230690379 gbest475.seq
230688836 gbest476.seq
230688241 gbest477.seq
230688892 gbest478.seq
230687670 gbest479.seq
215094753 gbest48.seq
230689033 gbest480.seq
230689951 gbest481.seq
230689135 gbest482.seq
230688598 gbest483.seq
230688215 gbest484.seq
230691037 gbest485.seq
230689700 gbest486.seq
230689664 gbest487.seq
230689124 gbest488.seq
230688820 gbest489.seq
216203173 gbest49.seq
230688668 gbest490.seq
230690359 gbest491.seq
230690497 gbest492.seq
230687638 gbest493.seq
230691568 gbest494.seq
230687703 gbest495.seq
230688676 gbest496.seq
226769910 gbest497.seq
230688988 gbest498.seq
230688668 gbest499.seq
164122622 gbest5.seq
215866619 gbest50.seq
230688592 gbest500.seq
230688277 gbest501.seq
230690898 gbest502.seq
230689020 gbest503.seq
230689840 gbest504.seq
230687546 gbest505.seq
230690323 gbest506.seq
230688347 gbest507.seq
230689066 gbest508.seq
230688580 gbest509.seq
216967628 gbest51.seq
230688235 gbest510.seq
225581732 gbest511.seq
228018183 gbest512.seq
230688500 gbest513.seq
230688744 gbest514.seq
230690154 gbest515.seq
230687690 gbest516.seq
230688872 gbest517.seq
230687561 gbest518.seq
230688297 gbest519.seq
230688078 gbest52.seq
230687699 gbest520.seq
230689832 gbest521.seq
230689647 gbest522.seq
230689079 gbest523.seq
230689537 gbest524.seq
230689702 gbest525.seq
226972693 gbest526.seq
196054591 gbest527.seq
223780479 gbest528.seq
230690494 gbest529.seq
230689310 gbest53.seq
230689895 gbest530.seq
230688875 gbest531.seq
230687540 gbest532.seq
230689301 gbest533.seq
230689681 gbest534.seq
230688252 gbest535.seq
230690261 gbest536.seq
230689649 gbest537.seq
230689087 gbest538.seq
230688870 gbest539.seq
230688364 gbest54.seq
230689264 gbest540.seq
221861437 gbest541.seq
221850582 gbest542.seq
230689491 gbest543.seq
230690376 gbest544.seq
230688868 gbest545.seq
230689308 gbest546.seq
230688975 gbest547.seq
230688061 gbest548.seq
219961408 gbest549.seq
227044573 gbest55.seq
223931492 gbest550.seq
230688314 gbest551.seq
230688623 gbest552.seq
230688771 gbest553.seq
230689572 gbest554.seq
230689870 gbest555.seq
230689513 gbest556.seq
230687669 gbest557.seq
230688448 gbest558.seq
230688287 gbest559.seq
230249432 gbest56.seq
230688550 gbest560.seq
230688829 gbest561.seq
230690090 gbest562.seq
230690878 gbest563.seq
230688215 gbest564.seq
230687756 gbest565.seq
230688200 gbest566.seq
230690492 gbest567.seq
230689485 gbest568.seq
230689480 gbest569.seq
230688826 gbest57.seq
230689355 gbest570.seq
230687740 gbest571.seq
230687977 gbest572.seq
230688796 gbest573.seq
230689599 gbest574.seq
230688708 gbest575.seq
230688538 gbest576.seq
230687976 gbest577.seq
230687992 gbest578.seq
230688627 gbest579.seq
230690327 gbest58.seq
230687685 gbest580.seq
230689597 gbest581.seq
230688463 gbest582.seq
230688884 gbest583.seq
230688084 gbest584.seq
230689839 gbest585.seq
230690980 gbest586.seq
230688613 gbest587.seq
230687897 gbest588.seq
230688563 gbest589.seq
230689288 gbest59.seq
230688387 gbest590.seq
230687947 gbest591.seq
230687795 gbest592.seq
230688679 gbest593.seq
230687963 gbest594.seq
230689245 gbest595.seq
230690254 gbest596.seq
230691032 gbest597.seq
230687471 gbest598.seq
230689453 gbest599.seq
177441695 gbest6.seq
230688024 gbest60.seq
230689804 gbest600.seq
230689757 gbest601.seq
230689924 gbest602.seq
230688519 gbest603.seq
230689616 gbest604.seq
230687755 gbest605.seq
230688270 gbest606.seq
230689209 gbest607.seq
230687746 gbest608.seq
230689301 gbest609.seq
230688711 gbest61.seq
230688039 gbest610.seq
230689244 gbest611.seq
230688308 gbest612.seq
230689525 gbest613.seq
230689001 gbest614.seq
230688855 gbest615.seq
230689906 gbest616.seq
209187736 gbest617.seq
230689456 gbest618.seq
230688966 gbest619.seq
230688917 gbest62.seq
226734558 gbest620.seq
217300237 gbest621.seq
230688484 gbest622.seq
223354609 gbest623.seq
189320189 gbest624.seq
189213284 gbest625.seq
192273890 gbest626.seq
190721998 gbest627.seq
190446733 gbest628.seq
189857574 gbest629.seq
230688498 gbest63.seq
192227376 gbest630.seq
190283153 gbest631.seq
190060726 gbest632.seq
191897861 gbest633.seq
230687512 gbest634.seq
230688035 gbest635.seq
230687855 gbest636.seq
230688983 gbest637.seq
230691016 gbest638.seq
230689334 gbest639.seq
230687960 gbest64.seq
230690570 gbest640.seq
230688482 gbest641.seq
230689150 gbest642.seq
230688950 gbest643.seq
230687507 gbest644.seq
230687569 gbest645.seq
230689614 gbest646.seq
230688183 gbest647.seq
230687717 gbest648.seq
230690668 gbest649.seq
230690213 gbest65.seq
230689111 gbest650.seq
230689191 gbest651.seq
230689823 gbest652.seq
230689697 gbest653.seq
230689596 gbest654.seq
230688691 gbest655.seq
230689675 gbest656.seq
230688887 gbest657.seq
230687547 gbest658.seq
230689864 gbest659.seq
230689969 gbest66.seq
230690581 gbest660.seq
230690825 gbest661.seq
230687513 gbest662.seq
230687497 gbest663.seq
230690341 gbest664.seq
230689680 gbest665.seq
230690264 gbest666.seq
230688695 gbest667.seq
230690090 gbest668.seq
230689158 gbest669.seq
230687497 gbest67.seq
230689161 gbest670.seq
230688932 gbest671.seq
225512012 gbest672.seq
230689517 gbest673.seq
230688313 gbest674.seq
40606395 gbest675.seq
230688214 gbest68.seq
230689501 gbest69.seq
230690906 gbest7.seq
230288833 gbest70.seq
230688001 gbest71.seq
210191941 gbest72.seq
209389918 gbest73.seq
208712239 gbest74.seq
209068508 gbest75.seq
209559853 gbest76.seq
210591605 gbest77.seq
209600572 gbest78.seq
208395265 gbest79.seq
230688637 gbest8.seq
210183017 gbest80.seq
208948469 gbest81.seq
205188900 gbest82.seq
208416787 gbest83.seq
207681838 gbest84.seq
210408781 gbest85.seq
224382001 gbest86.seq
230687642 gbest87.seq
230690823 gbest88.seq
222491747 gbest89.seq
230688685 gbest9.seq
214449764 gbest90.seq
214088235 gbest91.seq
230687446 gbest92.seq
230688918 gbest93.seq
230688028 gbest94.seq
230688833 gbest95.seq
230688707 gbest96.seq
230689092 gbest97.seq
230688059 gbest98.seq
230687594 gbest99.seq
74122540 gbgen.idx
209716011 gbgss1.seq
209719113 gbgss10.seq
209718163 gbgss100.seq
209717738 gbgss101.seq
209718882 gbgss102.seq
209716227 gbgss103.seq
209716898 gbgss104.seq
