Release Notes For GenBank Release 165
GBREL.TXT Genetic Sequence Data Bank
April 15 2008
NCBI-GenBank Flat File Release 165.0
Distribution Release Notes
85500730 loci, 89172350468 bases, from 85500730 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 165.0
1.2 Cutoff Date
1.3 Important Changes in Release 165.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 165.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 165.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 165.0, incorporates data available to the collaborating
databases as of April 14, 2008 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 165.0
1.3.1 Organizational changes
The total number of sequence data files increased by 41 with this release:
- the BCT division is now comprised of 28 files (+2)
- the EST division is now comprised of 713 files (+19)
- the GSS division is now comprised of 285 files (+8)
- the HTG division is now comprised of 114 files (+7)
- the PAT division is now comprised of 38 files (+3)
- the PLN division is now comprised of 29 files (+1)
- the VRL division is now comprised of 9 files (+1)
1.3.2 New Transcriptome Shotgun Assembly (TSA) division now legal
A new GenBank division for assembled mRNA sequences, Transcriptome Shotgun
Assembly (TSA), can now appear in GenBank releases, as of this April 2008
Release 165.0. The date of first appearance of a TSA record will depend
on the status of TSA submission processing, but it *is* expected that they will
begin to appear in the GenBank Incremental Updates (GIU) within the next
month, and that Release 166.0 will include a divisional TSA file.
Files in this new division will have filenames of:
gbtsaNN.aso.gz (ASN.1 format)
gbtsaNN.seq.gz (GenBank flatfile format)
where 'NN' represents an integer file-number within the TSA division.
TSA sequences are shotgun assemblies of primary sequences deposited in
dbEST, the Trace Archive (TA) or the Short-Read Archive (SRA). Keywords
"TSA" and "Transcriptome Shotgun Assembly" are present on all TSA
records, in addition to a division code value of "TSA" on the LOCUS line.
No format changes (new or changed line types, features, or qualifiers)
are anticipated for this new class of GenBank record.
However, note that TSA records make use of the same PRIMARY block that
is utilized for Third-Party Annotation (TPA) records. The PRIMARY block
contains references to the underlying reads/transcripts that were assembled
to construct a TSA record.
It might be helpful to review Third Party Annotation record BK005658,
which provides a good example of PRIMARY block usage:
http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=83843278
Requirements for the new Transcriptome Shotgun Assembly division include:
1. Submission of primary transcipt sequence data to dbEST, the Trace Archive,
or the Short-Read archive (SRA).
2. Registration of an associated transcriptome project with the International
Nucleotide Sequence Database Collaboration (INSDC).
For information about submitting projects via NCBI/GenBank, see:
http://www.ncbi.nlm.nih.gov/genomes/mpfsubmission.cgi
3. Submission of TSA sequence records to GenBank, including an assembly file
(.ace format)
Note that TSA records and the primary transcript sequences that they are
built from must be provided by the same submitter or collaborative group.
Examples of TSA records and more information about how to submit them
will be provided in future editions of these release notes, and via the
GenBank newsgroup.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
fifty-four of the GSS flatfiles in Release 165.0. Consider gbgss232.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
April 15 2008
NCBI-GenBank Flat File Release 165.0
GSS Sequences (Part 1)
87177 loci, 64476488 bases, from 87177 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "232" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 Comprehensive protein FASTA file to be discontinued
With the availability of divisional protein FASTA files as of GenBank
Release 164.0, support for the single, large, comprehensive protein FASTA
file:
ftp://ftp.ncbi.nih.gov/genbank/relNNN.fsa_aa.gz
(where 'NNN' represents a three-digit GenBank release number) will be
discontinued after GenBank Release 166.0 in June of 2008. The size
of this file has grown to exceed 4GB, which is unmanageable for many users.
Users are advised to make plans to utilize the new divisional files by
August of 2008. If this timetable poses problems, please let us know at the
NCBI Service Desk:
[email protected]
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1502 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut6.idx - Index of the entries according to author name, part 6.
51. gbaut7.idx - Index of the entries according to author name, part 7.
52. gbaut8.idx - Index of the entries according to author name, part 8.
53. gbaut9.idx - Index of the entries according to author name, part 9.
54. gbbct1.seq - Bacterial sequence entries, part 1.
55. gbbct10.seq - Bacterial sequence entries, part 10.
56. gbbct11.seq - Bacterial sequence entries, part 11.
57. gbbct12.seq - Bacterial sequence entries, part 12.
58. gbbct13.seq - Bacterial sequence entries, part 13.
59. gbbct14.seq - Bacterial sequence entries, part 14.
60. gbbct15.seq - Bacterial sequence entries, part 15.
61. gbbct16.seq - Bacterial sequence entries, part 16.
62. gbbct17.seq - Bacterial sequence entries, part 17.
63. gbbct18.seq - Bacterial sequence entries, part 18.
64. gbbct19.seq - Bacterial sequence entries, part 19.
65. gbbct2.seq - Bacterial sequence entries, part 2.
66. gbbct20.seq - Bacterial sequence entries, part 20.
67. gbbct21.seq - Bacterial sequence entries, part 21.
68. gbbct22.seq - Bacterial sequence entries, part 22.
69. gbbct23.seq - Bacterial sequence entries, part 23.
70. gbbct24.seq - Bacterial sequence entries, part 24.
71. gbbct25.seq - Bacterial sequence entries, part 25.
72. gbbct26.seq - Bacterial sequence entries, part 26.
73. gbbct27.seq - Bacterial sequence entries, part 27.
74. gbbct28.seq - Bacterial sequence entries, part 28.
75. gbbct3.seq - Bacterial sequence entries, part 3.
76. gbbct4.seq - Bacterial sequence entries, part 4.
77. gbbct5.seq - Bacterial sequence entries, part 5.
78. gbbct6.seq - Bacterial sequence entries, part 6.
79. gbbct7.seq - Bacterial sequence entries, part 7.
80. gbbct8.seq - Bacterial sequence entries, part 8.
81. gbbct9.seq - Bacterial sequence entries, part 9.
82. gbchg.txt - Accession numbers of entries updated since the previous release.
83. gbcon1.seq - Constructed sequence entries, part 1.
84. gbcon10.seq - Constructed sequence entries, part 10.
85. gbcon11.seq - Constructed sequence entries, part 11.
86. gbcon12.seq - Constructed sequence entries, part 12.
87. gbcon13.seq - Constructed sequence entries, part 13.
88. gbcon14.seq - Constructed sequence entries, part 14.
89. gbcon15.seq - Constructed sequence entries, part 15.
90. gbcon16.seq - Constructed sequence entries, part 16.
91. gbcon17.seq - Constructed sequence entries, part 17.
92. gbcon18.seq - Constructed sequence entries, part 18.
93. gbcon19.seq - Constructed sequence entries, part 19.
94. gbcon2.seq - Constructed sequence entries, part 2.
95. gbcon20.seq - Constructed sequence entries, part 20.
96. gbcon21.seq - Constructed sequence entries, part 21.
97. gbcon22.seq - Constructed sequence entries, part 22.
98. gbcon23.seq - Constructed sequence entries, part 23.
99. gbcon24.seq - Constructed sequence entries, part 24.
100. gbcon25.seq - Constructed sequence entries, part 25.
101. gbcon26.seq - Constructed sequence entries, part 26.
102. gbcon27.seq - Constructed sequence entries, part 27.
103. gbcon28.seq - Constructed sequence entries, part 28.
104. gbcon29.seq - Constructed sequence entries, part 29.
105. gbcon3.seq - Constructed sequence entries, part 3.
106. gbcon30.seq - Constructed sequence entries, part 30.
107. gbcon31.seq - Constructed sequence entries, part 31.
108. gbcon32.seq - Constructed sequence entries, part 32.
109. gbcon33.seq - Constructed sequence entries, part 33.
110. gbcon34.seq - Constructed sequence entries, part 34.
111. gbcon35.seq - Constructed sequence entries, part 35.
112. gbcon36.seq - Constructed sequence entries, part 36.
113. gbcon37.seq - Constructed sequence entries, part 37.
114. gbcon38.seq - Constructed sequence entries, part 38.
115. gbcon39.seq - Constructed sequence entries, part 39.
116. gbcon4.seq - Constructed sequence entries, part 4.
117. gbcon40.seq - Constructed sequence entries, part 40.
118. gbcon41.seq - Constructed sequence entries, part 41.
119. gbcon42.seq - Constructed sequence entries, part 42.
120. gbcon43.seq - Constructed sequence entries, part 43.
121. gbcon44.seq - Constructed sequence entries, part 44.
122. gbcon45.seq - Constructed sequence entries, part 45.
123. gbcon46.seq - Constructed sequence entries, part 46.
124. gbcon47.seq - Constructed sequence entries, part 47.
125. gbcon48.seq - Constructed sequence entries, part 48.
126. gbcon49.seq - Constructed sequence entries, part 49.
127. gbcon5.seq - Constructed sequence entries, part 5.
128. gbcon50.seq - Constructed sequence entries, part 50.
129. gbcon51.seq - Constructed sequence entries, part 51.
130. gbcon52.seq - Constructed sequence entries, part 52.
131. gbcon53.seq - Constructed sequence entries, part 53.
132. gbcon54.seq - Constructed sequence entries, part 54.
133. gbcon55.seq - Constructed sequence entries, part 55.
134. gbcon56.seq - Constructed sequence entries, part 56.
135. gbcon57.seq - Constructed sequence entries, part 57.
136. gbcon58.seq - Constructed sequence entries, part 58.
137. gbcon59.seq - Constructed sequence entries, part 59.
138. gbcon6.seq - Constructed sequence entries, part 6.
139. gbcon60.seq - Constructed sequence entries, part 60.
140. gbcon61.seq - Constructed sequence entries, part 61.
141. gbcon62.seq - Constructed sequence entries, part 62.
142. gbcon63.seq - Constructed sequence entries, part 63.
143. gbcon64.seq - Constructed sequence entries, part 64.
144. gbcon65.seq - Constructed sequence entries, part 65.
145. gbcon66.seq - Constructed sequence entries, part 66.
146. gbcon67.seq - Constructed sequence entries, part 67.
147. gbcon68.seq - Constructed sequence entries, part 68.
148. gbcon69.seq - Constructed sequence entries, part 69.
149. gbcon7.seq - Constructed sequence entries, part 7.
150. gbcon70.seq - Constructed sequence entries, part 70.
151. gbcon71.seq - Constructed sequence entries, part 71.
152. gbcon72.seq - Constructed sequence entries, part 72.
153. gbcon73.seq - Constructed sequence entries, part 73.
154. gbcon74.seq - Constructed sequence entries, part 74.
155. gbcon75.seq - Constructed sequence entries, part 75.
156. gbcon76.seq - Constructed sequence entries, part 76.
157. gbcon77.seq - Constructed sequence entries, part 77.
158. gbcon78.seq - Constructed sequence entries, part 78.
159. gbcon79.seq - Constructed sequence entries, part 79.
160. gbcon8.seq - Constructed sequence entries, part 8.
161. gbcon80.seq - Constructed sequence entries, part 80.
162. gbcon81.seq - Constructed sequence entries, part 81.
163. gbcon82.seq - Constructed sequence entries, part 82.
164. gbcon83.seq - Constructed sequence entries, part 83.
165. gbcon84.seq - Constructed sequence entries, part 84.
166. gbcon85.seq - Constructed sequence entries, part 85.
167. gbcon9.seq - Constructed sequence entries, part 9.
168. gbdel.txt - Accession numbers of entries deleted since the previous release.
169. gbenv1.seq - Environmental sampling sequence entries, part 1.
170. gbenv2.seq - Environmental sampling sequence entries, part 2.
171. gbenv3.seq - Environmental sampling sequence entries, part 3.
172. gbenv4.seq - Environmental sampling sequence entries, part 4.
173. gbenv5.seq - Environmental sampling sequence entries, part 5.
174. gbenv6.seq - Environmental sampling sequence entries, part 6.
175. gbenv7.seq - Environmental sampling sequence entries, part 7.
176. gbenv8.seq - Environmental sampling sequence entries, part 8.
177. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
178. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
179. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
180. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
181. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
182. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
183. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
184. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
185. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
186. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
187. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
188. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
189. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
190. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
191. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
192. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
193. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
194. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
195. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
196. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
197. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
198. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
199. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
200. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
201. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
202. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
203. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
204. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
205. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
206. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
207. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
208. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
209. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
210. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
211. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
212. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
213. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
214. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
215. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
216. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
217. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
218. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
219. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
220. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
221. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
222. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
223. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
224. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
225. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
226. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
227. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
228. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
229. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
230. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
231. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
232. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
233. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
234. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
235. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
236. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
237. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
238. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
239. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
240. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
241. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
242. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
243. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
244. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
245. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
246. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
247. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
248. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
249. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
250. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
251. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
252. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
253. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
254. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
255. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
256. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
257. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
258. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
259. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
260. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
261. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
262. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
263. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
264. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
265. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
266. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
267. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
268. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
269. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
270. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
271. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
272. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
273. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
274. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
275. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
276. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
277. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
278. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
279. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
280. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
281. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
282. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
283. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
284. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
285. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
286. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
287. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
288. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
289. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
290. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
291. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
292. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
293. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
294. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
295. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
296. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
297. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
298. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
299. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
300. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
301. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
302. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
303. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
304. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
305. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
306. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
307. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
308. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
309. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
310. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
311. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
312. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
313. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
314. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
315. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
316. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
317. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
318. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
319. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
320. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
321. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
322. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
323. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
324. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
325. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
326. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
327. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
328. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
329. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
330. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
331. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
332. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
333. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
334. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
335. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
336. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
337. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
338. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
339. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
340. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
341. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
342. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
343. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
344. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
345. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
346. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
347. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
348. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
349. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
350. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
351. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
352. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
353. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
354. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
355. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
356. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
357. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
358. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
359. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
360. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
361. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
362. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
363. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
364. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
365. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
366. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
367. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
368. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
369. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
370. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
371. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
372. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
373. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
374. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
375. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
376. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
377. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
378. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
379. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
380. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
381. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
382. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
383. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
384. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
385. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
386. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
387. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
388. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
389. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
390. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
391. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
392. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
393. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
394. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
395. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
396. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
397. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
398. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
399. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
400. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
401. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
402. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
403. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
404. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
405. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
406. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
407. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
408. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
409. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
410. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
411. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
412. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
413. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
414. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
415. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
416. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
417. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
418. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
419. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
420. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
421. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
422. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
423. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
424. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
425. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
426. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
427. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
428. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
429. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
430. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
431. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
432. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
433. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
434. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
435. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
436. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
437. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
438. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
439. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
440. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
441. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
442. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
443. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
444. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
445. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
446. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
447. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
448. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
449. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
450. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
451. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
452. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
453. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
454. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
455. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
456. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
457. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
458. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
459. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
460. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
461. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
462. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
463. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
464. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
465. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
466. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
467. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
468. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
469. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
470. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
471. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
472. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
473. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
474. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
475. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
476. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
477. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
478. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
479. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
480. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
481. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
482. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
483. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
484. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
485. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
486. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
487. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
488. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
489. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
490. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
491. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
492. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
493. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
494. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
495. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
496. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
497. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
498. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
499. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
500. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
501. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
502. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
503. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
504. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
505. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
506. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
507. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
508. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
509. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
510. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
511. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
512. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
513. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
514. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
515. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
516. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
517. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
518. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
519. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
520. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
521. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
522. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
523. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
524. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
525. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
526. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
527. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
528. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
529. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
530. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
531. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
532. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
533. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
534. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
535. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
536. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
537. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
538. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
539. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
540. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
541. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
542. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
543. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
544. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
545. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
546. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
547. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
548. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
549. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
550. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
551. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
552. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
553. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
554. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
555. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
556. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
557. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
558. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
559. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
560. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
561. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
562. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
563. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
564. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
565. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
566. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
567. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
568. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
569. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
570. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
571. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
572. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
573. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
574. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
575. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
576. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
577. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
578. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
579. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
580. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
581. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
582. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
583. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
584. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
585. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
586. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
587. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
588. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
589. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
590. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
591. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
592. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
593. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
594. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
595. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
596. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
597. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
598. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
599. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
600. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
601. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
602. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
603. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
604. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
605. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
606. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
607. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
608. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
609. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
610. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
611. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
612. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
613. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
614. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
615. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
616. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
617. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
618. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
619. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
620. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
621. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
622. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
623. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
624. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
625. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
626. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
627. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
628. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
629. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
630. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
631. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
632. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
633. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
634. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
635. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
636. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
637. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
638. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
639. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
640. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
641. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
642. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
643. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
644. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
645. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
646. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
647. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
648. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
649. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
650. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
651. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
652. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
653. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
654. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
655. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
656. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
657. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
658. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
659. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
660. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
661. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
662. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
663. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
664. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
665. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
666. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
667. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
668. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
669. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
670. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
671. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
672. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
673. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
674. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
675. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
676. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
677. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
678. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
679. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
680. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
681. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
682. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
683. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
684. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
685. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
686. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
687. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
688. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
689. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
690. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
691. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
692. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
693. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
694. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
695. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
696. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
697. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
698. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
699. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
700. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
701. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
702. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
703. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
704. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
705. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
706. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
707. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
708. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
709. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
710. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
711. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
712. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
713. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
714. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
715. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
716. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
717. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
718. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
719. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
720. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
721. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
722. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
723. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
724. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
725. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
726. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
727. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
728. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
729. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
730. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
731. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
732. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
733. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
734. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
735. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
736. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
737. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
738. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
739. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
740. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
741. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
742. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
743. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
744. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
745. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
746. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
747. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
748. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
749. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
750. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
751. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
752. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
753. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
754. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
755. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
756. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
757. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
758. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
759. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
760. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
761. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
762. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
763. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
764. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
765. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
766. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
767. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
768. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
769. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
770. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
771. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
772. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
773. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
774. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
775. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
776. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
777. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
778. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
779. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
780. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
781. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
782. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
783. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
784. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
785. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
786. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
787. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
788. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
789. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
790. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
791. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
792. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
793. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
794. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
795. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
796. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
797. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
798. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
799. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
800. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
801. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
802. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
803. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
804. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
805. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
806. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
807. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
808. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
809. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
810. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
811. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
812. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
813. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
814. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
815. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
816. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
817. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
818. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
819. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
820. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
821. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
822. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
823. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
824. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
825. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
826. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
827. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
828. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
829. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
830. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
831. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
832. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
833. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
834. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
835. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
836. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
837. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
838. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
839. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
840. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
841. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
842. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
843. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
844. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
845. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
846. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
847. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
848. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
849. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
850. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
851. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
852. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
853. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
854. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
855. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
856. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
857. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
858. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
859. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
860. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
861. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
862. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
863. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
864. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
865. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
866. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
867. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
868. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
869. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
870. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
871. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
872. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
873. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
874. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
875. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
876. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
877. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
878. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
879. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
880. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
881. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
882. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
883. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
884. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
885. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
886. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
887. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
888. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
889. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
890. gbgen.idx - Index of the entries according to gene symbols.
891. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
892. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
893. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
894. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
895. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
896. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
897. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
898. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
899. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
900. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
901. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
902. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
903. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
904. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
905. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
906. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
907. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
908. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
909. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
910. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
911. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
912. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
913. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
914. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
915. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
916. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
917. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
918. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
919. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
920. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
921. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
922. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
923. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
924. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
925. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
926. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
927. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
928. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
929. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
930. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
931. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
932. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
933. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
934. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
935. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
936. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
937. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
938. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
939. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
940. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
941. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
942. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
943. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
944. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
945. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
946. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
947. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
948. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
949. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
950. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
951. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
952. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
953. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
954. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
955. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
956. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
957. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
958. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
959. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
960. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
961. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
962. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
963. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
964. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
965. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
966. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
967. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
968. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
969. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
970. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
971. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
972. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
973. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
974. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
975. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
976. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
977. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
978. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
979. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
980. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
981. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
982. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
983. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
984. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
985. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
986. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
987. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
988. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
989. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
990. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
991. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
992. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
993. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
994. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
995. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
996. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
997. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
998. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
999. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1000. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1001. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1002. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1003. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1004. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1005. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1006. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1007. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1008. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1009. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1010. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1011. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1012. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1013. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1014. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1015. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1016. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1017. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1018. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1019. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1020. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1021. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1022. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1023. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1024. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1025. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1026. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1027. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1028. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1029. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1030. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1031. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1032. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1033. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1034. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1035. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1036. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1037. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1038. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1039. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1040. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1041. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1042. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1043. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1044. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1045. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1046. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1047. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1048. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1049. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1050. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1051. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1052. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1053. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1054. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1055. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1056. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1057. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1058. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1059. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1060. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1061. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1062. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1063. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1064. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1065. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1066. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1067. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1068. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1069. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1070. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1071. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1072. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1073. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1074. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1075. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1076. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1077. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1078. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1079. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1080. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1081. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1082. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1083. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1084. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1085. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1086. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1087. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1088. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1089. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1090. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1091. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1092. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1093. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1094. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1095. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1096. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1097. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1098. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1099. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1100. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1101. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1102. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1103. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1104. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1105. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1106. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1107. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1108. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1109. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1110. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1111. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1112. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1113. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1114. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1115. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1116. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1117. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1118. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1119. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1120. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1121. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1122. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1123. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1124. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1125. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1126. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1127. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1128. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1129. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1130. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1131. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1132. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1133. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1134. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1135. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1136. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1137. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1138. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1139. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1140. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1141. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1142. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1143. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1144. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1145. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1146. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1147. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1148. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1149. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1150. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1151. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1152. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1153. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1154. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1155. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1156. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1157. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1158. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1159. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1160. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1161. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1162. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1163. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1164. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1165. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1166. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1167. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1168. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1169. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1170. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1171. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1172. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1173. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1174. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1175. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1176. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1177. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1178. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1179. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1180. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1181. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1182. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1183. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1184. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1185. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1186. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1187. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1188. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1189. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1190. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1191. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1192. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1193. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1194. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1195. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1196. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1197. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1198. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1199. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1200. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1201. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1202. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1203. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1204. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1205. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1206. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1207. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1208. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1209. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1210. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1211. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1212. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1213. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1214. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1215. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1216. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1217. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1218. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1219. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1220. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1221. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1222. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1223. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1224. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1225. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1226. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1227. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1228. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1229. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1230. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1231. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1232. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1233. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1234. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1235. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1236. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1237. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1238. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1239. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1240. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1241. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1242. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1243. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1244. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1245. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1246. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1247. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1248. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1249. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1250. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1251. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1252. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1253. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1254. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1255. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1256. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1257. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1258. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1259. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1260. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1261. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1262. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1263. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1264. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1265. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1266. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1267. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1268. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1269. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1270. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1271. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1272. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1273. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1274. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1275. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1276. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1277. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1278. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1279. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1280. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1281. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1282. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1283. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1284. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1285. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1286. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1287. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1288. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1289. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1290. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1291. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1292. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1293. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1294. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1295. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1296. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1297. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1298. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1299. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1300. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1301. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1302. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1303. gbinv1.seq - Invertebrate sequence entries, part 1.
1304. gbinv10.seq - Invertebrate sequence entries, part 10.
1305. gbinv11.seq - Invertebrate sequence entries, part 11.
1306. gbinv12.seq - Invertebrate sequence entries, part 12.
1307. gbinv2.seq - Invertebrate sequence entries, part 2.
1308. gbinv3.seq - Invertebrate sequence entries, part 3.
1309. gbinv4.seq - Invertebrate sequence entries, part 4.
1310. gbinv5.seq - Invertebrate sequence entries, part 5.
1311. gbinv6.seq - Invertebrate sequence entries, part 6.
1312. gbinv7.seq - Invertebrate sequence entries, part 7.
1313. gbinv8.seq - Invertebrate sequence entries, part 8.
1314. gbinv9.seq - Invertebrate sequence entries, part 9.
1315. gbjou1.idx - Index of the entries according to journal citation, part 1.
1316. gbjou2.idx - Index of the entries according to journal citation, part 2.
1317. gbjou3.idx - Index of the entries according to journal citation, part 3.
1318. gbjou4.idx - Index of the entries according to journal citation, part 4.
1319. gbjou5.idx - Index of the entries according to journal citation, part 5.
1320. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1321. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1322. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1323. gbmam1.seq - Other mammalian sequence entries, part 1.
1324. gbmam2.seq - Other mammalian sequence entries, part 2.
1325. gbmam3.seq - Other mammalian sequence entries, part 3.
1326. gbmam4.seq - Other mammalian sequence entries, part 4.
1327. gbnew.txt - Accession numbers of entries new since the previous release.
1328. gbpat1.seq - Patent sequence entries, part 1.
1329. gbpat10.seq - Patent sequence entries, part 10.
1330. gbpat11.seq - Patent sequence entries, part 11.
1331. gbpat12.seq - Patent sequence entries, part 12.
1332. gbpat13.seq - Patent sequence entries, part 13.
1333. gbpat14.seq - Patent sequence entries, part 14.
1334. gbpat15.seq - Patent sequence entries, part 15.
1335. gbpat16.seq - Patent sequence entries, part 16.
1336. gbpat17.seq - Patent sequence entries, part 17.
1337. gbpat18.seq - Patent sequence entries, part 18.
1338. gbpat19.seq - Patent sequence entries, part 19.
1339. gbpat2.seq - Patent sequence entries, part 2.
1340. gbpat20.seq - Patent sequence entries, part 20.
1341. gbpat21.seq - Patent sequence entries, part 21.
1342. gbpat22.seq - Patent sequence entries, part 22.
1343. gbpat23.seq - Patent sequence entries, part 23.
1344. gbpat24.seq - Patent sequence entries, part 24.
1345. gbpat25.seq - Patent sequence entries, part 25.
1346. gbpat26.seq - Patent sequence entries, part 26.
1347. gbpat27.seq - Patent sequence entries, part 27.
1348. gbpat28.seq - Patent sequence entries, part 28.
1349. gbpat29.seq - Patent sequence entries, part 29.
1350. gbpat3.seq - Patent sequence entries, part 3.
1351. gbpat30.seq - Patent sequence entries, part 30.
1352. gbpat31.seq - Patent sequence entries, part 31.
1353. gbpat32.seq - Patent sequence entries, part 32.
1354. gbpat33.seq - Patent sequence entries, part 33.
1355. gbpat34.seq - Patent sequence entries, part 34.
1356. gbpat35.seq - Patent sequence entries, part 35.
1357. gbpat36.seq - Patent sequence entries, part 36.
1358. gbpat37.seq - Patent sequence entries, part 37.
1359. gbpat38.seq - Patent sequence entries, part 38.
1360. gbpat4.seq - Patent sequence entries, part 4.
1361. gbpat5.seq - Patent sequence entries, part 5.
1362. gbpat6.seq - Patent sequence entries, part 6.
1363. gbpat7.seq - Patent sequence entries, part 7.
1364. gbpat8.seq - Patent sequence entries, part 8.
1365. gbpat9.seq - Patent sequence entries, part 9.
1366. gbphg.seq - Phage sequence entries.
1367. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1368. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1369. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1370. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1371. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1372. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1373. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1374. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1375. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1376. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1377. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1378. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1379. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1380. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1381. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1382. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1383. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1384. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1385. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1386. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1387. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1388. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1389. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1390. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1391. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1392. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1393. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1394. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1395. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1396. gbpri1.seq - Primate sequence entries, part 1.
1397. gbpri10.seq - Primate sequence entries, part 10.
1398. gbpri11.seq - Primate sequence entries, part 11.
1399. gbpri12.seq - Primate sequence entries, part 12.
1400. gbpri13.seq - Primate sequence entries, part 13.
1401. gbpri14.seq - Primate sequence entries, part 14.
1402. gbpri15.seq - Primate sequence entries, part 15.
1403. gbpri16.seq - Primate sequence entries, part 16.
1404. gbpri17.seq - Primate sequence entries, part 17.
1405. gbpri18.seq - Primate sequence entries, part 18.
1406. gbpri19.seq - Primate sequence entries, part 19.
1407. gbpri2.seq - Primate sequence entries, part 2.
1408. gbpri20.seq - Primate sequence entries, part 20.
1409. gbpri21.seq - Primate sequence entries, part 21.
1410. gbpri22.seq - Primate sequence entries, part 22.
1411. gbpri23.seq - Primate sequence entries, part 23.
1412. gbpri24.seq - Primate sequence entries, part 24.
1413. gbpri25.seq - Primate sequence entries, part 25.
1414. gbpri26.seq - Primate sequence entries, part 26.
1415. gbpri27.seq - Primate sequence entries, part 27.
1416. gbpri28.seq - Primate sequence entries, part 28.
1417. gbpri29.seq - Primate sequence entries, part 29.
1418. gbpri3.seq - Primate sequence entries, part 3.
1419. gbpri30.seq - Primate sequence entries, part 30.
1420. gbpri31.seq - Primate sequence entries, part 31.
1421. gbpri32.seq - Primate sequence entries, part 32.
1422. gbpri33.seq - Primate sequence entries, part 33.
1423. gbpri34.seq - Primate sequence entries, part 34.
1424. gbpri35.seq - Primate sequence entries, part 35.
1425. gbpri4.seq - Primate sequence entries, part 4.
1426. gbpri5.seq - Primate sequence entries, part 5.
1427. gbpri6.seq - Primate sequence entries, part 6.
