Release Notes For GenBank Release 166
GBREL.TXT Genetic Sequence Data Bank
June 15 2008
NCBI-GenBank Flat File Release 166.0
Distribution Release Notes
88554578 loci, 92008611867 bases, from 88554578 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 166.0
1.2 Cutoff Date
1.3 Important Changes in Release 166.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 166.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for the new GenBank submission tool - BankIt - on the World Wide Web:
http://www.ncbi.nlm.nih.gov/
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 166.0 is a release of sequence data by NCBI in the GenBank
flatfile format. GenBank is a component of a tri-partite, international
collaboration of sequence databases in the U.S., Europe, and Japan. The
collaborating databases in Europe are the European Molecular Biology Laboratory
(EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima,
Japan. Patent sequences are incorporated through arrangements with the
U.S. Patent and Trademark Office, and via the collaborating international
databases from other international patent offices. The database is converted
to various output formats, including the Flat File and Abstract Syntax Notation 1
(ASN.1) versions. The ASN.1 and Flat File forms of the data are available at
NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 166.0, incorporates data available to the collaborating
databases as of June 11, 2008 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 166.0
1.3.1 Organizational changes
The total number of sequence data files increased by 47 with this release:
- the TSA division is now comprised of 1 file (+1)
- the BCT division is now comprised of 29 files (+1)
- the CON division is now comprised of 91 files (+6)
- the EST division is now comprised of 738 files (+25)
- the ENV division is now comprised of 9 files (+1)
- the GSS division is now comprised of 290 files (+5)
- the HTG division is now comprised of 117 files (+3)
- the PAT division is now comprised of 42 files (+4)
- the PRI division is now comprised of 36 files (+1)
The total number of index files increased by 4 with this release:
- the AUT index is now comprised of 54 files (+4)
1.3.2 New file for the Transcriptome Shotgun Assembly (TSA) division
As announced with the previous release, Release 166.0 contains a new
divisional file (gbtsa.seq) for Transcriptome Shotgun Assembly (TSA)
mRNA sequences.
TSA sequences are shotgun assemblies of primary sequences deposited in
dbEST, the Trace Archive (TA) or the Short-Read Archive (SRA). Keywords
"TSA" and "Transcriptome Shotgun Assembly" are present on all TSA
records, in addition to a division code value of "TSA" on the LOCUS line.
No format changes (new or changed line types, features, or qualifiers)
are anticipated for this new class of GenBank record.
However, note that TSA records make use of the same PRIMARY block that
is utilized for Third-Party Annotation (TPA) records. The PRIMARY block
contains references to the underlying reads/transcripts that were assembled
to construct a TSA record.
It might be helpful to review the content of TSA record EZ000001 and its
use of the PRIMARY block:
http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nuccore&id=189498984
Requirements for the new Transcriptome Shotgun Assembly division include:
1. Submission of primary transcipt sequence data to dbEST, the Trace Archive,
or the Short-Read archive (SRA).
2. Registration of an associated transcriptome project with the International
Nucleotide Sequence Database Collaboration (INSDC).
For information about submitting projects via NCBI/GenBank, see:
http://www.ncbi.nlm.nih.gov/genomes/mpfsubmission.cgi
3. Submission of TSA sequence records to GenBank, including an assembly file
(.ace format)
Note that TSA records and the primary transcript sequences that they are
built from must be provided by the same submitter or collaborative group.
1.3.3 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.4 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
fifty-nine of the GSS flatfiles in Release 166.0. Consider gbgss232.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
June 15 2008
NCBI-GenBank Flat File Release 166.0
GSS Sequences (Part 1)
87182 loci, 64465152 bases, from 87182 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "232" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 Comprehensive protein FASTA file to be discontinued
Given the availability of divisional protein FASTA files as of GenBank
Release 164.0, support for the single, large, comprehensive protein FASTA
file:
ftp://ftp.ncbi.nih.gov/genbank/relNNN.fsa_aa.gz
(where 'NNN' represents a three-digit GenBank release number) will be
discontinued after GenBank Release 166.0 in June of 2008. The size
of this file has grown to exceed 4GB, which is unmanageable for many users.