209717763 gbgss105.seq
209716994 gbgss106.seq
209716726 gbgss107.seq
209717399 gbgss108.seq
209717217 gbgss109.seq
209716636 gbgss11.seq
209718827 gbgss110.seq
207037075 gbgss111.seq
208074259 gbgss112.seq
207885040 gbgss113.seq
207855556 gbgss114.seq
207106932 gbgss115.seq
206778973 gbgss116.seq
209717416 gbgss117.seq
209717531 gbgss118.seq
209718853 gbgss119.seq
209718702 gbgss12.seq
209718329 gbgss120.seq
209717278 gbgss121.seq
209715921 gbgss122.seq
209717432 gbgss123.seq
209716351 gbgss124.seq
209717766 gbgss125.seq
209716038 gbgss126.seq
209718037 gbgss127.seq
209717478 gbgss128.seq
209718011 gbgss129.seq
209717618 gbgss13.seq
209717002 gbgss130.seq
209717392 gbgss131.seq
209716139 gbgss132.seq
209715935 gbgss133.seq
209716122 gbgss134.seq
209718447 gbgss135.seq
209717997 gbgss136.seq
209718150 gbgss137.seq
209716924 gbgss138.seq
209717959 gbgss139.seq
209717613 gbgss14.seq
209716788 gbgss140.seq
209717876 gbgss141.seq
209719217 gbgss142.seq
209718541 gbgss143.seq
209716488 gbgss144.seq
209717577 gbgss145.seq
209717865 gbgss146.seq
209717295 gbgss147.seq
209716718 gbgss148.seq
209718603 gbgss149.seq
209716297 gbgss15.seq
209717947 gbgss150.seq
209716172 gbgss151.seq
209716148 gbgss152.seq
209716335 gbgss153.seq
209716644 gbgss154.seq
209715991 gbgss155.seq
209716720 gbgss156.seq
209715947 gbgss157.seq
209718834 gbgss158.seq
209717209 gbgss159.seq
209718089 gbgss16.seq
203728162 gbgss160.seq
209717969 gbgss161.seq
209716233 gbgss162.seq
176926999 gbgss163.seq
209716590 gbgss164.seq
209718597 gbgss165.seq
209717027 gbgss166.seq
209716285 gbgss167.seq
209716911 gbgss168.seq
209716643 gbgss169.seq
209718026 gbgss17.seq
209716731 gbgss170.seq
209718718 gbgss171.seq
209717014 gbgss172.seq
209716322 gbgss173.seq
209716058 gbgss174.seq
209716202 gbgss175.seq
209717177 gbgss176.seq
209718144 gbgss177.seq
209717130 gbgss178.seq
209716507 gbgss179.seq
209718312 gbgss18.seq
209717546 gbgss180.seq
209717923 gbgss181.seq
209715976 gbgss182.seq
209718575 gbgss183.seq
209717645 gbgss184.seq
209717648 gbgss185.seq
209718212 gbgss186.seq
208148335 gbgss187.seq
209718192 gbgss188.seq
209716546 gbgss189.seq
209719001 gbgss19.seq
209718341 gbgss190.seq
196015291 gbgss191.seq
188920668 gbgss192.seq
190091083 gbgss193.seq
191558130 gbgss194.seq
191101663 gbgss195.seq
190377967 gbgss196.seq
190049615 gbgss197.seq
188497748 gbgss198.seq
188421213 gbgss199.seq
209717137 gbgss2.seq
209718325 gbgss20.seq
188804470 gbgss200.seq
190223438 gbgss201.seq
190229527 gbgss202.seq
190498509 gbgss203.seq
187256876 gbgss204.seq
186899477 gbgss205.seq
186832700 gbgss206.seq
186789179 gbgss207.seq
186639311 gbgss208.seq
186423236 gbgss209.seq
209717437 gbgss21.seq
187905826 gbgss210.seq
188582408 gbgss211.seq
189639613 gbgss212.seq
189005266 gbgss213.seq
189040514 gbgss214.seq
189637752 gbgss215.seq
189811921 gbgss216.seq
189799245 gbgss217.seq
188787380 gbgss218.seq
187249499 gbgss219.seq
209717642 gbgss22.seq
187347185 gbgss220.seq
187627117 gbgss221.seq
186836750 gbgss222.seq
187204503 gbgss223.seq
188522852 gbgss224.seq
188217459 gbgss225.seq
188469005 gbgss226.seq
188263808 gbgss227.seq
188460073 gbgss228.seq
188075759 gbgss229.seq
209716654 gbgss23.seq
188302917 gbgss230.seq
188052035 gbgss231.seq
188094267 gbgss232.seq
187878455 gbgss233.seq
189048992 gbgss234.seq
188905728 gbgss235.seq
190028730 gbgss236.seq
191006983 gbgss237.seq
190389011 gbgss238.seq
190867457 gbgss239.seq
209716604 gbgss24.seq
193693376 gbgss240.seq
198964286 gbgss241.seq
199316266 gbgss242.seq
209717758 gbgss243.seq
209716929 gbgss244.seq
209718782 gbgss245.seq
209717423 gbgss246.seq
102438745 gbgss247.seq
250000587 gbgss248.seq
250000528 gbgss249.seq
209718179 gbgss25.seq
250001090 gbgss250.seq
250003165 gbgss251.seq
250001891 gbgss252.seq
250000431 gbgss253.seq
250001825 gbgss254.seq
250000909 gbgss255.seq
250002571 gbgss256.seq
250002433 gbgss257.seq
250000352 gbgss258.seq
250001445 gbgss259.seq
209717587 gbgss26.seq
250001903 gbgss260.seq
250000091 gbgss261.seq
250001509 gbgss262.seq
250002123 gbgss263.seq
250000143 gbgss264.seq
250001324 gbgss265.seq
250000339 gbgss266.seq
250003403 gbgss267.seq
250001638 gbgss268.seq
250001571 gbgss269.seq
209719224 gbgss27.seq
250000923 gbgss270.seq
250000181 gbgss271.seq
250002124 gbgss272.seq
250001063 gbgss273.seq
250000882 gbgss274.seq
250000300 gbgss275.seq
250000102 gbgss276.seq
250000116 gbgss277.seq
250001876 gbgss278.seq
250001935 gbgss279.seq
209718361 gbgss28.seq
250000658 gbgss280.seq
250000453 gbgss281.seq
250000185 gbgss282.seq
250000677 gbgss283.seq
250001099 gbgss284.seq
250002461 gbgss285.seq
250001541 gbgss286.seq
250001970 gbgss287.seq
250002194 gbgss288.seq
250001384 gbgss289.seq
209720057 gbgss29.seq
250000385 gbgss290.seq
250002059 gbgss291.seq
250002391 gbgss292.seq
250000932 gbgss293.seq
250000255 gbgss294.seq
111860695 gbgss295.seq
209718357 gbgss3.seq
209717859 gbgss30.seq
209719445 gbgss31.seq
209717260 gbgss32.seq
209718695 gbgss33.seq
209716659 gbgss34.seq
209718176 gbgss35.seq
209717711 gbgss36.seq
209718551 gbgss37.seq
209716567 gbgss38.seq
209716441 gbgss39.seq
209716735 gbgss4.seq
209717552 gbgss40.seq
209718069 gbgss41.seq
209717215 gbgss42.seq
209716439 gbgss43.seq
209716436 gbgss44.seq
209716469 gbgss45.seq
209717279 gbgss46.seq
209717020 gbgss47.seq
209718731 gbgss48.seq
209717645 gbgss49.seq
209718358 gbgss5.seq
209718854 gbgss50.seq
209716281 gbgss51.seq
209717570 gbgss52.seq
209717880 gbgss53.seq
209717864 gbgss54.seq
209717675 gbgss55.seq
209716424 gbgss56.seq
209717756 gbgss57.seq
209717340 gbgss58.seq
209718945 gbgss59.seq
209717139 gbgss6.seq
209718143 gbgss60.seq
209716162 gbgss61.seq
209716644 gbgss62.seq
209717744 gbgss63.seq
209716243 gbgss64.seq
209717204 gbgss65.seq
209718032 gbgss66.seq
208009657 gbgss67.seq
209362838 gbgss68.seq
209717107 gbgss69.seq
209718431 gbgss7.seq
209718063 gbgss70.seq
209717029 gbgss71.seq
209716787 gbgss72.seq
209716054 gbgss73.seq
209716123 gbgss74.seq
209717749 gbgss75.seq
209717672 gbgss76.seq
209716479 gbgss77.seq
209717378 gbgss78.seq
209716052 gbgss79.seq
209718624 gbgss8.seq