1428. gbpri7.seq - Primate sequence entries, part 7.
1429. gbpri8.seq - Primate sequence entries, part 8.
1430. gbpri9.seq - Primate sequence entries, part 9.
1431. gbrel.txt - Release notes (this document).
1432. gbrod1.seq - Rodent sequence entries, part 1.
1433. gbrod10.seq - Rodent sequence entries, part 10.
1434. gbrod11.seq - Rodent sequence entries, part 11.
1435. gbrod12.seq - Rodent sequence entries, part 12.
1436. gbrod13.seq - Rodent sequence entries, part 13.
1437. gbrod14.seq - Rodent sequence entries, part 14.
1438. gbrod15.seq - Rodent sequence entries, part 15.
1439. gbrod16.seq - Rodent sequence entries, part 16.
1440. gbrod17.seq - Rodent sequence entries, part 17.
1441. gbrod18.seq - Rodent sequence entries, part 18.
1442. gbrod19.seq - Rodent sequence entries, part 19.
1443. gbrod2.seq - Rodent sequence entries, part 2.
1444. gbrod20.seq - Rodent sequence entries, part 20.
1445. gbrod21.seq - Rodent sequence entries, part 21.
1446. gbrod22.seq - Rodent sequence entries, part 22.
1447. gbrod23.seq - Rodent sequence entries, part 23.
1448. gbrod24.seq - Rodent sequence entries, part 24.
1449. gbrod25.seq - Rodent sequence entries, part 25.
1450. gbrod26.seq - Rodent sequence entries, part 26.
1451. gbrod3.seq - Rodent sequence entries, part 3.
1452. gbrod4.seq - Rodent sequence entries, part 4.
1453. gbrod5.seq - Rodent sequence entries, part 5.
1454. gbrod6.seq - Rodent sequence entries, part 6.
1455. gbrod7.seq - Rodent sequence entries, part 7.
1456. gbrod8.seq - Rodent sequence entries, part 8.
1457. gbrod9.seq - Rodent sequence entries, part 9.
1458. gbsdr1.txt - Short directory of the data bank, part 1.
1459. gbsdr2.txt - Short directory of the data bank, part 2.
1460. gbsdr3.txt - Short directory of the data bank, part 3.
1461. gbsec.idx - Index of the entries according to secondary accession number.
1462. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1463. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1464. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1465. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1466. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1467. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1468. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1469. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1470. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1471. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1472. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1473. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1474. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1475. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1476. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1477. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1478. gbuna.seq - Unannotated sequence entries.
1479. gbvrl1.seq - Viral sequence entries, part 1.
1480. gbvrl2.seq - Viral sequence entries, part 2.
1481. gbvrl3.seq - Viral sequence entries, part 3.
1482. gbvrl4.seq - Viral sequence entries, part 4.
1483. gbvrl5.seq - Viral sequence entries, part 5.
1484. gbvrl6.seq - Viral sequence entries, part 6.
1485. gbvrl7.seq - Viral sequence entries, part 7.
1486. gbvrl8.seq - Viral sequence entries, part 8.
1487. gbvrl9.seq - Viral sequence entries, part 9.
1488. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1489. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1490. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1491. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1492. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1493. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1494. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1495. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1496. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1497. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1498. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1499. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1500. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1501. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1502. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 165.0 flatfiles require roughly 332 GB (sequence
files only) or 353 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
689080589 gbacc1.idx
1686737787 gbacc2.idx
579910392 gbacc3.idx
185775328 gbaut1.idx
224171077 gbaut10.idx
235318246 gbaut11.idx
222142615 gbaut12.idx
229262053 gbaut13.idx
198289301 gbaut14.idx
198365031 gbaut15.idx
189515133 gbaut16.idx
206980172 gbaut17.idx
253729394 gbaut18.idx
202290578 gbaut19.idx
194507317 gbaut2.idx
233763391 gbaut20.idx
189338619 gbaut21.idx
183768780 gbaut22.idx
183899957 gbaut23.idx
249038148 gbaut24.idx
183561079 gbaut25.idx
195135247 gbaut26.idx
225867287 gbaut27.idx
185737485 gbaut28.idx
221483138 gbaut29.idx
225363115 gbaut3.idx
183972257 gbaut30.idx
226397853 gbaut31.idx
195570591 gbaut32.idx
183735373 gbaut33.idx
201899811 gbaut34.idx
215471459 gbaut35.idx
185220789 gbaut36.idx
188605817 gbaut37.idx
186039972 gbaut38.idx
200085822 gbaut39.idx
183905416 gbaut4.idx
183876093 gbaut40.idx
213868833 gbaut41.idx
205433871 gbaut42.idx
189460791 gbaut43.idx
183861659 gbaut44.idx
183517400 gbaut45.idx
185366927 gbaut46.idx
185395219 gbaut47.idx
252679718 gbaut48.idx
185648806 gbaut49.idx
183751431 gbaut5.idx
11194297 gbaut50.idx
184381728 gbaut6.idx
183878602 gbaut7.idx
186633704 gbaut8.idx
184982810 gbaut9.idx
252474767 gbbct1.seq
250511730 gbbct10.seq
261578817 gbbct11.seq
251434636 gbbct12.seq
255446196 gbbct13.seq
252247380 gbbct14.seq
250219782 gbbct15.seq
253840657 gbbct16.seq
260598244 gbbct17.seq
253031166 gbbct18.seq
255992925 gbbct19.seq
261406006 gbbct2.seq
251072640 gbbct20.seq
250640824 gbbct21.seq
254124474 gbbct22.seq
253944248 gbbct23.seq
253996787 gbbct24.seq
265244804 gbbct25.seq
250002086 gbbct26.seq
250007547 gbbct27.seq
184212522 gbbct28.seq
251980472 gbbct3.seq
250004695 gbbct4.seq
256495008 gbbct5.seq
258066265 gbbct6.seq
250001638 gbbct7.seq
254882019 gbbct8.seq
250007923 gbbct9.seq
24770135 gbchg.txt
250145883 gbcon1.seq
250001468 gbcon10.seq
250256792 gbcon11.seq
250002221 gbcon12.seq
250000780 gbcon13.seq
250003679 gbcon14.seq
250492744 gbcon15.seq
250001137 gbcon16.seq
250001531 gbcon17.seq
250000063 gbcon18.seq
250000745 gbcon19.seq
251081424 gbcon2.seq
250004551 gbcon20.seq
250002578 gbcon21.seq
250001632 gbcon22.seq
250001338 gbcon23.seq
250006330 gbcon24.seq
250003622 gbcon25.seq
250003127 gbcon26.seq
250001949 gbcon27.seq
250004980 gbcon28.seq
250003171 gbcon29.seq
250062861 gbcon3.seq
250001880 gbcon30.seq
250003739 gbcon31.seq
250000856 gbcon32.seq
250002896 gbcon33.seq
250003193 gbcon34.seq
250003892 gbcon35.seq
250003548 gbcon36.seq
250000780 gbcon37.seq
250006257 gbcon38.seq
250004748 gbcon39.seq
250000910 gbcon4.seq
250005542 gbcon40.seq
250002051 gbcon41.seq
250000083 gbcon42.seq
250003827 gbcon43.seq
250000947 gbcon44.seq
250002355 gbcon45.seq
250000147 gbcon46.seq
250002730 gbcon47.seq
250003104 gbcon48.seq
250003464 gbcon49.seq
250001001 gbcon5.seq
250000595 gbcon50.seq
250002365 gbcon51.seq
250000356 gbcon52.seq
250000306 gbcon53.seq
250001416 gbcon54.seq
250001000 gbcon55.seq
250002848 gbcon56.seq
250002191 gbcon57.seq
250005465 gbcon58.seq
250002013 gbcon59.seq
250001261 gbcon6.seq
250004415 gbcon60.seq
250003439 gbcon61.seq
250004922 gbcon62.seq
250005509 gbcon63.seq
250003536 gbcon64.seq
250001887 gbcon65.seq
250002300 gbcon66.seq
250004705 gbcon67.seq
250002036 gbcon68.seq
250002496 gbcon69.seq
250001246 gbcon7.seq
250002559 gbcon70.seq
250002236 gbcon71.seq
250001131 gbcon72.seq
250004383 gbcon73.seq
250003376 gbcon74.seq
250006503 gbcon75.seq
250001698 gbcon76.seq
250001992 gbcon77.seq
250002493 gbcon78.seq
250030569 gbcon79.seq
250000975 gbcon8.seq
250000876 gbcon80.seq
250001174 gbcon81.seq
250004657 gbcon82.seq
250002600 gbcon83.seq
216271538 gbcon84.seq
21369652 gbcon85.seq
250137645 gbcon9.seq
3010709 gbdel.txt
250000235 gbenv1.seq
250000962 gbenv2.seq
250012838 gbenv3.seq
250000286 gbenv4.seq
250000581 gbenv5.seq
250001785 gbenv6.seq
250002233 gbenv7.seq
153346279 gbenv8.seq
230688948 gbest1.seq
230688183 gbest10.seq
230689655 gbest100.seq
230688393 gbest101.seq
230689292 gbest102.seq
230689815 gbest103.seq
230689647 gbest104.seq
230689498 gbest105.seq
230688286 gbest106.seq
230690384 gbest107.seq
230690442 gbest108.seq
230688360 gbest109.seq
230687783 gbest11.seq
230687866 gbest110.seq
230687790 gbest111.seq
230690109 gbest112.seq
230689929 gbest113.seq
230690221 gbest114.seq
230689325 gbest115.seq
230690320 gbest116.seq
230688576 gbest117.seq
230618515 gbest118.seq
230689105 gbest119.seq
230688167 gbest12.seq
230689637 gbest120.seq
230689782 gbest121.seq
230689893 gbest122.seq
230690106 gbest123.seq
230687594 gbest124.seq
230687680 gbest125.seq
230687612 gbest126.seq
230688766 gbest127.seq
230689147 gbest128.seq
230690832 gbest129.seq
230689505 gbest13.seq
230688951 gbest130.seq
230689642 gbest131.seq
230688076 gbest132.seq
230690081 gbest133.seq
230687957 gbest134.seq
230688703 gbest135.seq
230687980 gbest136.seq
230688215 gbest137.seq
230688580 gbest138.seq
230688152 gbest139.seq
230690559 gbest14.seq
230688124 gbest140.seq
230690334 gbest141.seq
230690740 gbest142.seq
230688508 gbest143.seq
230689089 gbest144.seq
230689899 gbest145.seq
230688786 gbest146.seq
230688780 gbest147.seq
230687493 gbest148.seq
230691156 gbest149.seq
230688567 gbest15.seq
230689383 gbest150.seq
230689209 gbest151.seq
230687729 gbest152.seq
230689585 gbest153.seq
230688492 gbest154.seq
230688424 gbest155.seq
230689279 gbest156.seq
230689002 gbest157.seq
230688982 gbest158.seq
230688324 gbest159.seq
230690167 gbest16.seq
230688904 gbest160.seq
230688889 gbest161.seq
230689563 gbest162.seq
230689123 gbest163.seq
230688153 gbest164.seq
230690770 gbest165.seq
230687739 gbest166.seq
230690201 gbest167.seq
230688910 gbest168.seq
230687780 gbest169.seq
230689239 gbest17.seq
230687922 gbest170.seq
230687788 gbest171.seq
230690443 gbest172.seq
230687872 gbest173.seq
230688695 gbest174.seq
230689160 gbest175.seq
230689122 gbest176.seq
230688948 gbest177.seq
230689390 gbest178.seq
223676264 gbest179.seq
230688809 gbest18.seq
230689110 gbest180.seq
230687669 gbest181.seq
230689098 gbest182.seq
230691618 gbest183.seq
230688161 gbest184.seq
230687995 gbest185.seq
230687989 gbest186.seq
230689719 gbest187.seq
230688923 gbest188.seq
230687627 gbest189.seq
230689044 gbest19.seq
230689036 gbest190.seq
230689794 gbest191.seq
230690177 gbest192.seq
230688100 gbest193.seq
230690994 gbest194.seq
230689351 gbest195.seq
230687721 gbest196.seq
230689632 gbest197.seq
230690548 gbest198.seq
230688688 gbest199.seq
230689740 gbest2.seq
230688638 gbest20.seq
230689578 gbest200.seq
230689581 gbest201.seq
230688089 gbest202.seq
230689131 gbest203.seq
230688045 gbest204.seq
230689533 gbest205.seq
230690006 gbest206.seq
230689485 gbest207.seq
230688443 gbest208.seq
230689191 gbest209.seq
230688645 gbest21.seq
230688216 gbest210.seq
230690015 gbest211.seq
230688490 gbest212.seq
230688159 gbest213.seq
230687643 gbest214.seq
230689094 gbest215.seq
230687905 gbest216.seq
230689251 gbest217.seq
230688426 gbest218.seq
230687652 gbest219.seq
230689579 gbest22.seq
230690182 gbest220.seq
230688456 gbest221.seq
230688569 gbest222.seq
230690665 gbest223.seq
230689545 gbest224.seq
230687618 gbest225.seq
230688689 gbest226.seq
230689956 gbest227.seq
230689416 gbest228.seq
187704066 gbest229.seq