Users are advised to make plans to utilize the new divisional files by
August of 2008. The divisional protein FASTA files are located at:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/gbXXX.fsa_aa.gz
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1553 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut6.idx - Index of the entries according to author name, part 6.
55. gbaut7.idx - Index of the entries according to author name, part 7.
56. gbaut8.idx - Index of the entries according to author name, part 8.
57. gbaut9.idx - Index of the entries according to author name, part 9.
58. gbbct1.seq - Bacterial sequence entries, part 1.
59. gbbct10.seq - Bacterial sequence entries, part 10.
60. gbbct11.seq - Bacterial sequence entries, part 11.
61. gbbct12.seq - Bacterial sequence entries, part 12.
62. gbbct13.seq - Bacterial sequence entries, part 13.
63. gbbct14.seq - Bacterial sequence entries, part 14.
64. gbbct15.seq - Bacterial sequence entries, part 15.
65. gbbct16.seq - Bacterial sequence entries, part 16.
66. gbbct17.seq - Bacterial sequence entries, part 17.
67. gbbct18.seq - Bacterial sequence entries, part 18.
68. gbbct19.seq - Bacterial sequence entries, part 19.
69. gbbct2.seq - Bacterial sequence entries, part 2.
70. gbbct20.seq - Bacterial sequence entries, part 20.
71. gbbct21.seq - Bacterial sequence entries, part 21.
72. gbbct22.seq - Bacterial sequence entries, part 22.
73. gbbct23.seq - Bacterial sequence entries, part 23.
74. gbbct24.seq - Bacterial sequence entries, part 24.
75. gbbct25.seq - Bacterial sequence entries, part 25.
76. gbbct26.seq - Bacterial sequence entries, part 26.
77. gbbct27.seq - Bacterial sequence entries, part 27.
78. gbbct28.seq - Bacterial sequence entries, part 28.
79. gbbct29.seq - Bacterial sequence entries, part 29.
80. gbbct3.seq - Bacterial sequence entries, part 3.
81. gbbct4.seq - Bacterial sequence entries, part 4.
82. gbbct5.seq - Bacterial sequence entries, part 5.
83. gbbct6.seq - Bacterial sequence entries, part 6.
84. gbbct7.seq - Bacterial sequence entries, part 7.
85. gbbct8.seq - Bacterial sequence entries, part 8.
86. gbbct9.seq - Bacterial sequence entries, part 9.
87. gbchg.txt - Accession numbers of entries updated since the previous release.
88. gbcon1.seq - Constructed sequence entries, part 1.
89. gbcon10.seq - Constructed sequence entries, part 10.
90. gbcon11.seq - Constructed sequence entries, part 11.
91. gbcon12.seq - Constructed sequence entries, part 12.
92. gbcon13.seq - Constructed sequence entries, part 13.
93. gbcon14.seq - Constructed sequence entries, part 14.
94. gbcon15.seq - Constructed sequence entries, part 15.
95. gbcon16.seq - Constructed sequence entries, part 16.
96. gbcon17.seq - Constructed sequence entries, part 17.
97. gbcon18.seq - Constructed sequence entries, part 18.
98. gbcon19.seq - Constructed sequence entries, part 19.
99. gbcon2.seq - Constructed sequence entries, part 2.
100. gbcon20.seq - Constructed sequence entries, part 20.
101. gbcon21.seq - Constructed sequence entries, part 21.
102. gbcon22.seq - Constructed sequence entries, part 22.
103. gbcon23.seq - Constructed sequence entries, part 23.
104. gbcon24.seq - Constructed sequence entries, part 24.
105. gbcon25.seq - Constructed sequence entries, part 25.
106. gbcon26.seq - Constructed sequence entries, part 26.
107. gbcon27.seq - Constructed sequence entries, part 27.
108. gbcon28.seq - Constructed sequence entries, part 28.
109. gbcon29.seq - Constructed sequence entries, part 29.
110. gbcon3.seq - Constructed sequence entries, part 3.
111. gbcon30.seq - Constructed sequence entries, part 30.
112. gbcon31.seq - Constructed sequence entries, part 31.