209717991 gbgss80.seq
209716729 gbgss81.seq
209717024 gbgss82.seq
209718047 gbgss83.seq
209716142 gbgss84.seq
209718041 gbgss85.seq
209717503 gbgss86.seq
209716884 gbgss87.seq
209717041 gbgss88.seq
207146261 gbgss89.seq
209717119 gbgss9.seq
176180860 gbgss90.seq
176791346 gbgss91.seq
209716804 gbgss92.seq
209718595 gbgss93.seq
209717793 gbgss94.seq
209716152 gbgss95.seq
209718075 gbgss96.seq
209718292 gbgss97.seq
209717287 gbgss98.seq
209718155 gbgss99.seq
250005562 gbhtc1.seq
250000758 gbhtc10.seq
250001732 gbhtc11.seq
176065468 gbhtc12.seq
250016615 gbhtc2.seq
250005705 gbhtc3.seq
250002243 gbhtc4.seq
250012416 gbhtc5.seq
250007006 gbhtc6.seq
250000669 gbhtc7.seq
250008464 gbhtc8.seq
250004401 gbhtc9.seq
250096214 gbhtg1.seq
250059723 gbhtg10.seq
250140778 gbhtg100.seq
250219650 gbhtg101.seq
250143483 gbhtg102.seq
250000269 gbhtg103.seq
250178535 gbhtg104.seq
85718696 gbhtg105.seq
250080408 gbhtg11.seq
250028717 gbhtg12.seq
250228970 gbhtg13.seq
250086689 gbhtg14.seq
250190626 gbhtg15.seq
250201587 gbhtg16.seq
250201830 gbhtg17.seq
250114985 gbhtg18.seq
250028302 gbhtg19.seq
250020785 gbhtg2.seq
250033811 gbhtg20.seq
250164026 gbhtg21.seq
250242949 gbhtg22.seq
250045352 gbhtg23.seq
250068017 gbhtg24.seq
250000857 gbhtg25.seq
250142134 gbhtg26.seq
250183323 gbhtg27.seq
250030226 gbhtg28.seq
250074193 gbhtg29.seq
250039038 gbhtg3.seq
250290721 gbhtg30.seq
250202905 gbhtg31.seq
250158076 gbhtg32.seq
250226326 gbhtg33.seq
250016968 gbhtg34.seq
250427479 gbhtg35.seq
250108266 gbhtg36.seq
250039742 gbhtg37.seq
250154069 gbhtg38.seq
250123377 gbhtg39.seq
250101895 gbhtg4.seq
250134866 gbhtg40.seq
250046909 gbhtg41.seq
250185164 gbhtg42.seq
250143201 gbhtg43.seq
250129536 gbhtg44.seq
250151261 gbhtg45.seq
250004486 gbhtg46.seq
250075432 gbhtg47.seq
250050473 gbhtg48.seq
250071213 gbhtg49.seq
250209186 gbhtg5.seq
250230927 gbhtg50.seq
250278114 gbhtg51.seq
250138533 gbhtg52.seq
250304272 gbhtg53.seq
250110009 gbhtg54.seq
250075322 gbhtg55.seq
250124699 gbhtg56.seq
250287811 gbhtg57.seq
250100705 gbhtg58.seq
250156736 gbhtg59.seq
250053403 gbhtg6.seq
250023777 gbhtg60.seq
250119554 gbhtg61.seq
250141357 gbhtg62.seq
250025374 gbhtg63.seq
250034496 gbhtg64.seq
250121010 gbhtg65.seq
250082856 gbhtg66.seq
250217440 gbhtg67.seq
250089421 gbhtg68.seq
250069388 gbhtg69.seq
250004220 gbhtg7.seq
250273298 gbhtg70.seq
250337708 gbhtg71.seq
250120169 gbhtg72.seq
250046000 gbhtg73.seq
250076879 gbhtg74.seq
250134988 gbhtg75.seq
250260345 gbhtg76.seq
250182113 gbhtg77.seq
250227922 gbhtg78.seq
250148818 gbhtg79.seq
250124024 gbhtg8.seq
250041994 gbhtg80.seq
250116513 gbhtg81.seq
250026783 gbhtg82.seq
250040921 gbhtg83.seq
250203762 gbhtg84.seq
250149960 gbhtg85.seq
250165401 gbhtg86.seq
250172828 gbhtg87.seq
250050124 gbhtg88.seq
250158514 gbhtg89.seq
250009915 gbhtg9.seq
250121512 gbhtg90.seq
250150385 gbhtg91.seq
250125745 gbhtg92.seq
250029946 gbhtg93.seq
250131185 gbhtg94.seq
253053788 gbhtg95.seq
250080631 gbhtg96.seq
252373039 gbhtg97.seq
250105624 gbhtg98.seq
250092682 gbhtg99.seq
250089690 gbinv1.seq
250024835 gbinv10.seq
169141388 gbinv11.seq
250026061 gbinv2.seq
250002193 gbinv3.seq
250000649 gbinv4.seq
250000671 gbinv5.seq
250000297 gbinv6.seq
250000934 gbinv7.seq
250000100 gbinv8.seq
250002142 gbinv9.seq
148999061 gbjou1.idx
139168782 gbjou2.idx
230920172 gbjou3.idx
276365723 gbjou4.idx
23178691 gbjou5.idx
187769530 gbkey1.idx
208288530 gbkey2.idx
6145319 gbkey3.idx
250000708 gbmam1.seq
250003470 gbmam2.seq
250001235 gbmam3.seq
46716137 gbmam4.seq
45334631 gbnew.txt
250000401 gbpat1.seq
250001176 gbpat10.seq
250000358 gbpat11.seq
250001414 gbpat12.seq
250000859 gbpat13.seq
250000501 gbpat14.seq
250001402 gbpat15.seq
250001582 gbpat16.seq
250002043 gbpat17.seq
250000092 gbpat18.seq
250000035 gbpat19.seq
250000204 gbpat2.seq
250002306 gbpat20.seq
250000490 gbpat21.seq
250170081 gbpat22.seq
250079151 gbpat23.seq
250001446 gbpat24.seq
250005220 gbpat25.seq
250002245 gbpat26.seq
250001284 gbpat27.seq
250008047 gbpat28.seq
250000947 gbpat29.seq
250003353 gbpat3.seq
250000141 gbpat30.seq
250001061 gbpat31.seq
250000986 gbpat32.seq
250000292 gbpat33.seq
78892334 gbpat34.seq
250002406 gbpat4.seq
250000084 gbpat5.seq
250000203 gbpat6.seq
250001519 gbpat7.seq
250002720 gbpat8.seq
250000011 gbpat9.seq
64930275 gbphg.seq
250032297 gbpln1.seq
250001266 gbpln10.seq
250030479 gbpln11.seq
250004070 gbpln12.seq
250004469 gbpln13.seq
250171428 gbpln14.seq
250037744 gbpln15.seq
266322726 gbpln16.seq
267454122 gbpln17.seq
250000886 gbpln18.seq
250002450 gbpln19.seq
250039945 gbpln2.seq
250000587 gbpln20.seq
250520077 gbpln21.seq
250000145 gbpln22.seq
250000965 gbpln23.seq
250000245 gbpln24.seq
250002144 gbpln25.seq
250000656 gbpln26.seq
188456936 gbpln27.seq
250006138 gbpln3.seq
250614107 gbpln4.seq
250000626 gbpln5.seq
250000144 gbpln6.seq
250002883 gbpln7.seq
250001967 gbpln8.seq
250000061 gbpln9.seq
250044409 gbpri1.seq
250233099 gbpri10.seq
250054978 gbpri11.seq
250034661 gbpri12.seq
250051012 gbpri13.seq
250109052 gbpri14.seq
250192888 gbpri15.seq
250069835 gbpri16.seq
250038248 gbpri17.seq
250280044 gbpri18.seq
250000964 gbpri19.seq
250015561 gbpri2.seq
250008200 gbpri20.seq
250024984 gbpri21.seq
250030391 gbpri22.seq
250079954 gbpri23.seq
250023428 gbpri24.seq
250176966 gbpri25.seq
250182400 gbpri26.seq
250101872 gbpri27.seq
250001118 gbpri28.seq
251850949 gbpri29.seq
250020002 gbpri3.seq
250002603 gbpri30.seq
250004345 gbpri31.seq
250001535 gbpri32.seq
250002765 gbpri33.seq
237721779 gbpri34.seq
250005364 gbpri4.seq
250052347 gbpri5.seq
250057929 gbpri6.seq
250118849 gbpri7.seq
250335295 gbpri8.seq
250025759 gbpri9.seq
286821 gbrel.txt
250256137 gbrod1.seq
250091258 gbrod10.seq
250112331 gbrod11.seq
250126924 gbrod12.seq
250055425 gbrod13.seq
250152854 gbrod14.seq
250092002 gbrod15.seq
250124434 gbrod16.seq
250000865 gbrod17.seq
250095752 gbrod18.seq
250252754 gbrod19.seq
250225189 gbrod2.seq
250076204 gbrod20.seq
250001974 gbrod21.seq
250004706 gbrod22.seq
250004554 gbrod23.seq
250000658 gbrod24.seq
250000525 gbrod25.seq
68692758 gbrod26.seq