230689752 gbest23.seq
161564936 gbest230.seq
162369471 gbest231.seq
170106160 gbest232.seq
168827244 gbest233.seq
162714446 gbest234.seq
164048562 gbest235.seq
163609209 gbest236.seq
162919487 gbest237.seq
163510406 gbest238.seq
162976431 gbest239.seq
230687798 gbest24.seq
163142589 gbest240.seq
161828050 gbest241.seq
167275490 gbest242.seq
161328306 gbest243.seq
162042109 gbest244.seq
166421813 gbest245.seq
166560392 gbest246.seq
164758943 gbest247.seq
164608369 gbest248.seq
164242604 gbest249.seq
230688525 gbest25.seq
164046274 gbest250.seq
163129658 gbest251.seq
163111799 gbest252.seq
164192851 gbest253.seq
165024845 gbest254.seq
179865628 gbest255.seq
170379978 gbest256.seq
195059469 gbest257.seq
230690161 gbest258.seq
230689087 gbest259.seq
230689469 gbest26.seq
230689755 gbest260.seq
230688410 gbest261.seq
230688211 gbest262.seq
230690136 gbest263.seq
230688739 gbest264.seq
230688464 gbest265.seq
230689018 gbest266.seq
230688644 gbest267.seq
230691960 gbest268.seq
230688260 gbest269.seq
230690029 gbest27.seq
230690323 gbest270.seq
230688299 gbest271.seq
230689851 gbest272.seq
230689489 gbest273.seq
230687649 gbest274.seq
230689111 gbest275.seq
230691272 gbest276.seq
230687805 gbest277.seq
230689529 gbest278.seq
230688985 gbest279.seq
230688861 gbest28.seq
230687637 gbest280.seq
230688237 gbest281.seq
230687963 gbest282.seq
230689156 gbest283.seq
230687915 gbest284.seq
230688640 gbest285.seq
230687559 gbest286.seq
230688656 gbest287.seq
216512758 gbest288.seq
210841519 gbest289.seq
230689494 gbest29.seq
230688945 gbest290.seq
230690183 gbest291.seq
230688945 gbest292.seq
230689713 gbest293.seq
230687906 gbest294.seq
230687901 gbest295.seq
230688522 gbest296.seq
230690880 gbest297.seq
230689472 gbest298.seq
230688570 gbest299.seq
230690712 gbest3.seq
230688169 gbest30.seq
230690484 gbest300.seq
230688561 gbest301.seq
230689058 gbest302.seq
230687882 gbest303.seq
230687791 gbest304.seq
230688561 gbest305.seq
230688304 gbest306.seq
230689055 gbest307.seq
230689434 gbest308.seq
230688015 gbest309.seq
230688813 gbest31.seq
230688133 gbest310.seq
230687594 gbest311.seq
230690842 gbest312.seq
228542403 gbest313.seq
230688710 gbest314.seq
230691342 gbest315.seq
230689551 gbest316.seq
230689966 gbest317.seq
230688852 gbest318.seq
230691210 gbest319.seq
230690049 gbest32.seq
230688248 gbest320.seq
230691042 gbest321.seq
230689748 gbest322.seq
230690208 gbest323.seq
230690712 gbest324.seq
230690641 gbest325.seq
230688557 gbest326.seq
230688703 gbest327.seq
230688926 gbest328.seq
230689680 gbest329.seq
230688787 gbest33.seq
230688580 gbest330.seq
230689422 gbest331.seq
230689699 gbest332.seq
230690322 gbest333.seq
230687863 gbest334.seq
230687451 gbest335.seq
230688206 gbest336.seq
230689145 gbest337.seq
230688035 gbest338.seq
230690402 gbest339.seq
230688316 gbest34.seq
197139635 gbest340.seq
230690993 gbest341.seq
230689148 gbest342.seq
230690129 gbest343.seq
230690197 gbest344.seq
230689690 gbest345.seq
230682712 gbest346.seq
143422357 gbest347.seq
202444009 gbest348.seq
230688382 gbest349.seq
230689410 gbest35.seq
230688566 gbest350.seq
230690185 gbest351.seq
230688914 gbest352.seq
230689167 gbest353.seq
230691075 gbest354.seq
230690043 gbest355.seq
230689616 gbest356.seq
230687789 gbest357.seq
230688628 gbest358.seq
230689471 gbest359.seq
230688160 gbest36.seq
230690348 gbest360.seq
230687781 gbest361.seq
230690324 gbest362.seq
230690866 gbest363.seq
230689223 gbest364.seq
230687953 gbest365.seq
230689387 gbest366.seq
230689739 gbest367.seq
230690159 gbest368.seq
223405872 gbest369.seq
230688453 gbest37.seq
230689326 gbest370.seq
230689352 gbest371.seq
230689731 gbest372.seq
230690207 gbest373.seq
230690819 gbest374.seq
230690930 gbest375.seq
230689258 gbest376.seq
230687607 gbest377.seq
230689650 gbest378.seq
230688306 gbest379.seq
230687661 gbest38.seq
230691761 gbest380.seq
230691371 gbest381.seq
230688713 gbest382.seq
230688326 gbest383.seq
230689629 gbest384.seq
230689221 gbest385.seq
230689692 gbest386.seq
230688363 gbest387.seq
230689028 gbest388.seq
230688517 gbest389.seq
230688796 gbest39.seq
230687508 gbest390.seq
230688638 gbest391.seq
230688196 gbest392.seq
230689752 gbest393.seq
230687836 gbest394.seq
230690599 gbest395.seq
230688027 gbest396.seq
222438213 gbest397.seq
230689868 gbest398.seq
230688270 gbest399.seq
230689453 gbest4.seq
230687611 gbest40.seq
230687488 gbest400.seq
230690411 gbest401.seq
230688409 gbest402.seq
230690439 gbest403.seq
230690094 gbest404.seq
230688324 gbest405.seq
230688878 gbest406.seq
230688135 gbest407.seq
230690267 gbest408.seq
230689586 gbest409.seq
230688165 gbest41.seq
230687822 gbest410.seq
230688448 gbest411.seq
230688037 gbest412.seq
230688491 gbest413.seq
230690777 gbest414.seq
230689526 gbest415.seq
230688257 gbest416.seq
230689040 gbest417.seq
230687845 gbest418.seq
230689906 gbest419.seq
230687469 gbest42.seq
230689293 gbest420.seq
230689090 gbest421.seq
214208835 gbest422.seq
208303970 gbest423.seq
208235414 gbest424.seq
208399754 gbest425.seq
208341188 gbest426.seq
208502541 gbest427.seq
208987378 gbest428.seq
209972660 gbest429.seq
230687839 gbest43.seq
209556649 gbest430.seq
209266090 gbest431.seq
212337158 gbest432.seq
209579491 gbest433.seq
208753778 gbest434.seq
208759377 gbest435.seq
208907268 gbest436.seq
208229976 gbest437.seq
208249994 gbest438.seq
208291675 gbest439.seq
230687597 gbest44.seq
208089539 gbest440.seq
212933047 gbest441.seq
230688631 gbest442.seq
230688928 gbest443.seq
230689336 gbest444.seq
230689083 gbest445.seq
230689557 gbest446.seq
230688784 gbest447.seq
230689597 gbest448.seq
230687764 gbest449.seq
230689552 gbest45.seq
230688348 gbest450.seq
230689158 gbest451.seq
230688053 gbest452.seq
230688670 gbest453.seq
230691861 gbest454.seq
230691441 gbest455.seq
230689266 gbest456.seq
230688075 gbest457.seq
230687794 gbest458.seq
230689097 gbest459.seq
189040251 gbest46.seq
230689304 gbest460.seq
230687879 gbest461.seq
230689195 gbest462.seq
230689036 gbest463.seq
230692144 gbest464.seq
230689687 gbest465.seq
230689478 gbest466.seq
230689380 gbest467.seq
230689724 gbest468.seq
230688272 gbest469.seq
188239001 gbest47.seq
230688766 gbest470.seq
225923564 gbest471.seq
230688616 gbest472.seq
230689019 gbest473.seq
230687798 gbest474.seq
230687847 gbest475.seq
230689664 gbest476.seq
230688277 gbest477.seq
230689793 gbest478.seq
230688396 gbest479.seq
204631070 gbest48.seq
230687463 gbest480.seq
230690966 gbest481.seq
230690712 gbest482.seq
230688258 gbest483.seq
230689408 gbest484.seq
230689401 gbest485.seq
230688983 gbest486.seq
230687820 gbest487.seq
230690779 gbest488.seq
230690264 gbest489.seq
215037141 gbest49.seq
230690441 gbest490.seq
230690043 gbest491.seq
230690543 gbest492.seq
230688175 gbest493.seq
230690176 gbest494.seq
230688627 gbest495.seq
230691267 gbest496.seq
230690555 gbest497.seq
230688464 gbest498.seq
230687663 gbest499.seq
164140234 gbest5.seq
214769181 gbest50.seq
230689303 gbest500.seq
230689099 gbest501.seq
230690766 gbest502.seq
230690722 gbest503.seq
230687471 gbest504.seq
230687799 gbest505.seq
230689202 gbest506.seq
230687496 gbest507.seq
230687531 gbest508.seq
230688163 gbest509.seq
215577695 gbest51.seq
230687845 gbest510.seq
230688497 gbest511.seq
229381769 gbest512.seq
230689989 gbest513.seq
230688768 gbest514.seq
230687520 gbest515.seq
230689785 gbest516.seq
230691053 gbest517.seq
230687536 gbest518.seq
230688204 gbest519.seq
228629179 gbest52.seq
230687896 gbest520.seq
230689789 gbest521.seq
230690996 gbest522.seq
230687787 gbest523.seq
230688979 gbest524.seq
230687980 gbest525.seq
230689527 gbest526.seq
196038254 gbest527.seq
204006121 gbest528.seq
230690721 gbest529.seq
230688778 gbest53.seq
230688184 gbest530.seq
230689181 gbest531.seq
230687501 gbest532.seq
230689458 gbest533.seq
230687897 gbest534.seq
230689032 gbest535.seq
230689531 gbest536.seq
230688938 gbest537.seq
230687505 gbest538.seq
230690319 gbest539.seq
230688032 gbest54.seq
230689405 gbest540.seq
230687721 gbest541.seq
222251539 gbest542.seq
230691070 gbest543.seq
230688341 gbest544.seq
230690524 gbest545.seq
230687694 gbest546.seq
230688313 gbest547.seq
230689036 gbest548.seq
229216939 gbest549.seq
230688144 gbest55.seq
216339854 gbest550.seq
230688141 gbest551.seq
230688900 gbest552.seq
230688385 gbest553.seq
230688124 gbest554.seq
230689907 gbest555.seq
230690408 gbest556.seq
230687499 gbest557.seq
230687611 gbest558.seq
230690356 gbest559.seq
224031424 gbest56.seq
230689027 gbest560.seq
230689146 gbest561.seq
230689499 gbest562.seq
230689301 gbest563.seq
230689582 gbest564.seq
221494995 gbest565.seq
230687689 gbest566.seq
230688777 gbest567.seq
230688465 gbest568.seq
230690022 gbest569.seq
230688757 gbest57.seq
230688088 gbest570.seq
230687542 gbest571.seq
230690478 gbest572.seq
230688279 gbest573.seq
230688935 gbest574.seq
230688554 gbest575.seq
230688108 gbest576.seq
230689024 gbest577.seq
230690222 gbest578.seq
230690414 gbest579.seq
230688560 gbest58.seq
230689903 gbest580.seq
230688877 gbest581.seq
230687499 gbest582.seq
230688839 gbest583.seq
230691128 gbest584.seq
230690492 gbest585.seq
220281453 gbest586.seq
230689082 gbest587.seq
230687560 gbest588.seq
230691205 gbest589.seq
230688139 gbest59.seq
230691888 gbest590.seq
230689211 gbest591.seq
230691887 gbest592.seq
230688733 gbest593.seq
230690288 gbest594.seq
230689650 gbest595.seq
230688025 gbest596.seq
230687836 gbest597.seq
230688881 gbest598.seq
230688727 gbest599.seq
177421852 gbest6.seq
230689437 gbest60.seq
230689208 gbest600.seq
230687575 gbest601.seq
230689014 gbest602.seq
230689752 gbest603.seq
230689880 gbest604.seq
230689003 gbest605.seq
230689826 gbest606.seq
230690928 gbest607.seq
230688462 gbest608.seq
230687700 gbest609.seq
230688736 gbest61.seq
230690212 gbest610.seq
230688155 gbest611.seq
230689198 gbest612.seq
230688112 gbest613.seq
230688807 gbest614.seq
230690536 gbest615.seq
230689944 gbest616.seq
230688894 gbest617.seq
230688995 gbest618.seq
230687497 gbest619.seq
230688074 gbest62.seq
230688010 gbest620.seq
230689755 gbest621.seq
230690857 gbest622.seq
230688900 gbest623.seq
210144643 gbest624.seq
230689191 gbest625.seq
230688628 gbest626.seq
230688599 gbest627.seq
217407001 gbest628.seq
230688504 gbest629.seq
230688548 gbest63.seq
230689237 gbest630.seq
190401676 gbest631.seq
191275708 gbest632.seq
191249289 gbest633.seq
193438693 gbest634.seq
191107508 gbest635.seq
192562172 gbest636.seq
191316153 gbest637.seq
193535182 gbest638.seq
210405917 gbest639.seq
230690438 gbest64.seq
230689854 gbest640.seq
230687851 gbest641.seq
230688041 gbest642.seq
230689715 gbest643.seq
230691025 gbest644.seq
230689795 gbest645.seq
230687905 gbest646.seq
230688288 gbest647.seq
230689424 gbest648.seq
230690268 gbest649.seq
230690341 gbest65.seq
230689023 gbest650.seq
230688373 gbest651.seq
230689336 gbest652.seq
230689400 gbest653.seq
230690014 gbest654.seq
230689543 gbest655.seq
230690432 gbest656.seq
230689890 gbest657.seq
230691011 gbest658.seq
230689082 gbest659.seq
230689639 gbest66.seq
230689413 gbest660.seq
230689473 gbest661.seq
230688925 gbest662.seq
230689637 gbest663.seq
230688311 gbest664.seq
230687963 gbest665.seq
230691441 gbest666.seq
230689590 gbest667.seq
230690107 gbest668.seq
230688770 gbest669.seq
230688544 gbest67.seq
230689479 gbest670.seq
230690364 gbest671.seq
230689121 gbest672.seq
230687918 gbest673.seq
230688930 gbest674.seq
230688650 gbest675.seq
230689112 gbest676.seq
230688687 gbest677.seq
230689660 gbest678.seq
230688851 gbest679.seq
230690128 gbest68.seq