113. gbcon32.seq - Constructed sequence entries, part 32.
114. gbcon33.seq - Constructed sequence entries, part 33.
115. gbcon34.seq - Constructed sequence entries, part 34.
116. gbcon35.seq - Constructed sequence entries, part 35.
117. gbcon36.seq - Constructed sequence entries, part 36.
118. gbcon37.seq - Constructed sequence entries, part 37.
119. gbcon38.seq - Constructed sequence entries, part 38.
120. gbcon39.seq - Constructed sequence entries, part 39.
121. gbcon4.seq - Constructed sequence entries, part 4.
122. gbcon40.seq - Constructed sequence entries, part 40.
123. gbcon41.seq - Constructed sequence entries, part 41.
124. gbcon42.seq - Constructed sequence entries, part 42.
125. gbcon43.seq - Constructed sequence entries, part 43.
126. gbcon44.seq - Constructed sequence entries, part 44.
127. gbcon45.seq - Constructed sequence entries, part 45.
128. gbcon46.seq - Constructed sequence entries, part 46.
129. gbcon47.seq - Constructed sequence entries, part 47.
130. gbcon48.seq - Constructed sequence entries, part 48.
131. gbcon49.seq - Constructed sequence entries, part 49.
132. gbcon5.seq - Constructed sequence entries, part 5.
133. gbcon50.seq - Constructed sequence entries, part 50.
134. gbcon51.seq - Constructed sequence entries, part 51.
135. gbcon52.seq - Constructed sequence entries, part 52.
136. gbcon53.seq - Constructed sequence entries, part 53.
137. gbcon54.seq - Constructed sequence entries, part 54.
138. gbcon55.seq - Constructed sequence entries, part 55.
139. gbcon56.seq - Constructed sequence entries, part 56.
140. gbcon57.seq - Constructed sequence entries, part 57.
141. gbcon58.seq - Constructed sequence entries, part 58.
142. gbcon59.seq - Constructed sequence entries, part 59.
143. gbcon6.seq - Constructed sequence entries, part 6.
144. gbcon60.seq - Constructed sequence entries, part 60.
145. gbcon61.seq - Constructed sequence entries, part 61.
146. gbcon62.seq - Constructed sequence entries, part 62.
147. gbcon63.seq - Constructed sequence entries, part 63.
148. gbcon64.seq - Constructed sequence entries, part 64.
149. gbcon65.seq - Constructed sequence entries, part 65.
150. gbcon66.seq - Constructed sequence entries, part 66.
151. gbcon67.seq - Constructed sequence entries, part 67.
152. gbcon68.seq - Constructed sequence entries, part 68.
153. gbcon69.seq - Constructed sequence entries, part 69.
154. gbcon7.seq - Constructed sequence entries, part 7.
155. gbcon70.seq - Constructed sequence entries, part 70.
156. gbcon71.seq - Constructed sequence entries, part 71.
157. gbcon72.seq - Constructed sequence entries, part 72.
158. gbcon73.seq - Constructed sequence entries, part 73.
159. gbcon74.seq - Constructed sequence entries, part 74.
160. gbcon75.seq - Constructed sequence entries, part 75.
161. gbcon76.seq - Constructed sequence entries, part 76.
162. gbcon77.seq - Constructed sequence entries, part 77.
163. gbcon78.seq - Constructed sequence entries, part 78.
164. gbcon79.seq - Constructed sequence entries, part 79.
165. gbcon8.seq - Constructed sequence entries, part 8.
166. gbcon80.seq - Constructed sequence entries, part 80.
167. gbcon81.seq - Constructed sequence entries, part 81.
168. gbcon82.seq - Constructed sequence entries, part 82.
169. gbcon83.seq - Constructed sequence entries, part 83.
170. gbcon84.seq - Constructed sequence entries, part 84.
171. gbcon85.seq - Constructed sequence entries, part 85.
172. gbcon86.seq - Constructed sequence entries, part 86.
173. gbcon87.seq - Constructed sequence entries, part 87.
174. gbcon88.seq - Constructed sequence entries, part 88.
175. gbcon89.seq - Constructed sequence entries, part 89.