250098146 gbrod3.seq
250227134 gbrod4.seq
250055825 gbrod5.seq
250113668 gbrod6.seq
250145170 gbrod7.seq
250056910 gbrod8.seq
250192191 gbrod9.seq
1206247726 gbsdr1.txt
3853367618 gbsdr2.txt
1710953438 gbsdr3.txt
98286799 gbsec.idx
250001142 gbsts1.seq
250000926 gbsts10.seq
250002036 gbsts11.seq
250002240 gbsts12.seq
250002167 gbsts13.seq
199800359 gbsts14.seq
250001256 gbsts2.seq
250001893 gbsts3.seq
250000943 gbsts4.seq
250003898 gbsts5.seq
250001736 gbsts6.seq
250002692 gbsts7.seq
250001758 gbsts8.seq
250002327 gbsts9.seq
250002099 gbsyn1.seq
26422141 gbsyn2.seq
422716 gbuna.seq
250015646 gbvrl1.seq
250000013 gbvrl2.seq
250010335 gbvrl3.seq
250003148 gbvrl4.seq
250001458 gbvrl5.seq
250002357 gbvrl6.seq
250002790 gbvrl7.seq
150521426 gbvrl8.seq
250170247 gbvrt1.seq
250013241 gbvrt10.seq
250016644 gbvrt11.seq
250039316 gbvrt12.seq
250003001 gbvrt13.seq
250000283 gbvrt14.seq
17008050 gbvrt15.seq
250004794 gbvrt2.seq
250246998 gbvrt3.seq
250002597 gbvrt4.seq
250000118 gbvrt5.seq
250027771 gbvrt6.seq
250157878 gbvrt7.seq
250030639 gbvrt8.seq
250050490 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 33065 101002156
BCT10 115 107914174
BCT11 145 102149261
BCT12 61 113778634
BCT13 46 112930081
BCT14 55 116808839
BCT15 52 117268197
BCT16 71 113646700
BCT17 42 112657675
BCT18 59 112338335
BCT19 67 112930593
BCT2 3541 111270643
BCT20 59 114150194
BCT21 60 114870424
BCT22 56 109124474
BCT23 7839 101592577
BCT24 74483 80628897
BCT25 55373 89586059
BCT26 7073 17322277
BCT3 159 112070853
BCT4 23024 104073120
BCT5 54376 87638936
BCT6 5466 98489581
BCT7 15620 100856871
BCT8 21988 106692337
BCT9 47739 93730267
ENV1 91203 70852034
ENV2 96311 70771609
ENV3 83245 86327578
ENV4 92507 82762950
ENV5 129513 35642421
ENV6 105031 59187528
ENV7 82094 63313243
EST1 68126 26289737
EST10 76542 29845947
EST100 75762 43610646
EST101 71174 36766224
EST102 75013 33363679
EST103 72493 45116514
EST104 73116 33785040
EST105 73091 43139605
EST106 67210 36068929
EST107 73273 36427094
EST108 72730 48193073
EST109 72776 42759593
EST11 75186 28804942
EST110 68682 46206873
EST111 74166 33279634
EST112 70759 29813189
EST113 64559 32016209
EST114 68597 40924592
EST115 69493 38511905
EST116 70951 41901258
EST117 75430 34082066
EST118 74319 27517741
EST119 75044 29033828
EST12 77560 30740468
EST120 72488 39739124
EST121 65301 31813738
EST122 78676 48072978
EST123 78690 44648254
EST124 70749 46683645
EST125 69058 40432067
EST126 72409 49329490
EST127 68146 42806697
EST128 73193 45111153
EST129 75767 44127094
EST13 77009 29270258
EST130 71082 48598929
EST131 74688 47949220
EST132 74355 45995296
EST133 78004 34262754
EST134 77798 28548405
EST135 79843 49229388
EST136 74810 42490823
EST137 64792 35715777
EST138 73021 37095306
EST139 65788 36506474
EST14 78527 31836122
EST140 66839 36566432
EST141 70472 43247113
EST142 72930 43158549
EST143 67982 41369977
EST144 67842 40639732
EST145 75148 43864174
EST146 68555 41558324
EST147 59927 33928949
EST148 96415 52185496
EST149 85606 49409640
EST15 74651 31550365
EST150 77992 40105907
EST151 101347 54650030
EST152 108241 58059371
EST153 98327 54277064
EST154 73828 45109738
EST155 94243 55272638
EST156 99452 59598869
EST157 90729 56079617
EST158 82780 43684501
EST159 70620 41449008
EST16 75794 33337683
EST160 65523 31314817
EST161 62670 28544287
EST162 55122 26208004
EST163 66201 31806638
EST164 58754 29873323
EST165 71495 41208253
EST166 68870 46385338
EST167 68513 48177353
EST168 78134 45193249
EST169 57875 29843197
EST17 82206 33937960
EST170 63262 32257628
EST171 66353 38703501
EST172 64485 43309013
EST173 62552 37908586
EST174 97716 45814991
EST175 83801 45942002
EST176 97675 56434478
EST177 99392 57591905
EST178 91406 49949331
EST179 84919 42739054
EST18 80843 32236579
EST180 90478 37182969
EST181 94216 48930558
EST182 90761 39418530
EST183 91213 38804975
EST184 75935 37760365
EST185 65899 44540522
EST186 68713 39139717
EST187 62237 42257867
EST188 68357 32214061
EST189 75203 28674313
EST19 78531 31812366
EST190 70677 45254842
EST191 82024 41084743
EST192 63497 32660238
EST193 67200 43729823
EST194 68129 50247115
EST195 70082 36613601
EST196 66502 40209939
EST197 70257 57082699
EST198 67355 34981457
EST199 72613 36499028
EST2 74651 28647346
EST20 74690 30659700
EST200 69115 57411827
EST201 67629 52508361
EST202 63670 46666396
EST203 63474 46719704
EST204 64484 46508606
EST205 64061 44700985
EST206 63664 48361258
EST207 63715 40377850
EST208 63250 34229940
EST209 64684 38193117
EST21 73816 34319040
EST210 81199 41915558
EST211 84362 55764444
EST212 67897 41387253
EST213 99199 61696533
EST214 107477 66256125
EST215 109209 63996044
EST216 105502 65921632
EST217 104452 64885127
EST218 111164 49229669
EST219 88466 51705650
EST22 75255 30169223
EST220 88816 46370338
EST221 92166 41872925
EST222 77752 49071801
EST223 66906 39640156
EST224 68032 53736978
EST225 68226 58637173
EST226 76116 50669393
EST227 80126 39296259
EST228 75965 52036303
EST229 71589 51479259
EST23 77342 32670021
EST230 65430 43435051
EST231 27800 10443916
EST232 27868 10458247
EST233 26873 9857595
EST234 26940 9554823
EST235 26686 9131223
EST236 27328 10170642
EST237 27196 9633970
EST238 27225 10001557
EST239 27223 11402735
EST24 74793 32884425
EST240 27171 11585759
EST241 27190 10707500
EST242 27515 9623451
EST243 27137 8813040
EST244 27448 10958808
EST245 27875 10813431
EST246 27551 11045591
EST247 26594 11598016
EST248 26820 11953154
EST249 27121 10654309
EST25 73911 31817129
EST250 26994 11218767
EST251 27052 11904040
EST252 27227 11390566
EST253 27276 10736008
EST254 27249 10901170
EST255 27110 10331997
EST256 26159 14434517
EST257 24910 16963255
EST258 25861 17633827
EST259 88119 36137691
EST26 75328 31130887
EST260 55221 34597662
EST261 91649 36332884
EST262 78546 39772421
EST263 68882 44474758
EST264 69214 44829329
EST265 69088 44283143
EST266 64703 40634664
EST267 79747 44213465
EST268 61970 41702052
EST269 69427 44302027
EST27 74517 32468002
EST270 59159 29630770
EST271 101821 47866509
EST272 86041 43549906
EST273 72209 39970465
EST274 62595 30159690
EST275 69994 41620758