230689843 gbest680.seq
230690405 gbest681.seq
230689948 gbest682.seq
230688629 gbest683.seq
230690280 gbest684.seq
230688564 gbest685.seq
230689498 gbest686.seq
230688006 gbest687.seq
230688740 gbest688.seq
230690643 gbest689.seq
230688424 gbest69.seq
230691175 gbest690.seq
230689403 gbest691.seq
230689763 gbest692.seq
230690128 gbest693.seq
230689640 gbest694.seq
230689818 gbest695.seq
230688578 gbest696.seq
230690756 gbest697.seq
230688879 gbest698.seq
230687710 gbest699.seq
230687578 gbest7.seq
230045714 gbest70.seq
230687713 gbest700.seq
230687892 gbest701.seq
230689955 gbest702.seq
207009086 gbest703.seq
230688470 gbest704.seq
230688909 gbest705.seq
230689568 gbest706.seq
230689124 gbest707.seq
230689314 gbest708.seq
230690184 gbest709.seq
230689356 gbest71.seq
225616421 gbest710.seq
230690172 gbest711.seq
230687835 gbest712.seq
41341572 gbest713.seq
209483034 gbest72.seq
208188992 gbest73.seq
207482129 gbest74.seq
207832187 gbest75.seq
208440296 gbest76.seq
209217440 gbest77.seq
208528744 gbest78.seq
207014237 gbest79.seq
230688273 gbest8.seq
209031090 gbest80.seq
207092473 gbest81.seq
204134670 gbest82.seq
207233673 gbest83.seq
206947085 gbest84.seq
210636567 gbest85.seq
226623346 gbest86.seq
230692466 gbest87.seq
230691179 gbest88.seq
217295595 gbest89.seq
230688404 gbest9.seq
213207697 gbest90.seq
214572435 gbest91.seq
230688425 gbest92.seq
230688133 gbest93.seq
230688333 gbest94.seq
230688138 gbest95.seq
230689288 gbest96.seq
230689512 gbest97.seq
230687676 gbest98.seq
230688345 gbest99.seq
78992358 gbgen.idx
230688198 gbgss1.seq
230690079 gbgss10.seq
230687853 gbgss100.seq
227817300 gbgss101.seq
228816526 gbgss102.seq
228520039 gbgss103.seq
228616350 gbgss104.seq
227731153 gbgss105.seq
230689160 gbgss106.seq
230689314 gbgss107.seq
230687446 gbgss108.seq
230688753 gbgss109.seq
230689764 gbgss11.seq
230687509 gbgss110.seq
230689867 gbgss111.seq
230689458 gbgss112.seq
230688762 gbgss113.seq
230689863 gbgss114.seq
230688763 gbgss115.seq
230689089 gbgss116.seq
230687520 gbgss117.seq
230689395 gbgss118.seq
230687489 gbgss119.seq
230687679 gbgss12.seq
230688754 gbgss120.seq
230689677 gbgss121.seq
230689535 gbgss122.seq
230689340 gbgss123.seq
230689070 gbgss124.seq
230688249 gbgss125.seq
230687552 gbgss126.seq
230687775 gbgss127.seq
230690261 gbgss128.seq
230689917 gbgss129.seq
230690347 gbgss13.seq
230689455 gbgss130.seq
230688933 gbgss131.seq
230689865 gbgss132.seq
230688971 gbgss133.seq
230689062 gbgss134.seq
230687620 gbgss135.seq
230688472 gbgss136.seq
230689476 gbgss137.seq
230688429 gbgss138.seq
230689759 gbgss139.seq
230689893 gbgss14.seq
230688505 gbgss140.seq
230689668 gbgss141.seq
230688425 gbgss142.seq
230688546 gbgss143.seq
230688595 gbgss144.seq
224496374 gbgss145.seq
230688765 gbgss146.seq
230688099 gbgss147.seq
195690675 gbgss148.seq
230690367 gbgss149.seq
230689648 gbgss15.seq
230688111 gbgss150.seq
230688367 gbgss151.seq
230688031 gbgss152.seq
230688163 gbgss153.seq
230687494 gbgss154.seq
230689972 gbgss155.seq
230690461 gbgss156.seq
230689756 gbgss157.seq
230689760 gbgss158.seq
230687651 gbgss159.seq
230689778 gbgss16.seq
230687544 gbgss160.seq
230687594 gbgss161.seq
230689589 gbgss162.seq
230689435 gbgss163.seq
230689073 gbgss164.seq
230689098 gbgss165.seq
230690354 gbgss166.seq
230688287 gbgss167.seq
230688273 gbgss168.seq
230690403 gbgss169.seq
230688655 gbgss17.seq
229161450 gbgss170.seq
230691027 gbgss171.seq
230689768 gbgss172.seq
230690399 gbgss173.seq
213055868 gbgss174.seq
207613015 gbgss175.seq
210346365 gbgss176.seq
210644733 gbgss177.seq
209586179 gbgss178.seq
209278137 gbgss179.seq
230688580 gbgss18.seq
207485834 gbgss180.seq
207272373 gbgss181.seq
207678590 gbgss182.seq
209598937 gbgss183.seq
209301026 gbgss184.seq
208146069 gbgss185.seq
205715316 gbgss186.seq
205676382 gbgss187.seq
205238723 gbgss188.seq
205410489 gbgss189.seq
230688247 gbgss19.seq
205275689 gbgss190.seq
206460296 gbgss191.seq
207548497 gbgss192.seq
208590390 gbgss193.seq
207817542 gbgss194.seq
208049447 gbgss195.seq
208740117 gbgss196.seq
208869812 gbgss197.seq
208619790 gbgss198.seq
205803117 gbgss199.seq
230688628 gbgss2.seq
230689216 gbgss20.seq
206120666 gbgss200.seq
206373749 gbgss201.seq
205439311 gbgss202.seq
206357415 gbgss203.seq
207221524 gbgss204.seq
207178477 gbgss205.seq
207128980 gbgss206.seq
207220283 gbgss207.seq
207015277 gbgss208.seq
207156998 gbgss209.seq
230690186 gbgss21.seq
206838596 gbgss210.seq
206942093 gbgss211.seq
206808989 gbgss212.seq
207733615 gbgss213.seq
208025165 gbgss214.seq
209662459 gbgss215.seq
210071224 gbgss216.seq
209294059 gbgss217.seq
210486161 gbgss218.seq
218857870 gbgss219.seq
230690133 gbgss22.seq
218858750 gbgss220.seq
230688373 gbgss221.seq
230689546 gbgss222.seq
230690506 gbgss223.seq
230687971 gbgss224.seq
230689272 gbgss225.seq
225509800 gbgss226.seq
217904390 gbgss227.seq
217946648 gbgss228.seq
230689983 gbgss229.seq
230689062 gbgss23.seq
230689682 gbgss230.seq
96700952 gbgss231.seq
250001003 gbgss232.seq
250001752 gbgss233.seq
250002297 gbgss234.seq
250001237 gbgss235.seq
250001078 gbgss236.seq
250002835 gbgss237.seq
250003052 gbgss238.seq
250000382 gbgss239.seq
230688100 gbgss24.seq
250000245 gbgss240.seq
250002457 gbgss241.seq
250002639 gbgss242.seq
250002455 gbgss243.seq
250002454 gbgss244.seq
250002011 gbgss245.seq
250000875 gbgss246.seq
250003171 gbgss247.seq
250001782 gbgss248.seq
250002363 gbgss249.seq
230687876 gbgss25.seq
250003256 gbgss250.seq
250002114 gbgss251.seq
250002209 gbgss252.seq
250000547 gbgss253.seq
250001792 gbgss254.seq
250001797 gbgss255.seq
250000182 gbgss256.seq
250003319 gbgss257.seq
250002229 gbgss258.seq
250002497 gbgss259.seq
230691504 gbgss26.seq
250001570 gbgss260.seq
250001863 gbgss261.seq
250002073 gbgss262.seq
250000064 gbgss263.seq
250001451 gbgss264.seq
250001851 gbgss265.seq
250001679 gbgss266.seq
250001844 gbgss267.seq
250001136 gbgss268.seq
250000519 gbgss269.seq
230690309 gbgss27.seq
250000324 gbgss270.seq
250001292 gbgss271.seq
250001257 gbgss272.seq
250000931 gbgss273.seq
250002517 gbgss274.seq
250002402 gbgss275.seq
250001164 gbgss276.seq
250001005 gbgss277.seq
250000826 gbgss278.seq
250001156 gbgss279.seq
230689913 gbgss28.seq
250002445 gbgss280.seq
250000035 gbgss281.seq
250001740 gbgss282.seq
250001257 gbgss283.seq
250001678 gbgss284.seq
170342453 gbgss285.seq
230689340 gbgss29.seq
230689286 gbgss3.seq
230687533 gbgss30.seq
230688932 gbgss31.seq
230689492 gbgss32.seq
230689759 gbgss33.seq
230689716 gbgss34.seq
230689209 gbgss35.seq
230689522 gbgss36.seq
230689286 gbgss37.seq
230688422 gbgss38.seq
230690318 gbgss39.seq
230688064 gbgss4.seq
230689168 gbgss40.seq
230687812 gbgss41.seq
230688951 gbgss42.seq
230687690 gbgss43.seq
230688176 gbgss44.seq
230690500 gbgss45.seq
230689158 gbgss46.seq
230687794 gbgss47.seq
230688035 gbgss48.seq
230688492 gbgss49.seq
230688342 gbgss5.seq
230688356 gbgss50.seq
230688935 gbgss51.seq
230689611 gbgss52.seq
230687931 gbgss53.seq
230687706 gbgss54.seq
230687841 gbgss55.seq
230689450 gbgss56.seq
230687466 gbgss57.seq
230687473 gbgss58.seq
230687873 gbgss59.seq
230689182 gbgss6.seq
230690125 gbgss60.seq
229069036 gbgss61.seq
230689007 gbgss62.seq
230689164 gbgss63.seq
230689191 gbgss64.seq
230689147 gbgss65.seq
230688298 gbgss66.seq
230688223 gbgss67.seq
230688460 gbgss68.seq
230687701 gbgss69.seq
230687458 gbgss7.seq
230688793 gbgss70.seq
230688050 gbgss71.seq
230688752 gbgss72.seq
230689223 gbgss73.seq
230688675 gbgss74.seq
230688922 gbgss75.seq
230689343 gbgss76.seq
230689378 gbgss77.seq
230688283 gbgss78.seq
230689569 gbgss79.seq
230690430 gbgss8.seq
230688895 gbgss80.seq
224573069 gbgss81.seq
194175655 gbgss82.seq
194285702 gbgss83.seq
230687585 gbgss84.seq
230687559 gbgss85.seq
230687962 gbgss86.seq
230689306 gbgss87.seq
230688271 gbgss88.seq
230689613 gbgss89.seq
230689298 gbgss9.seq
230690367 gbgss90.seq
230688827 gbgss91.seq
230687919 gbgss92.seq
230689397 gbgss93.seq
230688155 gbgss94.seq
230689437 gbgss95.seq
230688614 gbgss96.seq
230689206 gbgss97.seq
230689994 gbgss98.seq
230690068 gbgss99.seq
250005012 gbhtc1.seq
250002611 gbhtc10.seq
250000734 gbhtc11.seq
250002889 gbhtc12.seq
25214642 gbhtc13.seq
250016613 gbhtc2.seq
250005703 gbhtc3.seq
250002241 gbhtc4.seq
250012414 gbhtc5.seq
250007004 gbhtc6.seq
250002603 gbhtc7.seq
250001657 gbhtc8.seq
250002292 gbhtc9.seq
250096212 gbhtg1.seq
250059677 gbhtg10.seq
250139138 gbhtg100.seq
250007761 gbhtg101.seq
250001063 gbhtg102.seq
251274926 gbhtg103.seq
250154970 gbhtg104.seq
250011036 gbhtg105.seq
250101229 gbhtg106.seq
250191982 gbhtg107.seq
250158867 gbhtg108.seq
250091282 gbhtg109.seq
250041995 gbhtg11.seq
250212378 gbhtg110.seq
250250373 gbhtg111.seq
250068210 gbhtg112.seq
250076947 gbhtg113.seq
245473434 gbhtg114.seq
250102351 gbhtg12.seq
250150638 gbhtg13.seq
250040473 gbhtg14.seq
250231765 gbhtg15.seq
250122318 gbhtg16.seq
250482896 gbhtg17.seq
250263687 gbhtg18.seq
250083488 gbhtg19.seq
250020783 gbhtg2.seq
250077534 gbhtg20.seq
250147587 gbhtg21.seq
250002047 gbhtg22.seq
250073792 gbhtg23.seq
250230281 gbhtg24.seq
250029704 gbhtg25.seq
250188207 gbhtg26.seq
250278085 gbhtg27.seq
250352952 gbhtg28.seq
250151795 gbhtg29.seq
250039036 gbhtg3.seq
250128854 gbhtg30.seq
250283077 gbhtg31.seq
250164934 gbhtg32.seq
250168865 gbhtg33.seq
250019170 gbhtg34.seq
250108002 gbhtg35.seq
250219570 gbhtg36.seq
250101082 gbhtg37.seq
250307425 gbhtg38.seq
250233667 gbhtg39.seq
250101893 gbhtg4.seq
250053349 gbhtg40.seq
250248737 gbhtg41.seq
250163674 gbhtg42.seq
250397985 gbhtg43.seq
250201343 gbhtg44.seq
250046870 gbhtg45.seq
250260605 gbhtg46.seq
250065468 gbhtg47.seq
250071334 gbhtg48.seq
250038230 gbhtg49.seq
250209184 gbhtg5.seq
250198773 gbhtg50.seq
250019720 gbhtg51.seq
250197634 gbhtg52.seq
250051529 gbhtg53.seq
250261345 gbhtg54.seq
250255773 gbhtg55.seq
250240504 gbhtg56.seq
250104388 gbhtg57.seq
250080038 gbhtg58.seq
250056960 gbhtg59.seq
250053313 gbhtg6.seq
250219079 gbhtg60.seq
250085967 gbhtg61.seq
250217732 gbhtg62.seq
250225013 gbhtg63.seq
250107862 gbhtg64.seq
250193414 gbhtg65.seq
250038812 gbhtg66.seq
250048370 gbhtg67.seq
250006130 gbhtg68.seq
250080664 gbhtg69.seq
250004174 gbhtg7.seq
250112715 gbhtg70.seq
250166838 gbhtg71.seq
250044801 gbhtg72.seq
250221496 gbhtg73.seq
250087273 gbhtg74.seq
250087981 gbhtg75.seq
250106271 gbhtg76.seq
250296541 gbhtg77.seq
250000235 gbhtg78.seq
250148519 gbhtg79.seq
250124022 gbhtg8.seq
250072828 gbhtg80.seq
250099738 gbhtg81.seq
250005775 gbhtg82.seq
250026892 gbhtg83.seq
250092220 gbhtg84.seq
250188220 gbhtg85.seq
250092549 gbhtg86.seq
250137960 gbhtg87.seq
250150910 gbhtg88.seq
250002339 gbhtg89.seq
250009869 gbhtg9.seq
250142526 gbhtg90.seq
250064078 gbhtg91.seq
250127571 gbhtg92.seq
250181654 gbhtg93.seq
250029628 gbhtg94.seq
250111241 gbhtg95.seq
250003996 gbhtg96.seq
250119501 gbhtg97.seq
250154027 gbhtg98.seq
250136968 gbhtg99.seq
250187707 gbinv1.seq
250001058 gbinv10.seq
250051460 gbinv11.seq
62587123 gbinv12.seq
250145538 gbinv2.seq
250001844 gbinv3.seq
250000263 gbinv4.seq
250001305 gbinv5.seq
250001191 gbinv6.seq
250000082 gbinv7.seq
250000005 gbinv8.seq
250001054 gbinv9.seq
149849901 gbjou1.idx
141709494 gbjou2.idx
221016189 gbjou3.idx
290845037 gbjou4.idx
77594531 gbjou5.idx
183320847 gbkey1.idx
199193282 gbkey2.idx
60552166 gbkey3.idx
250045226 gbmam1.seq
250001561 gbmam2.seq
250001476 gbmam3.seq
99729348 gbmam4.seq
45225242 gbnew.txt
250000443 gbpat1.seq
250001174 gbpat10.seq
250000356 gbpat11.seq
250001775 gbpat12.seq
250000857 gbpat13.seq