EST276 71128 34914635
EST277 71690 33720362
EST278 71731 44732819
EST279 72417 39796684
EST28 108051 51161127
EST280 63915 38215238
EST281 72625 34398473
EST282 84932 46374905
EST283 71888 46828428
EST284 80282 54585353
EST285 95437 50698843
EST286 98762 46878542
EST287 77023 42906709
EST288 68909 46075316
EST289 75622 34681459
EST29 97076 45965629
EST290 70241 31548239
EST291 71880 33656556
EST292 66764 40303557
EST293 59802 37474393
EST294 66874 38395067
EST295 69015 44100400
EST296 60773 38689269
EST297 85095 43038545
EST298 79637 41393726
EST299 70810 43641081
EST3 73738 29918375
EST30 98317 53742147
EST300 98817 56100929
EST301 118283 49051778
EST302 91808 40792990
EST303 64265 35084558
EST304 71517 43953362
EST305 81755 43932900
EST306 72733 39077936
EST307 70247 44742370
EST308 69623 38694526
EST309 62602 36987884
EST31 83899 48580049
EST310 47636 24925354
EST311 72737 52642742
EST312 69994 39162626
EST313 73092 46832677
EST314 63161 34385236
EST315 70184 36209482
EST316 54637 27556928
EST317 54046 28023159
EST318 53183 28345612
EST319 52822 27811576
EST32 65450 46046822
EST320 52881 29681644
EST321 56707 23097110
EST322 56554 24587328
EST323 54769 22386672
EST324 55999 21995520
EST325 55338 21805243
EST326 57118 23164522
EST327 55642 21649705
EST328 56619 20727131
EST329 59572 25550034
EST33 72748 55093515
EST330 73948 40499822
EST331 74391 34083497
EST332 76201 31078877
EST333 74553 31755498
EST334 85874 50204141
EST335 73374 56272024
EST336 84216 53684410
EST337 92670 56495978
EST338 94285 55444211
EST339 101146 57550865
EST34 85391 48208538
EST340 98763 55050857
EST341 72489 38199211
EST342 68829 39148552
EST343 74127 44644395
EST344 61659 53754585
EST345 64573 46471548
EST346 62694 38165610
EST347 66381 41616641
EST348 71625 47650006
EST349 47818 24040380
EST35 86498 43990853
EST350 52495 26178803
EST351 75504 42255151
EST352 59417 30455186
EST353 60990 32829283
EST354 68132 43084071
EST355 82258 41449632
EST356 70757 41750043
EST357 68597 43923332
EST358 64974 37221072
EST359 68730 44755519
EST36 94962 51777929
EST360 87672 49104232
EST361 84568 50439491
EST362 74428 41180310
EST363 62452 36362016
EST364 69932 36919904
EST365 66961 35712465
EST366 47277 24131690
EST367 71330 40917619
EST368 72974 42684072
EST369 98856 46122159
EST37 84662 58978279
EST370 72856 48860501
EST371 69888 44634165
EST372 68190 43798277
EST373 64035 35021923
EST374 82092 37313944
EST375 75591 39085314
EST376 55446 39413493
EST377 60987 38669065
EST378 61699 39172500
EST379 92223 52328159
EST38 77072 53567983
EST380 83765 44798115
EST381 67094 44890656
EST382 76626 39293092
EST383 48396 30330125
EST384 44118 23118486
EST385 74025 48722196
EST386 80260 39780096
EST387 78279 47726925
EST388 76256 46365635
EST389 77611 47839473
EST39 90342 52994446
EST390 79398 51728416
EST391 84638 66541142
EST392 79422 67255552
EST393 83991 42961235
EST394 65412 38014919
EST395 61362 40530008
EST396 75397 39739346
EST397 53115 33189645
EST398 80535 29925525
EST399 81426 32726526
EST4 74568 28391284
EST40 63478 49870813
EST400 68461 42405778
EST401 64220 36370989
EST402 68482 36293905
EST403 73742 43457164
EST404 65322 45323651
EST405 64069 41228563
EST406 78696 46425313
EST407 57914 32892204
EST408 58576 36439878
EST409 83573 52714166
EST41 85084 49344409
EST410 83748 49052772
EST411 75240 42894733
EST412 58865 41139289
EST413 56881 40946625
EST414 57275 40550992
EST415 63969 39415978
EST416 75246 46050719
EST417 52159 32886221
EST418 61791 38993011
EST419 57912 40814563
EST42 102817 46990407
EST420 61454 41174646
EST421 55709 41976645
EST422 47046 33534092
EST423 92672 42347320
EST424 69432 38571581
EST425 69707 38339714
EST426 69867 38217905
EST427 69541 38780363
EST428 69608 38507842
EST429 69575 38727282
EST43 90558 45840115
EST430 68925 38388150
EST431 68932 38868919
EST432 69128 38699940
EST433 68251 37573814
EST434 67636 38653459
EST435 69349 39110631
EST436 69299 38198422
EST437 69445 38469521
EST438 69521 38048476
EST439 69863 38146528
EST44 99062 47878207
EST440 69691 38375422
EST441 69762 38283085
EST442 69938 37396428
EST443 82568 46925845
EST444 85389 44870056
EST445 80371 36615631
EST446 99177 57905927
EST447 79711 43901691
EST448 73728 47238794
EST449 83086 50020110
EST45 91456 35225693
EST450 92617 57441211
EST451 87120 51467528
EST452 81467 45990543
EST453 85676 47240371
EST454 69411 45608179
EST455 52199 40592728
EST456 66382 45801310
EST457 68127 38121030
EST458 63509 37854543
EST459 103196 53618408
EST46 68708 18231237
EST460 84999 50202000
EST461 87976 54229324
EST462 62709 43870324
EST463 43331 31133493
EST464 46912 58469898
EST465 62174 56637203
EST466 64722 42954225
EST467 73491 42061988
EST468 73787 42960013
EST469 68597 44111603
EST47 68709 18410735
EST470 66471 40210059
EST471 58764 51363551
EST472 106676 47363750
EST473 102781 48066020
EST474 68736 50632143
EST475 55246 39020332
EST476 57385 40114123
EST477 60982 40410981
EST478 62673 49547671
EST479 64765 45686522
EST48 63792 19511790
EST480 58537 40267539
EST481 51384 38724138
EST482 58917 40481172
EST483 59605 38961895
EST484 69796 40134094
EST485 61463 42018107
EST486 56915 38473798
EST487 62088 44991713
EST488 58409 45716182
EST489 64991 47658902
EST49 43715 11914104
EST490 60695 40937982
EST491 56546 40933615
EST492 51738 34423376
EST493 57020 39151600
EST494 56077 36753209
EST495 76564 42921275
EST496 61976 50048340
EST497 74131 56987676
EST498 78785 49823529
EST499 46993 55306985
EST5 48195 15293879
EST50 43330 11999872
EST500 52311 50449206
EST501 65858 54113622
EST502 59394 39160775
EST503 71793 38011793
EST504 84923 55358644
EST505 80568 53375059
EST506 74562 44186031
EST507 59474 39279230
EST508 71834 46047000
EST509 81651 50507452
EST51 43210 11439690
EST510 79471 54055122
EST511 71912 56515634
EST512 71578 50491248
EST513 66928 45262813
EST514 66344 51222445
EST515 62696 45460212
EST516 69849 44255267
EST517 78630 44803284
EST518 97008 43212026
EST519 122929 46253515
EST52 78012 31513960
EST520 87706 54749574
EST521 55429 49948518
EST522 56380 47734290
EST523 91974 21742468
EST524 99699 11057803
EST525 99489 12309584
EST526 94972 44567900
EST527 86991 31686420
EST528 86024 34879043
EST529 61363 63810102
EST53 90317 37120112
EST530 89850 56569381
EST531 82878 45755499
EST532 68616 42706392
EST533 72238 49448602
EST534 76104 48866537
EST535 89383 52515221
EST536 70917 51248888
EST537 69767 50075600
EST538 69506 52165559
EST539 81055 54590055
EST54 94504 42761893
EST540 86789 43715537
EST541 82652 47044815
EST542 83546 38702003
EST543 79252 41693384
EST544 79347 52027395
EST545 74657 56314673
EST546 69591 50239859
EST547 81545 44574406
EST548 102834 47524112
EST549 111393 48504354
EST55 92706 45885139
EST550 119340 50274588
EST551 132815 59646869
EST552 92589 53811082
EST553 80238 52521711
EST554 80558 23825338
EST555 84290 8750072
EST556 101415 43241802
EST557 122385 58645265
EST558 69611 44120556
EST559 63913 37824681
EST56 90119 43168594
EST560 74680 50315301
EST561 77240 46993819
EST562 71358 44288953
EST563 74762 46266083
EST564 68672 53365987
EST565 90554 54573913
EST566 97623 51714312
EST567 70034 36180838
EST568 63397 43780415
EST569 79170 53834462
EST57 101453 51294353
EST570 102278 60517101
EST571 75038 43567487
EST572 77654 41205881
EST573 72943 43261647
EST574 87499 46694956
EST575 85155 47291661
EST576 71006 52095449
EST577 85962 56681981
EST578 85456 55461864
EST579 85122 56619083
EST58 102133 52173490
EST580 80128 46639068
EST581 86446 52014541
EST582 74603 44849269
EST583 64081 43523472
EST584 63941 36064786
EST585 107443 34766018
EST586 53907 37045473
EST587 51396 31831320
EST588 51065 34369499
EST589 61687 42217679
EST59 75770 32884885
EST590 71785 46687019
EST591 64794 48017380
EST592 112282 18684593
EST593 118212 14553976
EST594 122584 11136388
EST595 122478 11298459
EST596 105101 22628161
EST597 65350 47524664
EST598 64166 48916401
EST599 81656 53423893
EST6 54921 17444667
EST60 66475 28729724
EST600 74060 48968987
EST601 68016 46871979
EST602 77799 44559821
EST603 64290 43643829
EST604 73986 39331957
EST605 76182 43065748
EST606 74095 47409180
EST607 69018 50827737
EST608 87986 51831215
EST609 79837 48977173
EST61 73166 32432882
EST610 65538 33882273
EST611 66841 41347699
EST612 97383 47030739
EST613 104735 54418664
EST614 62361 47992820
EST615 60783 48374380
EST616 69468 54237298
EST617 71328 30388753
EST618 89118 56374964
EST619 82086 49362422
EST62 70522 30078522
EST620 74475 48479685
EST621 71457 46982214
EST622 70429 51579956
EST623 91217 41333665
EST624 79214 26631244
EST625 79311 25035562
EST626 76998 29713777
EST627 78211 26733872
EST628 77916 29765941
EST629 78262 29246327
EST63 79947 32513484
EST630 77069 29147630
EST631 78317 27944614
EST632 78056 30410220
EST633 78395 29453226
EST634 80152 47109360
EST635 81845 60083098
EST636 81930 59825308
EST637 75250 44380199
EST638 62355 35170534
EST639 72211 44307967
EST64 76000 29892293
EST640 64501 44110224
EST641 58125 45749467
EST642 61763 44551705
EST643 74436 44915014
EST644 64290 40778834
EST645 87974 53915964
EST646 68632 42140791
EST647 66794 45594774
EST648 78088 49808928
EST649 74923 38182921
EST65 70866 28592376
EST650 68392 46618280
EST651 76799 51774803
EST652 59188 40949898
EST653 70083 50645820
EST654 71034 50094068
EST655 73508 46310541
EST656 69327 50002651
EST657 69654 46952390
EST658 77131 39084059
EST659 70502 31581515
EST66 65066 29750415
EST660 55591 33513663
EST661 66237 46917686
EST662 63720 40836662
EST663 66710 49079096
EST664 66923 44270476
EST665 58603 39032927
EST666 54462 37575830
EST667 64851 43299902
EST668 73095 32011547
EST669 71734 26058473
EST67 72924 32726306
EST670 73332 26619582
EST671 72652 26444506
EST672 78142 26267328
EST673 72416 28537912
EST674 69629 27938993
EST675 16827 5109862
EST68 79006 35298745
EST69 73493 29365895
EST7 74544 29357867
EST70 74317 25040002
EST71 86891 42258985
EST72 42449 12026824
EST73 40413 11115569
EST74 40382 12380472
EST75 40756 12578111
EST76 40780 12178330
EST77 40781 13219676
EST78 40623 12682417
EST79 40484 12353202
EST8 75833 30592306
EST80 40140 11913668
EST81 40793 12801383
EST82 41475 11693699
EST83 41013 13194942
EST84 40903 12758490
EST85 41892 13197137
EST86 45736 14358496
EST87 43253 27300417
EST88 42069 20308732
EST89 47120 18898581
EST9 77569 29868098
EST90 50735 23058095
EST91 51207 21243220
EST92 77514 45743596
EST93 77948 38679616
EST94 72709 28150376
EST95 75718 29166752
EST96 74255 38621833
EST97 76319 42166474
EST98 77440 44696418
EST99 75434 34798634
GSS1 81983 35151959
GSS10 66195 33932453
GSS100 77651 44534380
GSS101 66905 36320703
GSS102 75879 49287411
GSS103 65945 53300540
GSS104 76942 47935441
GSS105 73860 55218404
GSS106 77447 51016385
GSS107 76097 52374552
GSS108 80404 46466790
GSS109 74159 65447979
GSS11 68147 40182229
GSS110 72971 42910530
GSS111 67831 38668939
GSS112 66634 41704916
GSS113 66852 41155694
GSS114 66887 41067960
GSS115 66578 40870176
GSS116 66885 40037439
GSS117 69325 45250355
GSS118 76186 50769615
GSS119 75852 49644046
GSS12 65613 32971532
GSS120 74827 47115394
GSS121 74085 46096497
GSS122 76455 51525715
GSS123 72513 56620963
GSS124 80056 41242882
GSS125 85008 51894326
GSS126 69343 43023358
GSS127 76829 52311790
GSS128 79246 62651119
GSS129 72007 45934591
GSS13 64358 34440226
GSS130 69037 41458438
GSS131 77166 42628585
GSS132 85794 48407913
GSS133 76653 50652213
GSS134 77491 49395430
GSS135 76040 47555593
GSS136 69170 63294066
GSS137 69148 61745718
GSS138 72165 55287313
GSS139 68225 47503323
GSS14 68326 35714444
GSS140 65766 45814446
GSS141 66187 45046223
GSS142 66317 44892334
GSS143 65514 46270063
GSS144 67306 45384755
GSS145 76462 54381142
GSS146 74721 52408498
GSS147 68057 52665424
GSS148 57504 51347644
GSS149 70598 55363181
GSS15 67693 31132008
GSS150 68897 62943884
GSS151 69366 50633459
GSS152 69949 45528659
GSS153 81723 52126364
GSS154 86398 52382798
GSS155 84603 54733276
GSS156 73334 49044283
GSS157 83487 44485863
GSS158 64920 58856801
GSS159 97185 50356866
GSS16 65169 28830099
GSS160 105001 53332355
GSS161 89562 55490573
GSS162 71621 48299410
GSS163 41788 26326878
GSS164 63957 47336930
GSS165 66364 50807657