250000499 gbpat14.seq
250001400 gbpat15.seq
250001580 gbpat16.seq
250002041 gbpat17.seq
250000090 gbpat18.seq
250000336 gbpat19.seq
250000202 gbpat2.seq
250002304 gbpat20.seq
250000858 gbpat21.seq
250170065 gbpat22.seq
250080325 gbpat23.seq
250003340 gbpat24.seq
250005162 gbpat25.seq
250002360 gbpat26.seq
250001294 gbpat27.seq
250008157 gbpat28.seq
250002070 gbpat29.seq
250003351 gbpat3.seq
250001359 gbpat30.seq
250001152 gbpat31.seq
250000352 gbpat32.seq
250000026 gbpat33.seq
250001266 gbpat34.seq
250000519 gbpat35.seq
250000004 gbpat36.seq
250000833 gbpat37.seq
157321441 gbpat38.seq
250002404 gbpat4.seq
250000082 gbpat5.seq
250000243 gbpat6.seq
250001690 gbpat7.seq
250003072 gbpat8.seq
250000009 gbpat9.seq
68253780 gbphg.seq
250115988 gbpln1.seq
250011288 gbpln10.seq
250003781 gbpln11.seq
250008771 gbpln12.seq
250052729 gbpln13.seq
250071148 gbpln14.seq
250229779 gbpln15.seq
266055884 gbpln16.seq
256537862 gbpln17.seq
250098990 gbpln18.seq
250000839 gbpln19.seq
250053017 gbpln2.seq
250002787 gbpln20.seq
250002186 gbpln21.seq
252613999 gbpln22.seq
250375453 gbpln23.seq
250001459 gbpln24.seq
250001397 gbpln25.seq
250001525 gbpln26.seq
250001074 gbpln27.seq
250004254 gbpln28.seq
60576986 gbpln29.seq
250013336 gbpln3.seq
250142607 gbpln4.seq
250000727 gbpln5.seq
250001542 gbpln6.seq
250004410 gbpln7.seq
250000444 gbpln8.seq
250048324 gbpln9.seq
250088565 gbpri1.seq
250061166 gbpri10.seq
250167622 gbpri11.seq
250009713 gbpri12.seq
250157150 gbpri13.seq
250082276 gbpri14.seq
250002557 gbpri15.seq
250190604 gbpri16.seq
250218077 gbpri17.seq
250128760 gbpri18.seq
250001537 gbpri19.seq
250048021 gbpri2.seq
250001801 gbpri20.seq
250001552 gbpri21.seq
250107244 gbpri22.seq
250150365 gbpri23.seq
250145363 gbpri24.seq
250051085 gbpri25.seq
250003208 gbpri26.seq
250043558 gbpri27.seq
250198697 gbpri28.seq
250001012 gbpri29.seq
250155147 gbpri3.seq
250001637 gbpri30.seq
250036270 gbpri31.seq
250002370 gbpri32.seq
250002020 gbpri33.seq
250007545 gbpri34.seq
195272841 gbpri35.seq
250097192 gbpri4.seq
250045127 gbpri5.seq
250100796 gbpri6.seq
250019233 gbpri7.seq
250212975 gbpri8.seq
250183728 gbpri9.seq
289762 gbrel.txt
250077427 gbrod1.seq
250189141 gbrod10.seq
250213775 gbrod11.seq
250197324 gbrod12.seq
250007484 gbrod13.seq
250125429 gbrod14.seq
250216929 gbrod15.seq
250138550 gbrod16.seq
250015662 gbrod17.seq
250205238 gbrod18.seq
250072901 gbrod19.seq
250129259 gbrod2.seq
250118571 gbrod20.seq
250002632 gbrod21.seq
250007442 gbrod22.seq
250095738 gbrod23.seq
250000955 gbrod24.seq
250004059 gbrod25.seq
111543159 gbrod26.seq
250102955 gbrod3.seq
250115211 gbrod4.seq
250015847 gbrod5.seq
250102720 gbrod6.seq
250017977 gbrod7.seq
250000899 gbrod8.seq
250124376 gbrod9.seq
1287288845 gbsdr1.txt
4099145601 gbsdr2.txt
1798125405 gbsdr3.txt
99481835 gbsec.idx
250000883 gbsts1.seq
250003322 gbsts10.seq
250002978 gbsts11.seq
250000687 gbsts12.seq
250000632 gbsts13.seq
228668286 gbsts14.seq
250001873 gbsts2.seq
250001040 gbsts3.seq
250004283 gbsts4.seq
250002986 gbsts5.seq
250000757 gbsts6.seq
250003878 gbsts7.seq
250001551 gbsts8.seq
250002749 gbsts9.seq
250002834 gbsyn1.seq
128184862 gbsyn2.seq
426301 gbuna.seq
250001212 gbvrl1.seq
250000356 gbvrl2.seq
250007985 gbvrl3.seq
250000576 gbvrl4.seq
250000666 gbvrl5.seq
250002644 gbvrl6.seq
250001894 gbvrl7.seq
250012599 gbvrl8.seq
28693782 gbvrl9.seq
250133558 gbvrt1.seq
250100282 gbvrt10.seq
250038863 gbvrt11.seq
250035131 gbvrt12.seq
250001838 gbvrt13.seq
250003669 gbvrt14.seq
164557451 gbvrt15.seq
250001917 gbvrt2.seq
250052343 gbvrt3.seq
250000154 gbvrt4.seq
250000739 gbvrt5.seq
250230525 gbvrt6.seq
250080477 gbvrt7.seq
250045674 gbvrt8.seq
250002256 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 35026 101134647
BCT10 8261 112992924
BCT11 208 97330432
BCT12 69 113719464
BCT13 49 113888701
BCT14 50 115259082
BCT15 58 116308500
BCT16 68 115171466
BCT17 44 115427027
BCT18 54 110306286
BCT19 61 113345307
BCT2 3543 113650307
BCT20 67 111336692
BCT21 56 109773442
BCT22 67 110763599
BCT23 47 110109989
BCT24 58 111143668
BCT25 234 110236863
BCT26 59251 88418822
BCT27 73856 82203126
BCT28 30311 68815820
BCT3 160 112232466
BCT4 23022 104071925
BCT5 54398 87811330
BCT6 5494 98527911
BCT7 15440 97924962
BCT8 2438 120531928
BCT9 61505 85763767
ENV1 91044 71586521
ENV2 95529 69298540
ENV3 83312 82743954
ENV4 89819 86601783
ENV5 115774 49969936
ENV6 120713 40752661
ENV7 91866 75998940
ENV8 58016 50487714
EST1 68126 26289737
EST10 76527 29834975
EST100 74583 43220153
EST101 71507 36592171
EST102 74102 37472810
EST103 73194 39524687
EST104 74440 40367514
EST105 70248 40066831
EST106 68812 36387239
EST107 73143 36421740
EST108 72288 45592732
EST109 72675 45403361
EST11 75175 28790643
EST110 69502 42750589
EST111 72645 33207899
EST112 69676 29558519
EST113 67317 38131235
EST114 68230 36168870
EST115 68342 42125159
EST116 72640 36122526
EST117 75075 34645386
EST118 74544 27224712
EST119 73633 35264228
EST12 77544 30744509
EST120 74185 35118099
EST121 64684 37350109
EST122 80547 44589300
EST123 77829 43635610
EST124 68452 47365007
EST125 67690 40288440
EST126 74443 50788462
EST127 69177 41752553
EST128 74793 44691803
EST129 73569 45692993
EST13 76985 29267829
EST130 71701 49647372
EST131 72468 47580281
EST132 78983 43777116
EST133 75346 31153079
EST134 78148 34447273
EST135 79304 45716193
EST136 74618 43480475
EST137 64606 34217070
EST138 70280 36440689
EST139 68147 37672149
EST14 78641 31878007
EST140 65720 36633492
EST141 71583 43137531
EST142 72645 46028358
EST143 67889 39273326
EST144 69033 39252849
EST145 73654 45102704
EST146 67475 39523566
EST147 63926 36565005
EST148 104061 56657181
EST149 78353 44538796
EST15 74588 31529631
EST150 92624 48398643
EST151 111754 58992179
EST152 107316 59194608
EST153 91053 53553470
EST154 89303 50438088
EST155 99997 61136538
EST156 95583 58889628
EST157 89357 50458009
EST158 79139 46236703
EST159 68947 34802047
EST16 75803 33341394
EST160 63657 28837002
EST161 55401 25334899
EST162 64268 30736230
EST163 59808 30962306
EST164 63497 34179715
EST165 76653 53041384
EST166 63768 44032092
EST167 79678 46193094
EST168 62502 32646325
EST169 61263 30745213
EST17 82179 33912815
EST170 65567 40459143
EST171 64985 30098251
EST172 64848 49078028
EST173 82281 43783543
EST174 97842 46525296
EST175 92633 54962096
EST176 103993 60201032
EST177 96682 53918109
EST178 93375 47162679
EST179 90079 38227231
EST18 80748 32247986
EST180 97717 50264242
EST181 95623 41382422
EST182 95235 40859603
EST183 76134 37909682
EST184 66658 45063631
EST185 67961 38769261
EST186 63163 42519759
EST187 67942 31492972
EST188 75305 29310299
EST189 70490 44987072
EST19 78564 31775255
EST190 81804 40964089
EST191 63297 32431325
EST192 67417 44938020
EST193 68739 49127968
EST194 69699 36794586
EST195 66309 41213656
EST196 70334 57107382
EST197 67405 33595998
EST198 73064 37519857
EST199 68747 57781348
EST2 74644 28644020
EST20 74641 30696072
EST200 67327 52058950
EST201 63674 46544318
EST202 63436 46740339
EST203 64946 46253212
EST204 63686 44296317
EST205 63693 49264598
EST206 63444 39834065
EST207 63560 34138532
EST208 65057 38137956
EST209 83497 43813015
EST21 73888 34310254
EST210 84768 55879245
EST211 66194 40217892
EST212 106623 66566399
EST213 114392 69156547
EST214 115498 68550119
EST215 109388 70332195
EST216 113523 61979265
EST217 109728 53140000
EST218 89321 53897287
EST219 96863 43071003
EST22 75080 30087138
EST220 88618 46861132
EST221 72041 46875392
EST222 66877 44063649
EST223 68610 58457294
EST224 68582 58118096
EST225 80166 40059864
EST226 79979 46592720
EST227 74694 52956522
EST228 70742 51685487
EST229 40942 20664029
EST23 77360 32700059
EST230 28002 10627298
EST231 27857 10307819
EST232 26521 9801274
EST233 26819 9026418
EST234 27808 9994967
EST235 27407 10051684
EST236 27392 9871793
EST237 27528 10434405
EST238 27321 12150815
EST239 27434 11245799
EST24 74783 32843577
EST240 27530 10157753
EST241 27834 9332158
EST242 27121 9409575
EST243 28008 11393412
EST244 27931 10943314
EST245 27167 11406308
EST246 26872 12094594
EST247 27287 11339448
EST248 27245 10963050
EST249 27237 11783318
EST25 74008 31884609
EST250 27367 11647727
EST251 27480 11006936
EST252 27471 10947149
EST253 27344 10512067
EST254 27184 12105166
EST255 24574 17209564
EST256 26124 17555435
EST257 57868 25582933
EST258 79476 42029717
EST259 71669 32988363
EST26 75243 31068148
EST260 92788 40341475
EST261 70185 43940623
EST262 69185 44594730
EST263 69120 44325011
EST264 67540 41840718
EST265 73412 43169450
EST266 66149 38452451
EST267 66919 50187882
EST268 60026 28327072
EST269 93940 45568772
EST27 74373 32418239
EST270 95539 46627186
EST271 71553 40362955
EST272 61671 29694917
EST273 70744 37227243
EST274 70638 40237133
EST275 73624 34195080
EST276 70277 37763222
EST277 70811 45080049
EST278 65065 37920386
EST279 69518 33994770
EST28 108071 51139112
EST280 86455 46260027
EST281 73685 42190927
EST282 78543 55209721
EST283 86927 52060700
EST284 105539 47516883
EST285 78584 45890364
EST286 71894 41857146
EST287 74115 39506042
EST288 68655 33239694
EST289 70431 28277528
EST29 97091 45924259
EST290 66561 40051018
EST291 61599 35647441
EST292 66306 42214402
EST293 69128 39796160
EST294 63697 44052316
EST295 69345 34874121
EST296 81481 43962617
EST297 78577 42821592
EST298 87252 51895298
EST299 113403 51687527
EST3 73730 29915842
EST30 98622 53904769
EST300 107908 47861420
EST301 71117 37050542
EST302 68032 37875684
EST303 72987 46063853
EST304 79734 39084529
EST305 71346 43473013
EST306 70010 39025185
EST307 59646 36731735
EST308 52919 28614988
EST309 70939 48459222
EST31 86650 50481373
EST310 65687 40520627
EST311 70434 42412792
EST312 64454 38227605
EST313 77652 39544008
EST314 56630 29218213
EST315 55599 28395763
EST316 54232 29626953
EST317 55087 28751258
EST318 53752 29473967
EST319 57571 25021714
EST32 67533 43121591
EST320 58079 25441073
EST321 56515 23258561
EST322 57303 22862034
EST323 57066 22088679
EST324 58424 23866513
EST325 57257 22277019
EST326 58126 21419213
EST327 61265 26270664
EST328 76491 41419958
EST329 76384 34940432
EST33 71461 56965934
EST330 78835 32556175
EST331 76317 32199380
EST332 91041 56582980
EST333 60142 46946583
EST334 79705 50512637
EST335 96408 58868350
EST336 98521 58058575
EST337 106226 59712062
EST338 102781 58026302
EST339 69079 38750574
EST34 85193 48652592
EST340 70858 37329787
EST341 69803 46111251
EST342 65450 52364270
EST343 61621 46639071
EST344 62594 37149941
EST345 67459 43512405
EST346 71120 44825978
EST347 47823 24042735
EST348 57800 30909367
EST349 73633 38795359
EST35 86593 43580845
EST350 56674 28421245
EST351 66269 39729139
EST352 67771 43171493
EST353 83263 40466343
EST354 67645 42264030
EST355 71203 41679366
EST356 65104 39241034
EST357 72602 45562481
EST358 86251 49145424
EST359 86865 50160902
EST36 92231 50066688
EST360 71230 38687685
EST361 58735 37119058
EST362 74856 37566424
EST363 58734 31046780
EST364 49181 25717038
EST365 72636 40475118
EST366 82147 45764445
EST367 96909 48053443
EST368 67722 47341338
EST369 68166 44139862
EST37 87030 60718525
EST370 68553 41500103
EST371 60797 34514860
EST372 89040 38020389
EST373 68608 40207779
EST374 53017 37454806
EST375 63464 37845788
EST376 63768 42097932
EST377 98114 53819445
EST378 73945 39421544
EST379 75724 48558900
EST38 76182 51443221
EST380 65720 34101992
EST381 47187 29047513
EST382 45142 23691522
EST383 81541 55706682
EST384 81210 40349684
EST385 77673 45963176
EST386 75442 46566062
EST387 77650 47808309
EST388 81019 54330320