GSS166 66344 50841374
GSS167 66368 50799668
GSS168 66363 50807561
GSS169 66358 50816248
GSS17 69434 37703819
GSS170 66330 50865207
GSS171 70342 51616675
GSS172 68202 44544644
GSS173 77972 42388069
GSS174 82417 55918311
GSS175 74429 60644167
GSS176 84210 52322129
GSS177 83698 52182299
GSS178 75302 53785172
GSS179 69890 46506847
GSS18 66126 37729125
GSS180 66380 40953584
GSS181 82074 53498835
GSS182 86106 53405919
GSS183 77289 57558903
GSS184 77855 50762609
GSS185 108301 5607083
GSS186 81256 39569661
GSS187 71202 43093396
GSS188 74034 49014152
GSS189 48557 35316343
GSS19 62331 28672937
GSS190 46990 36251569
GSS191 57020 47760479
GSS192 53565 41634132
GSS193 52952 43015176
GSS194 52236 44442884
GSS195 52560 43420264
GSS196 53073 41839482
GSS197 53150 42293170
GSS198 53533 44193029
GSS199 53588 44024665
GSS2 83264 35168809
GSS20 51683 26279054
GSS200 53320 44851794
GSS201 52973 43993436
GSS202 53330 41809320
GSS203 53001 44175580
GSS204 54558 45993944
GSS205 54810 45262772
GSS206 54861 45133072
GSS207 54893 45038694
GSS208 54995 44729861
GSS209 55145 44277854
GSS21 51749 26109665
GSS210 54240 42562573
GSS211 53852 40991997
GSS212 53113 43316683
GSS213 53557 41928199
GSS214 53531 42008689
GSS215 53115 43312595
GSS216 52990 43700005
GSS217 53001 43667287
GSS218 53597 44818343
GSS219 54522 45881596
GSS22 52536 23986462
GSS220 54453 46087360
GSS221 54490 44298135
GSS222 55135 41668322
GSS223 54883 42454059
GSS224 53967 45282393
GSS225 54179 44635463
GSS226 54004 45168017
GSS227 54146 44735028
GSS228 54006 45160797
GSS229 54277 44336058
GSS23 55688 24577272
GSS230 54119 44818442
GSS231 54292 44290846
GSS232 54266 44372720
GSS233 54414 43919451
GSS234 53480 42040731
GSS235 53579 41609144
GSS236 53171 42993412
GSS237 52924 43855469
GSS238 53361 42484934
GSS239 52848 43156433
GSS24 59916 38118893
GSS240 54812 45539870
GSS241 58926 49790277
GSS242 59288 49602350
GSS243 94049 59064520
GSS244 73219 40734778
GSS245 71284 53789845
GSS246 80015 46008614
GSS247 37303 21093131
GSS248 86843 64232072
GSS249 83567 62773367
GSS25 52511 24049271
GSS250 103049 48153603
GSS251 68656 58536078
GSS252 68310 58771394
GSS253 69366 56632173
GSS254 69633 56114500
GSS255 70526 55524384
GSS256 85869 73170056
GSS257 86403 44923726
GSS258 88351 46874211
GSS259 85037 64836847
GSS26 55165 36701640
GSS260 70302 58968384
GSS261 69852 59875178
GSS262 63594 60939475
GSS263 81687 47122760
GSS264 87275 35467890
GSS265 107454 82038171
GSS266 105369 69703338
GSS267 84066 33990134
GSS268 119993 73845937
GSS269 120108 73738621
GSS27 67602 31709980
GSS270 116000 75274590
GSS271 94805 51419724
GSS272 87263 55387002
GSS273 98914 65322908
GSS274 107917 77918598
GSS275 107208 78806529
GSS276 105847 80265387
GSS277 97282 72838052
GSS278 83452 54605715
GSS279 110407 67138414
GSS28 53857 20521329
GSS280 110231 65983833
GSS281 104682 56504571
GSS282 75979 43261666
GSS283 106157 50660751
GSS284 89490 52485281
GSS285 95499 69068511
GSS286 95167 67698871
GSS287 95921 36514993
GSS288 95346 37391695
GSS289 96752 35028607
GSS29 52222 24831238
GSS290 94483 38835268
GSS291 90397 60592354
GSS292 83858 28362132
GSS293 84361 27393234
GSS294 85083 25930408
GSS295 38048 15215379
GSS3 79723 37808591
GSS30 69198 31935126
GSS31 50985 27997860
GSS32 76035 37623350
GSS33 74264 35981276
GSS34 67467 36695142
GSS35 63226 44686701
GSS36 71187 32537831
GSS37 70957 38269510
GSS38 68305 36937456
GSS39 73175 42393318
GSS4 73951 37730128
GSS40 79620 52901854
GSS41 79795 51468362
GSS42 77610 40744406
GSS43 76844 43510043
GSS44 80150 36131815
GSS45 75657 27231474
GSS46 73804 51843060
GSS47 73386 52491574
GSS48 67336 45936449
GSS49 65426 43236538
GSS5 70467 37700496
GSS50 65451 43183647
GSS51 72366 38885184
GSS52 73468 39890711
GSS53 75646 53233976
GSS54 78496 61372131
GSS55 74451 46645234
GSS56 85585 53336573
GSS57 80119 52192378
GSS58 71736 43456937
GSS59 64587 33100995
GSS6 70570 35428382
GSS60 79401 51956020
GSS61 77159 40082694
GSS62 77303 49177942
GSS63 65927 68850747
GSS64 64968 70288433
GSS65 81126 61617781
GSS66 80695 53521092
GSS67 57622 40620718
GSS68 58764 40554125
GSS69 78583 58194636
GSS7 70049 35131726
GSS70 81121 59763024
GSS71 74486 43686360
GSS72 79705 49453011
GSS73 78167 54088818
GSS74 87928 50147020
GSS75 88741 48053355
GSS76 88653 48169856
GSS77 89304 47307764
GSS78 90230 46080542
GSS79 89843 46593016
GSS8 70767 36261913
GSS80 90822 45297533
GSS81 90077 46282934
GSS82 89807 46640879
GSS83 86827 51637850
GSS84 81764 63331752
GSS85 81670 64342433
GSS86 80361 63454611
GSS87 79858 63319050
GSS88 79869 57505710
GSS89 80834 42279592
GSS9 68447 33994914
GSS90 71431 20463808
GSS91 70932 21729057
GSS92 79726 34903824
GSS93 76059 48440589
GSS94 71745 45740357
GSS95 80266 57337045
GSS96 72389 53491926
GSS97 70211 71278125
GSS98 70840 61228155
GSS99 78347 43037092
HTC1 24998 26954535
HTC10 64837 83565335
HTC11 68115 59261731
HTC12 47043 51551421
HTC2 15993 36013431
HTC3 15970 36547861
HTC4 16191 35357336
HTC5 15927 40313070
HTC6 16010 37271080
HTC7 51171 28266248
HTC8 81482 60687313
HTC9 76078 71560254
HTG1 1318 188929277
HTG10 1300 186477873
HTG100 1065 192917501
HTG101 1069 188606095
HTG102 1109 191115739
HTG103 1222 190789706
HTG104 1223 191185424
HTG105 554 64981448
HTG11 1437 184144251
HTG12 883 191839640
HTG13 751 192403068
HTG14 743 192211920
HTG15 782 192281135
HTG16 803 192110055
HTG17 768 192308108
HTG18 2056 171242738
HTG19 1050 187938699
HTG2 2465 186071856
HTG20 994 189114630
HTG21 782 191981791
HTG22 924 190472464
HTG23 903 190578787
HTG24 807 191448804
HTG25 779 191978670
HTG26 859 191431375
HTG27 888 190837083
HTG28 948 189921302
HTG29 897 191079664
HTG3 2517 185290576
HTG30 928 190561776
HTG31 874 191415178
HTG32 968 189678782
HTG33 878 191299128
HTG34 858 191420437
HTG35 827 192121978
HTG36 935 190219736
HTG37 937 190702812
HTG38 938 190431111
HTG39 1034 189392974
HTG4 2553 188532563
HTG40 1187 187278405
HTG41 1257 188042194
HTG42 1182 188260277
HTG43 1161 187443403
HTG44 1104 191559361
HTG45 1283 190867403
HTG46 1172 191011397
HTG47 1134 191211332
HTG48 1043 191199328
HTG49 937 189434429
HTG5 1284 185715991
HTG50 1057 189721601
HTG51 898 189812268
HTG52 1042 189635965
HTG53 925 189775649
HTG54 1016 189891442
HTG55 969 189685581
HTG56 980 189048792
HTG57 1089 188986461
HTG58 977 189426903
HTG59 1138 185779958
HTG6 1274 185234665
HTG60 1046 188905850
HTG61 1003 189162522
HTG62 995 188910299
HTG63 993 189022487
HTG64 1124 188781648
HTG65 1154 186958909
HTG66 1289 184461431
HTG67 1224 185501417
HTG68 1242 184714379
HTG69 1246 184699396
HTG7 1277 185414872
HTG70 1301 186874524
HTG71 1239 187602660
HTG72 1236 189547752
HTG73 1113 191097938
HTG74 1207 191673990
HTG75 1134 190928823
HTG76 1182 191203850
HTG77 1145 190989322
HTG78 1174 191040534
HTG79 1200 190562193
HTG8 1459 184762119
HTG80 1122 190733598
HTG81 1138 191169229
HTG82 1333 187234898
HTG83 1209 190995754
HTG84 1205 191389287
HTG85 1140 191570297
HTG86 1168 191717248
HTG87 1255 191212446
HTG88 1233 190005549
HTG89 1266 190268050
HTG9 1200 186999351
HTG90 1235 190606597
HTG91 1271 190543275
HTG92 1290 190656514
HTG93 1215 189532465
HTG94 1085 187740512
HTG95 1587 191238296
HTG96 1020 190945925
HTG97 820 175152469
HTG98 1021 189433020
HTG99 1098 192720184
INV1 42570 122957496
INV10 80660 72028508
INV11 17859 78656975
INV2 1686 181192694
INV3 1809 143813718
INV4 71174 80478925
INV5 60635 87780763
INV6 37823 107929782
INV7 81464 71437020
INV8 62686 86435548
INV9 83782 65808788
MAM1 15575 162089901
MAM2 69312 74815426
MAM3 54480 112793666
MAM4 14426 14251357
PAT1 222610 70141260
PAT10 125437 99518322
PAT11 141739 62608396
PAT12 105795 59941764
PAT13 103555 50226564
PAT14 121472 53274905
PAT15 113046 61292248
PAT16 145018 54899867
PAT17 155517 69893240
PAT18 97490 122598017
PAT19 147594 87373130
PAT2 194518 84655123
PAT20 117407 104542066
PAT21 123717 103465007
PAT22 119286 106149134
PAT23 140192 91319413
PAT24 203990 39164825
PAT25 101745 75139475
PAT26 95444 84263317
PAT27 116944 64735334
PAT28 96529 83259841
PAT29 115325 61768127
PAT3 171984 95898893
PAT30 134277 86432566
PAT31 147613 107609425
PAT32 160696 96227363
PAT33 253885 6347125
PAT34 77523 20246566
PAT4 153750 106059356
PAT5 184018 85619906
PAT6 156356 93378118
PAT7 152402 81705440
PAT8 104672 119401279
PAT9 143543 89226955
PHG 3557 26321507
PLN1 51965 101688989
PLN10 22478 121305330
PLN11 18520 152104786
PLN12 18259 152685278
PLN13 18259 152836371
PLN14 6845 158558270
PLN15 1201 171247635
PLN16 469 167649907
PLN17 6 176743046
PLN18 28549 121260884
PLN19 71821 73642969
PLN2 1463 168353876
PLN20 76675 77756882
PLN21 54841 91885489
PLN22 14060 143699427
PLN23 63706 84963142
PLN24 75110 78648641
PLN25 97976 55341897
PLN26 81407 77366514
PLN27 39829 70414992
PLN3 1647 182799929
PLN4 1896 182173398
PLN5 66467 88560089
PLN6 73895 78069079
PLN7 58026 58380266
PLN8 35567 58519332
PLN9 15145 141858453
PRI1 32832 118124368
PRI10 1458 182828344
PRI11 1275 179102729
PRI12 1455 178145178
PRI13 1589 179925322
PRI14 1605 182184488
PRI15 1269 192101792
PRI16 1138 193927573
PRI17 1102 194311498
PRI18 1351 193455703
PRI19 35825 131445235
PRI2 1635 172522504
PRI20 66924 87424025
PRI21 34154 89345003
PRI22 2643 181268061
PRI23 2190 184651140
PRI24 1642 185151077
PRI25 2079 185480807
PRI26 2125 183087291
PRI27 12231 161370579
PRI28 7648 166166850
PRI29 58073 89564865
PRI3 1308 183734483
PRI30 32774 64953410
PRI31 19222 128239167
PRI32 22330 146301005
PRI33 78291 74656969
PRI34 57038 95468019
PRI4 1343 185153158
PRI5 1196 181294625
PRI6 1186 178958872
PRI7 1236 181237397
PRI8 1316 175951021
PRI9 1244 175205631
ROD1 29177 145615235
ROD10 981 181670806
ROD11 1031 186063424
ROD12 953 183233103
ROD13 1030 188783740
ROD14 953 180699242
ROD15 965 182013459
ROD16 1006 186345373
ROD17 14501 167944868
ROD18 22603 148848395
ROD19 1166 187331422
ROD2 913 175073803
ROD20 1200 186358241
ROD21 22011 152390879
ROD22 34387 68266073
ROD23 11630 149544809
ROD24 42009 146264084
ROD25 134303 33644492
ROD26 18100 22308373
ROD3 913 173566113
ROD4 906 174168277
ROD5 929 174129383
ROD6 981 179748731
ROD7 957 179885830
ROD8 994 181944257
ROD9 1004 182728487
STS1 84256 36151809
STS10 57828 44845894
STS11 57929 43635614
STS12 64464 43031758
STS13 86552 36758497
STS14 71243 31200765
STS2 83993 48162362
STS3 69756 27454652
STS4 79049 37549640
STS5 54784 32171940
STS6 54866 31898275
STS7 54670 32202858
STS8 55682 35638370
STS9 57900 44451157
SYN1 50630 68517407
SYN2 5068 10456794
UNA 211 114018
VRL1 72055 65950088
VRL2 70802 64185386
VRL3 71177 65918787
VRL4 69548 67836593
VRL5 56632 73567476
VRL6 63295 71461952
VRL7 69207 67049737
VRL8 43330 42522341
VRT1 19731 162086473
VRT10 10440 178439784
VRT11 8659 179393039
VRT12 5006 185092070
VRT13 54924 108436774
VRT14 80615 69851879
VRT15 4979 5051039
VRT2 52076 116372797
VRT3 21692 154762215
VRT4 63705 93091331
VRT5 54696 65834167
VRT6 22983 110625187
VRT7 1217 191771171
VRT8 1268 191107555
VRT9 8286 179915066
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 163.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11279087 12854169426 Homo sapiens
7228215 8323105071 Mus musculus
1305109 5778218766 Rattus norvegicus
2880831 4205748958 Zea mays
2057685 3845789573 Bos taurus
1584337 2832324577 Danio rerio
2121316 2304579871 Sus scrofa
227854 1352499678 Strongylocentrotus purpuratus
1418414 1136849350 Xenopus tropicalis
1130666 1005948286 Oryza sativa Japonica Group
212624 974669347 Pan troglodytes
738789 900252577 Drosophila melanogaster
1951847 881157707 Arabidopsis thaliana
802672 864709966 Gallus gallus
530099 838165327 Vitis vinifera
76348 784577143 Macaca mulatta
1221140 700538475 Canis lupus familiaris
1011784 660118364 Sorghum bicolor
1103658 656437787 Triticum aestivum
422523 536075160 Medicago truncatula
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
15 October 2007
NCBI-GenBank Flat File Release 163.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
15 December 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 163.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko
Database Administration
Slava Khotomliansky, Ben Slade, Angela Tirone
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