EST389 83566 67528484
EST39 93905 55028273
EST390 79300 64317291
EST391 91617 52410295
EST392 74174 38148442
EST393 62762 41168774
EST394 68315 38334944
EST395 61359 36410299
EST396 67984 32077572
EST397 79582 25693336
EST398 73078 41280445
EST399 67986 39170929
EST4 74560 28391053
EST40 63730 49335688
EST400 65460 33491163
EST401 72836 45102167
EST402 72042 48203340
EST403 66149 41634622
EST404 69533 42803314
EST405 61200 34090044
EST406 68359 41350788
EST407 74267 47026051
EST408 82162 48569340
EST409 83235 47525913
EST41 78701 49621980
EST410 61138 39871374
EST411 56397 41379307
EST412 57407 40492897
EST413 61334 40418977
EST414 76716 47971690
EST415 53786 31755485
EST416 57380 37184576
EST417 62194 39991779
EST418 58506 41579351
EST419 60596 41999125
EST42 103748 51717479
EST420 47954 33745874
EST421 76482 43465608
EST422 80261 39372698
EST423 70565 38858442
EST424 70635 38724354
EST425 70488 39218743
EST426 70494 38931859
EST427 70366 39263864
EST428 69931 38781872
EST429 69813 38858175
EST43 105271 44964566
EST430 69770 39610116
EST431 69760 38839314
EST432 67901 38503136
EST433 70112 38463081
EST434 70255 39721676
EST435 70295 39054971
EST436 70235 38241751
EST437 70695 38701387
EST438 70620 38823430
EST439 70545 38768288
EST44 92360 51415986
EST440 70831 38256598
EST441 77522 41651056
EST442 91362 51225819
EST443 82381 36814239
EST444 103442 60043357
EST445 82591 45834351
EST446 75655 48337234
EST447 83142 48286965
EST448 89077 53027751
EST449 97605 60488834
EST45 103647 45926026
EST450 81279 48104302
EST451 90630 50048425
EST452 88359 48710971
EST453 75084 58038410
EST454 68240 46032690
EST455 52276 40313079
EST456 59032 44717762
EST457 74121 40811621
EST458 53370 32072601
EST459 96486 51728376
EST46 70159 19059409
EST460 101949 56872173
EST461 78758 49719006
EST462 78039 54128828
EST463 38001 20376388
EST464 48801 58440977
EST465 52363 58152729
EST466 70098 46305088
EST467 70292 41309582
EST468 76003 42915799
EST469 67001 42832462
EST47 70452 18747886
EST470 67801 41444393
EST471 59606 52400160
EST472 92845 44465580
EST473 109254 47861998
EST474 72915 51620671
EST475 59939 40071778
EST476 57771 41358031
EST477 59034 39138123
EST478 65717 51003125
EST479 62109 44860340
EST48 72974 21772221
EST480 60979 41077631
EST481 51790 38399267
EST482 57061 38817910
EST483 55532 41225771
EST484 69223 37406625
EST485 65770 44018564
EST486 57102 38110439
EST487 61632 42783715
EST488 58427 45754866
EST489 65143 48721026
EST49 44093 12163317
EST490 62926 41540043
EST491 54552 41508936
EST492 53428 35563111
EST493 53084 36564729
EST494 59827 38762436
EST495 68197 40217344
EST496 64136 44942085
EST497 74892 61317835
EST498 74989 50250944
EST499 58884 52879538
EST5 48193 15292129
EST50 44040 12207564
EST500 48481 54939789
EST501 61751 52745249
EST502 62761 40270066
EST503 67477 38009814
EST504 82671 51892500
EST505 81122 54342975
EST506 77234 46783545
EST507 65436 41067966
EST508 67539 41566843
EST509 77373 51285065
EST51 43821 11890864
EST510 80993 49133743
EST511 75084 62942542
EST512 72414 48344506
EST513 67308 47269175
EST514 66741 51311172
EST515 62696 45492438
EST516 62892 45514693
EST517 87550 45849691
EST518 88095 42756268
EST519 121783 40381666
EST52 63837 24302012
EST520 90431 56237415
EST521 63911 51292468
EST522 50702 50115384
EST523 84062 29941499
EST524 99632 11169747
EST525 99731 11005663
EST526 95689 39144617
EST527 86999 31658799
EST528 87834 33626684
EST529 64284 54569808
EST53 96680 39152526
EST530 79222 56205279
EST531 87346 51213911
EST532 73567 41139572
EST533 72138 52555486
EST534 71920 44247871
EST535 84506 53753887
EST536 76468 48126118
EST537 73765 54233730
EST538 64705 48052661
EST539 78770 56890041
EST54 96999 42480314
EST540 91773 47856102
EST541 80826 46064923
EST542 83018 40659935
EST543 77232 41282092
EST544 83238 51276579
EST545 77117 52552477
EST546 71985 54413079
EST547 74024 44830189
EST548 98826 51022997
EST549 106307 45868144
EST55 97619 47027724
EST550 108836 48804920
EST551 130603 54988342
EST552 124002 57019959
EST553 74726 54844166
EST554 80077 44019860
EST555 83962 10426266
EST556 84935 16423506
EST557 118615 59296240
EST558 96946 49565606
EST559 66033 43523504
EST56 92596 46544526
EST560 70894 42028327
EST561 74657 51527263
EST562 71977 43643173
EST563 78346 47631180
EST564 67330 47004748
EST565 74005 51670088
EST566 98786 53499226
EST567 88666 44418732
EST568 63883 40430245
EST569 62891 46666027
EST57 103192 50934669
EST570 95184 58211426
EST571 90694 53170985
EST572 75293 42806716
EST573 85134 29391743
EST574 98475 10631048
EST575 98581 10445375
EST576 94192 25530752
EST577 70863 45118749
EST578 94034 45494577
EST579 71790 50764748
EST58 108010 55345942
EST580 78602 54952382
EST581 87512 53317950
EST582 85201 56268995
EST583 83027 55362463
EST584 81709 42528045
EST585 81962 48780061
EST586 72197 51558470
EST587 61254 39908874
EST588 82059 30738778
EST589 92647 42002941
EST59 76104 33327011
EST590 50024 34595884
EST591 51538 31647532
EST592 50662 35598969
EST593 68687 43028978
EST594 67291 47487565
EST595 64640 48208892
EST596 121773 12468276
EST597 118200 14571418
EST598 122565 11165906
EST599 122482 11292028
EST6 54905 17436890
EST60 66590 28748116
EST600 96325 27807752
EST601 64716 48491812
EST602 69400 47153859
EST603 80407 55392780
EST604 70478 49838438
EST605 68481 45675661
EST606 77115 44554940
EST607 65285 44071789
EST608 77273 38831084
EST609 127366 11608021
EST61 72719 32313889
EST610 124889 13678660
EST611 76460 42623102
EST612 70249 49277255
EST613 71569 47799555
EST614 93586 49805123
EST615 83332 52689671
EST616 60035 32383986
EST617 77572 50145453
EST618 69438 54269601
EST619 97404 47039895
EST62 70548 30026735
EST620 104723 54433365
EST621 62355 47990974
EST622 60783 48374691
EST623 70380 55403699
EST624 71516 30995778
EST625 88444 55475402
EST626 85866 52117063
EST627 84707 38142465
EST628 71297 47463336
EST629 70703 51671260
EST63 79774 32587243
EST630 83917 49185720
EST631 77292 27152107
EST632 77043 25765349
EST633 77068 26549522
EST634 75449 29094276
EST635 76945 26177859
EST636 75561 31046374
EST637 76583 28324551
EST638 75471 28200146
EST639 84078 32581043
EST64 76836 30135812
EST640 78775 48179849
EST641 81884 59989707
EST642 82051 59846743
EST643 72821 40765494
EST644 61570 36651873
EST645 76074 47351794
EST646 63679 43722478
EST647 58295 45866138
EST648 61733 42548467
EST649 77255 43058458
EST65 70588 28413240
EST650 66095 37939387
EST651 85993 51623437
EST652 80392 43862863
EST653 65824 41791872
EST654 73311 48671057
EST655 80068 46226692
EST656 65889 35492470
EST657 70428 48843355
EST658 74953 49916155
EST659 59337 40982276
EST66 64850 29670127
EST660 70771 52126465
EST661 74812 51640493
EST662 72463 46462182
EST663 69301 50036211
EST664 69716 46689631
EST665 77233 38977138
EST666 69795 31129385
EST667 56499 34588386
EST668 65553 46366336
EST669 63823 41075919
EST67 72712 32484813
EST670 66970 49337881
EST671 66376 43547508
EST672 58603 38957893
EST673 55338 38249237
EST674 64293 42713504
EST675 69019 44635140
EST676 65612 45198468
EST677 65873 46001949
EST678 66268 44743716
EST679 69358 47420102
EST68 79656 35648150
EST680 69895 59313326
EST681 65268 36252765
EST682 68354 40414462
EST683 66367 46385585
EST684 60934 36470406
EST685 63820 40816267
EST686 62050 37833999
EST687 69248 43255068
EST688 94012 53726726
EST689 100182 49642445
EST69 73424 29332091
EST690 61672 36260074
EST691 54046 28146880
EST692 51070 32165372
EST693 56062 36271307
EST694 59497 41145950
EST695 56741 37501126
EST696 62325 38094719
EST697 63309 41242798
EST698 56106 34918003
EST699 52750 32081995
EST7 74531 29353408
EST70 73890 24934461
EST700 72113 43029154
EST701 81632 45208858
EST702 79359 38003420
EST703 73225 27631291
EST704 76081 44228403
EST705 74757 44167063
EST706 71258 35463247
EST707 71732 26038875
EST708 73321 26637554
EST709 72659 26434091
EST71 86854 42298788
EST710 78159 26282368
EST711 72427 28532789
EST712 69390 27932493
EST713 17285 5204345
EST72 43698 12534403
EST73 40879 11257936
EST74 40846 12526788
EST75 41233 12717335
EST76 41284 12367266
EST77 41234 13310889
EST78 40973 13072792
EST79 41059 12205812
EST8 75810 30584478
EST80 40613 12136424
EST81 41369 12897507
EST82 41906 11987127
EST83 41488 13229870
EST84 41346 13078608
EST85 42993 13055218
EST86 46683 17458340
EST87 43378 27229315
EST88 43044 19456541
EST89 49500 20367120
EST9 77564 29870549
EST90 51567 22178595
EST91 50970 22004650
EST92 84247 49969232
EST93 78855 38389237
EST94 73106 27920262
EST95 74295 29203524
EST96 74776 41150007
EST97 77286 40663775
EST98 76393 43697526
EST99 76010 34951470
GSS1 90430 38662943
GSS10 74787 43607320
GSS100 80625 51422843
GSS101 74530 42753648
GSS102 73373 45684992
GSS103 73713 44827269
GSS104 73231 45733535
GSS105 73262 44830408
GSS106 75263 45725044
GSS107 81428 54690764
GSS108 83866 55511200
GSS109 81042 52312062
GSS11 70802 35983221
GSS110 82207 50438793
GSS111 84241 58182135
GSS112 79857 59047467
GSS113 91236 46345220
GSS114 89939 53559784
GSS115 73588 50011283
GSS116 89785 65411864
GSS117 82176 58727782
GSS118 75869 42420716
GSS119 81835 50489780
GSS12 73150 38495437
GSS120 94954 53358649
GSS121 84423 55562466
GSS122 84917 54820681
GSS123 81891 55709810
GSS124 76057 69621305
GSS125 76817 66079667
GSS126 78850 55621096
GSS127 72480 50149657
GSS128 72483 50133686
GSS129 73142 49023825
GSS13 76795 38906116
GSS130 72128 50786929
GSS131 74443 50623196
GSS132 84090 59846790
GSS133 80778 58331281
GSS134 68666 56198519
GSS135 71852 55677888
GSS136 75828 67955347
GSS137 75881 61943617
GSS138 77004 52532761
GSS139 86866 53817953
GSS14 71379 32114760
GSS140 94773 57968518
GSS141 92655 59925492
GSS142 82271 53749673
GSS143 88042 51667382
GSS144 75723 58227341
GSS145 114879 59700222
GSS146 109532 58815377
GSS147 87589 62240766
GSS148 50009 29619232
GSS149 68128 48781040
GSS15 70493 35055254
GSS150 73001 55885354
GSS151 72980 55922432
GSS152 73002 55884604
GSS153 73011 55867827
GSS154 72974 55931986
GSS155 72975 55932703
GSS156 75746 57511140
GSS157 84179 39668024
GSS158 88494 60237744
GSS159 85438 66058546
GSS16 78213 46093569
GSS160 89561 58468133
GSS161 91111 56964636
GSS162 83739 58139137
GSS163 75283 48393482
GSS164 76665 49456810
GSS165 92881 58461227
GSS166 90589 62004153
GSS167 86160 61036213
GSS168 105356 22055496
GSS169 100334 31964864
GSS17 70895 33315071
GSS170 78165 47132567
GSS171 81699 53791161
GSS172 52885 38521019
GSS173 54959 43359479
GSS174 61256 50569871
GSS175 59062 45357793
GSS176 57610 48695319
GSS177 57510 48729036
GSS178 58258 46389991
GSS179 58481 45716039
GSS18 58792 27918452
GSS180 58809 48767219
GSS181 58942 48443688
GSS182 58659 49318282
GSS183 58152 48366811
GSS184 58631 46102464
GSS185 58958 49558484
GSS186 60199 50037786
GSS187 60237 49979730
GSS188 60539 49068595
GSS189 60420 49426036
GSS19 56814 29015258
GSS190 60515 49141778
GSS191 59813 46847160
GSS192 59162 45327731
GSS193 58434 47618785
GSS194 58973 45930604
GSS195 58810 46441105
GSS196 58327 47951883
GSS197 58237 48234808
GSS198 58382 48663474
GSS199 60093 50113327
GSS2 89000 39334171
GSS20 57683 26671178
GSS200 59872 50775025
GSS201 59923 48952761
GSS202 60707 45658854
GSS203 60070 47625601
GSS204 59471 49484315
GSS205 59500 49393862
GSS206 59534 49289738
GSS207 59469 49488907
GSS208 59614 49048247
GSS209 59514 49351710
GSS21 61527 29551920
GSS210 59735 48677794
GSS211 59664 48895408
GSS212 59749 48315546
GSS213 58977 45622140
GSS214 58781 46274385
GSS215 58331 47843082
GSS216 58242 48160241
GSS217 58704 46241380
GSS218 58105 48183310
GSS219 64817 54771999
GSS22 64704 37621344
GSS220 64820 54762116
GSS221 100480 64030517
GSS222 81392 44545305
GSS223 77723 58368598
GSS224 88189 55557012
GSS225 86862 49607975
GSS226 73960 49885956
GSS227 71277 47089397
GSS228 71233 47199713
GSS229 103897 53423224
GSS23 57535 27063987
GSS230 97993 66800111
GSS231 35094 19166384
GSS232 87177 64476488
GSS233 83575 62755461
GSS234 103539 48483806
GSS235 68489 58441520
GSS236 68305 58779646
GSS237 69368 56630434
GSS238 69625 56131424
GSS239 70575 56037620
GSS24 66458 42175333
GSS240 76222 57617461
GSS241 75915 58212411
GSS242 87264 74943082
GSS243 84896 46827886
GSS244 92326 43887582
GSS245 84270 65564387
GSS246 70507 58638380
GSS247 69705 58658977
GSS248 64716 62215725
GSS249 74511 48468311
GSS25 67918 28145143
GSS250 85665 33830677
GSS251 113037 74039215
GSS252 98146 73867312
GSS253 90232 43096714
GSS254 111967 64719391
GSS255 120655 73176121
GSS256 116755 76093194
GSS257 101972 54269219
GSS258 83841 54659673
GSS259 96286 62140684
GSS26 58155 25414254
GSS260 107423 78517045
GSS261 108009 77919329
GSS262 105943 80160553
GSS263 102553 78443516
GSS264 78540 52122867
GSS265 109325 66541399
GSS266 110083 66161469
GSS267 105945 58358105
GSS268 81981 44584553
GSS269 105529 50784801
GSS27 65596 32054593
GSS270 85218 50451192
GSS271 98217 66006585
GSS272 95092 72944294
GSS273 95676 42760804
GSS274 95610 36946721
GSS275 96180 35990937
GSS276 94818 38274150
GSS277 96521 45094039
GSS278 100418 64374190
GSS279 94427 61369838
GSS28 65171 32497374
GSS280 95428 59928241
GSS281 93359 62874130
GSS282 81828 42512269
GSS283 84231 27632935
GSS284 84907 26186127
GSS285 58025 21210689
GSS29 77737 39812956
GSS3 87422 41844005
GSS30 82634 39702934
GSS31 74190 40413538
GSS32 70525 48290302
GSS33 79852 37772820
GSS34 75886 40326877
GSS35 74175 39863155
GSS36 87464 56577344
GSS37 87595 58178309
GSS38 85545 44925829
GSS39 86586 50235704
GSS4 79227 41150659
GSS40 86504 39700345
GSS41 83045 32388844
GSS42 81250 56926851
GSS43 80042 57956228
GSS44 72010 47533478
GSS45 72050 47405762
GSS46 77622 45644990
GSS47 77878 38873559
GSS48 83289 58061712
GSS49 86558 64908963
GSS5 78819 40567994
GSS50 81735 54225716
GSS51 93800 59362439
GSS52 88481 58784706
GSS53 76372 41881065
GSS54 73080 40854127
GSS55 86368 46797019
GSS56 88126 58671558
GSS57 76349 64405215
GSS58 70881 78111802
GSS59 86056 68969104
GSS6 78088 38842501
GSS60 89098 59748739
GSS61 63428 44952248
GSS62 66508 45599694
GSS63 89647 67279784
GSS64 84931 58261507
GSS65 86111 52984841
GSS66 85494 55678032
GSS67 93567 57753044
GSS68 97810 52599615
GSS69 97519 52984564
GSS7 77657 39174963
GSS70 98227 52048868
GSS71 99262 50676252
GSS72 99225 50725962
GSS73 99068 50935149
GSS74 99603 50224607
GSS75 97771 52651499
GSS76 91739 64969623
GSS77 89864 70742097
GSS78 88891 70086136
GSS79 87856 69637428
GSS8 75881 38134490
GSS80 87862 63828337
GSS81 88001 44102297
GSS82 78265 23298895
GSS83 78173 23509825
GSS84 83857 49928042
GSS85 77492 45035825
GSS86 88956 56322920
GSS87 84261 58535379
GSS88 76274 77062525
GSS89 79322 72662131
GSS9 72240 37167492
GSS90 84602 46667067
GSS91 84676 49200145
GSS92 75663 41949576
GSS93 79235 56943508
GSS94 77449 56451153
GSS95 81287 53740583
GSS96 84889 58220250
GSS97 85349 57695222
GSS98 87355 52202997
GSS99 82025 67857162
HTC1 24998 26954535
HTC10 64772 86489212
HTC11 66990 60365586
HTC12 69502 70304088
HTC13 9735 6155625
HTC2 15993 36013431
HTC3 15970 36547861
HTC4 16191 35357336
HTC5 15927 40313070
HTC6 16010 37271080
HTC7 51463 28046115
HTC8 81537 62955376
HTC9 74230 69680044
HTG1 1318 188929277
HTG10 1300 186477873
HTG100 1129 188893487
HTG101 1165 190448070
HTG102 1098 187111520
HTG103 1573 188562384
HTG104 982 193544129
HTG105 747 168918657
HTG106 1093 193874762
HTG107 1111 193156721
HTG108 1016 189877562
HTG109 1099 191358020
HTG11 1452 184100451
HTG110 1097 192204071
HTG111 1204 191550258
HTG112 1152 191690522
HTG113 1346 191715576
HTG114 1400 187309526
HTG12 875 191896857
HTG13 750 192351551
HTG14 744 192163475
HTG15 782 192309737
HTG16 803 192050081
HTG17 767 192527806
HTG18 2067 171160856
HTG19 1070 187868251
HTG2 2465 186071856
HTG20 964 189454990
HTG21 784 191964830
HTG22 923 190281534
HTG23 902 190592292
HTG24 810 191580191
HTG25 777 192012819
HTG26 866 191408217
HTG27 883 190950184
HTG28 954 190136110
HTG29 897 191147635
HTG3 2517 185290576
HTG30 929 190419240
HTG31 871 191490455
HTG32 966 189694769
HTG33 881 191236432
HTG34 864 191387865
HTG35 823 191895113
HTG36 946 190196078
HTG37 929 190808644
HTG38 938 190577506
HTG39 1039 189422730
HTG4 2553 188532563
HTG40 1205 186914421
HTG41 1257 188319990
HTG42 1176 188141155
HTG43 1151 188082094
HTG44 1117 191562844
HTG45 1280 190741582
HTG46 1176 191280972
HTG47 1134 191378700
HTG48 1028 191439355
HTG49 986 189551574
HTG5 1284 185715991
HTG50 1127 190292945
HTG51 879 189614156
HTG52 1066 189960932
HTG53 931 189586494
HTG54 1017 190184271
HTG55 987 189696639
HTG56 997 189488867
HTG57 1020 189867514
HTG58 1021 189869693
HTG59 1134 186188613
HTG6 1274 185234665
HTG60 1123 189429521
HTG61 1095 189918618
HTG62 1055 189666093
HTG63 1134 188930437
HTG64 1102 189627820
HTG65 1286 184597503
HTG66 1242 185448390
HTG67 1238 184547374
HTG68 1271 184580754
HTG69 1236 185364317
HTG7 1277 185414872
HTG70 1196 189123911
HTG71 1165 187691900
HTG72 1107 190980853
HTG73 1131 191230607
HTG74 1206 191374066
HTG75 1128 190464838
HTG76 1185 191014320
HTG77 1115 190590510
HTG78 1168 190310795
HTG79 1188 190286502
HTG8 1459 184762119
HTG80 1128 190636653
HTG81 1113 190461406
HTG82 1330 186611663
HTG83 1206 190832820
HTG84 1204 190916347
HTG85 1130 191576646
HTG86 1193 191330581
HTG87 1215 191608120
HTG88 1164 191925504
HTG89 1155 192060981
HTG9 1200 186999351
HTG90 1205 192239778
HTG91 1101 191823922
HTG92 1298 191995258
HTG93 1244 190616040
HTG94 1098 189207118
HTG95 1004 189729226
HTG96 1058 189853378
HTG97 989 189627203
HTG98 998 189700111
HTG99 1045 189586017
INV1 44926 119354427
INV10 86579 66267614
INV11 58839 88625800
INV12 2534 32701976
INV2 1600 181250577
INV3 411 146624781
INV4 69919 81405731
INV5 60974 87974469
INV6 38364 106109265
INV7 80701 72800665
INV8 62010 87001606
INV9 83915 66005268
MAM1 12157 166621240
MAM2 70599 77789966
MAM3 42861 122112501
MAM4 33605 29150025
PAT1 222610 70141260
PAT10 125437 99518322
PAT11 141739 62608396
PAT12 105795 59941764
PAT13 103555 50226564
PAT14 121472 53274905
PAT15 113046 61292248
PAT16 145018 54899867
PAT17 155517 69893240
PAT18 97490 122598017
PAT19 147594 87373130
PAT2 194518 84655123
PAT20 117407 104542066
PAT21 123717 103465007
PAT22 119286 106149134
PAT23 140192 91319413
PAT24 203990 39164825
PAT25 101745 75139475
PAT26 95444 84263317
PAT27 116944 64735334
PAT28 96529 83259841
PAT29 131958 51407862
PAT3 171984 95898893
PAT30 125865 75498534
PAT31 107436 54590176
PAT32 168134 21582153
PAT33 139894 66563204
PAT34 139489 112697953
PAT35 151242 107062109
PAT36 132472 114051490
PAT37 229290 27614926
PAT38 157299 22240966
PAT4 153750 106059356
PAT5 184018 85619906
PAT6 156356 93378118
PAT7 152402 81705440
PAT8 104672 119401279
PAT9 143543 89226955
PHG 3766 27582131
PLN1 54147 99425813
PLN10 22968 121108502
PLN11 17666 145541887
PLN12 17654 146698252
PLN13 17601 146777591
PLN14 17362 145164068
PLN15 1268 166495759
PLN16 996 173962062
PLN17 5 168115057
PLN18 85 166919288
PLN19 59769 74355427
PLN2 1477 167912517
PLN20 77569 77064455
PLN21 76822 78320145
PLN22 19039 118572503
PLN23 26376 134449232
PLN24 66761 87445241
PLN25 76557 78046330
PLN26 97844 55181291
PLN27 81035 76416348
PLN28 69186 82624652
PLN29 10807 23558867
PLN3 1610 182446773
PLN4 1992 192890403
PLN5 48138 103759200
PLN6 75324 79614594
PLN7 68257 63709970
PLN8 31887 54913839
PLN9 21406 121876960
PRI1 32950 117932719
PRI10 1455 182621629
PRI11 1278 179243985
PRI12 1453 178027295
PRI13 1589 180109941
PRI14 1603 182120539
PRI15 1272 191898343
PRI16 1138 193984927
PRI17 1103 194478210
PRI18 1211 193651339
PRI19 20441 157627138
PRI2 1638 172562886
PRI20 50094 111864774
PRI21 53231 74318908
PRI22 15538 147935905
PRI23 2616 180862326
PRI24 1643 182309135
PRI25 1898 183387546
PRI26 2029 182134129
PRI27 12647 155210231
PRI28 1474 185503192
PRI29 34868 119465047
PRI3 1307 183730588
PRI30 46945 75334811
PRI31 29204 78367381
PRI32 9688 167902649
PRI33 68501 90139430
PRI34 57313 88849292
PRI35 43804 81561168
PRI4 1346 185313705
PRI5 1196 181287798
PRI6 1186 178997668
PRI7 1233 181086609
PRI8 1322 176597182
PRI9 1241 174683007
ROD1 29234 145563425
ROD10 979 181510847
ROD11 1035 185933245
ROD12 947 183206752
ROD13 1035 189344426
ROD14 953 180469527
ROD15 965 181975942
ROD16 1002 186175258
ROD17 11845 172320661
ROD18 25249 142943934
ROD19 1133 183337820
ROD2 912 175026596
ROD20 1192 184460329
ROD21 15458 160427588
ROD22 37759 70516628
ROD23 15360 133168080
ROD24 15421 171947634
ROD25 150174 22843282
ROD26 31345 35786787
ROD3 913 173594190
ROD4 904 174083972
ROD5 929 174127427
ROD6 982 179530278
ROD7 956 179769512
ROD8 993 182011592
ROD9 1003 182569656
STS1 84289 36245439
STS10 57822 44863717
STS11 57931 43634958
STS12 64391 43034200
STS13 88842 38368623
STS14 80274 35119602
STS2 83898 48129028
STS3 69765 27432771
STS4 79165 37608844
STS5 54782 32174828
STS6 54867 31895122
STS7 54672 32199099
STS8 55672 35606924
STS9 57906 44436285
SYN1 48346 71434699
SYN2 26140 34764691
UNA 212 115418
VRL1 72220 65878711
VRL2 70485 64586052
VRL3 72247 64016364
VRL4 69217 68619131
VRL5 55412 74166897
VRL6 63125 71830649
VRL7 69170 66615686
VRL8 66292 72774032
VRL9 8097 7663744
VRT1 20928 160131312
VRT10 12168 175059322
VRT11 10557 175624589
VRT12 5973 183209307
VRT13 29604 147740710
VRT14 81475 68105739
VRT15 52276 45823437
VRT2 49602 120074247
VRT3 24166 150422663
VRT4 60905 97175735
VRT5 57092 65938397
VRT6 27317 92725895
VRT7 1197 191042201
VRT8 1267 190507188
VRT9 3227 186758288
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 165.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11362899 12961112485 Homo sapiens
7245579 8338427737 Mus musculus
1637741 5987910358 Rattus norvegicus
2084025 5027790273 Bos taurus
3174097 4445620571 Zea mays
1585714 2878075820 Danio rerio
1965110 2589103830 Sus scrofa
1204621 1532977763 Oryza sativa Japonica Group
227953 1352600350 Strongylocentrotus purpuratus
1420749 1141393595 Xenopus tropicalis
212771 990978270 Pan troglodytes
2208289 909951148 Arabidopsis thaliana
777300 909670835 Drosophila melanogaster
803054 867046372 Gallus gallus
530132 838221754 Vitis vinifera
76674 797930433 Macaca mulatta
1223071 704537082 Canis lupus familiaris
1104163 661241671 Triticum aestivum
1011822 660237482 Sorghum bicolor
422599 540494977 Medicago truncatula
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
April 15 2008
NCBI-GenBank Flat File Release 165.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 34(Database issue), D16-20 (2006)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 34(Database issue), D16-20 (2006)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 165.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko
Database Administration
Slava Khotomliansky, Ben Slade, Angela Tirone
User Support
Masoumeh Assadi, Medha Bhagwat, Peter Cooper, Susan Dombrowski,
Andrei Gabrielian, Renata Geer, Chuong Huynh, Emir Khatipov,
Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous,
Vyvy Pham, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian,
David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