176. gbcon9.seq - Constructed sequence entries, part 9.
177. gbcon90.seq - Constructed sequence entries, part 90.
178. gbcon91.seq - Constructed sequence entries, part 91.
179. gbdel.txt - Accession numbers of entries deleted since the previous release.
180. gbenv1.seq - Environmental sampling sequence entries, part 1.
181. gbenv2.seq - Environmental sampling sequence entries, part 2.
182. gbenv3.seq - Environmental sampling sequence entries, part 3.
183. gbenv4.seq - Environmental sampling sequence entries, part 4.
184. gbenv5.seq - Environmental sampling sequence entries, part 5.
185. gbenv6.seq - Environmental sampling sequence entries, part 6.
186. gbenv7.seq - Environmental sampling sequence entries, part 7.
187. gbenv8.seq - Environmental sampling sequence entries, part 8.
188. gbenv9.seq - Environmental sampling sequence entries, part 9.
189. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
190. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
191. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
192. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
193. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
194. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
195. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
196. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
197. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
198. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
199. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
200. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
201. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
202. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
203. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
204. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
205. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
206. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
207. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
208. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
209. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
210. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
211. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
212. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
213. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
214. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
215. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
216. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
217. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
218. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
219. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
220. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
221. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
222. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
223. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
224. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
225. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
226. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
227. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
228. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
229. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
230. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
231. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
232. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
233. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
234. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
235. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
236. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
237. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
238. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
239. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
240. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
241. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
242. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
243. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
244. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
245. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
246. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
247. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
248. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
249. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
250. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
251. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
252. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
253. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
254. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
255. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
256. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
257. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
258. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
259. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
260. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
261. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
262. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
263. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
264. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
265. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
266. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
267. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
268. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
269. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
270. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
271. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
272. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
273. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
274. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
275. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
276. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
277. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
278. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
279. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
280. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
281. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
282. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
283. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
284. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
285. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
286. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
287. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
288. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
289. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
290. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
291. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
292. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
293. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
294. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
295. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
296. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
297. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
298. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
299. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
300. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
301. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
302. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
303. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
304. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
305. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
306. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
307. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
308. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
309. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
310. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
311. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
312. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
313. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
314. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
315. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
316. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
317. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
318. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
319. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
320. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
321. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
322. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
323. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
324. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
325. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
326. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
327. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
328. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
329. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
330. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
331. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
332. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
333. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
334. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
335. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
336. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
337. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
338. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
339. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
340. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
341. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
342. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
343. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
344. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
345. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
346. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
347. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
348. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
349. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
350. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
351. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
352. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
353. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
354. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
355. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
356. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
357. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
358. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
359. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
360. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
361. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
362. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
363. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
364. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
365. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
366. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
367. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
368. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
369. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
370. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
371. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
372. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
373. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
374. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
375. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
376. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
377. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
378. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
379. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
380. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
381. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
382. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
383. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
384. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
385. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
386. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
387. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
388. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
389. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
390. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
391. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
392. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
393. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
394. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
395. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
396. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
397. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
398. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
399. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
400. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
401. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
402. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
403. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
404. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
405. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
406. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
407. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
408. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
409. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
410. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
411. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
412. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
413. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
414. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
415. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
416. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
417. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
418. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
419. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
420. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
421. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
422. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
423. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
424. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
425. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
426. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
427. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
428. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
429. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
430. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
431. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
432. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
433. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
434. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
435. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
436. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
437. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
438. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
439. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
440. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
441. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
442. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
443. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
444. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
445. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
446. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
447. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
448. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
449. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
450. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
451. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
452. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
453. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
454. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
455. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
456. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
457. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
458. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
459. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
460. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
461. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
462. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
463. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
464. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
465. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
466. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
467. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
468. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
469. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
470. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
471. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
472. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
473. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
474. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
475. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
476. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
477. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
478. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
479. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
480. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
481. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
482. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
483. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
484. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
485. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
486. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
487. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
488. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
489. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
490. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
491. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
492. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
493. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
494. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
495. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
496. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
497. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
498. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
499. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
500. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
501. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
502. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
503. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
504. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
505. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
506. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
507. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
508. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
509. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
510. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
511. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
512. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
513. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
514. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
515. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
516. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
517. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
518. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
519. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
520. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
521. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
522. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
523. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
524. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
525. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
526. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
527. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
528. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
529. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
530. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
531. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
532. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
533. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
534. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
535. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
536. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
537. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
538. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
539. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
540. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
541. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
542. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
543. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
544. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
545. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
546. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
547. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
548. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
549. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
550. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
551. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
552. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
553. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
554. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
555. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
556. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
557. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
558. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
559. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
560. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
561. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
562. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
563. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
564. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
565. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
566. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
567. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
568. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
569. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
570. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
571. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
572. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
573. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
574. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
575. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
576. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
577. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
578. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
579. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
580. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
581. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
582. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
583. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
584. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
585. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
586. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
587. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
588. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
589. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
590. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
591. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
592. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
593. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
594. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
595. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
596. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
597. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
598. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
599. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
600. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
601. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
602. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
603. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
604. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
605. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
606. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
607. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
608. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
609. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
610. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
611. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
612. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
613. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
614. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
615. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
616. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
617. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
618. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
619. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
620. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
621. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
622. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
623. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
624. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
625. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
626. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
627. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
628. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
629. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
630. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
631. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
632. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
633. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
634. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
635. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
636. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
637. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
638. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
639. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
640. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
641. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
642. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
643. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
644. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
645. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
646. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
647. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
648. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
649. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
650. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
651. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
652. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
653. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
654. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
655. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
656. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
657. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
658. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
659. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
660. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
661. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
662. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
663. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
664. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
665. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
666. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
667. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
668. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
669. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
670. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
671. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
672. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
673. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
674. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
675. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
676. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
677. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
678. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
679. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
680. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
681. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
682. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
683. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
684. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
685. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
686. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
687. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
688. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
689. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
690. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
691. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
692. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
693. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
694. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
695. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
696. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
697. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
698. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
699. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
700. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
701. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
702. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
703. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
704. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
705. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
706. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
707. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
708. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
709. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
710. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
711. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
712. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
713. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
714. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
715. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
716. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
717. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
718. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
719. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
720. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
721. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
722. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
723. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
724. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
725. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
726. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
727. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
728. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
729. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
730. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
731. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
732. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
733. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
734. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
735. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
736. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
737. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
738. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
739. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
740. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
741. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
742. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
743. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
744. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
745. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
746. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
747. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
748. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
749. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
750. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
751. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
752. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
753. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
754. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
755. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
756. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
757. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
758. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
759. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
760. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
761. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
762. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
763. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
764. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
765. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
766. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
767. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
768. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
769. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
770. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
771. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
772. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
773. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
774. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
775. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
776. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
777. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
778. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
779. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
780. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
781. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
782. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
783. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
784. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
785. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
786. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
787. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
788. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
789. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
790. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
791. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
792. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
793. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
794. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
795. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
796. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
797. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
798. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
799. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
800. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
801. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
802. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
803. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
804. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
805. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
806. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
807. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
808. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
809. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
810. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
811. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
812. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
813. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
814. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
815. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
816. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
817. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
818. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
819. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
820. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
821. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
822. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
823. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
824. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
825. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
826. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
827. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
828. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
829. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
830. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
831. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
832. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
833. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
834. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
835. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
836. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
837. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
838. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
839. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
840. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
841. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
842. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
843. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
844. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
845. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
846. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
847. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
848. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
849. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
850. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
851. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
852. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
853. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
854. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
855. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
856. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
857. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
858. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
859. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
860. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
861. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
862. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
863. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
864. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
865. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
866. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
867. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
868. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
869. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
870. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
871. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
872. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
873. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
874. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
875. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
876. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
877. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
878. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
879. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
880. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
881. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
882. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
883. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
884. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
885. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
886. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
887. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
888. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
889. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
890. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
891. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
892. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
893. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
894. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
895. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
896. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
897. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
898. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
899. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
900. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
901. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
902. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
903. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
904. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
905. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
906. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
907. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
908. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
909. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
910. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
911. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
912. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
913. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
914. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
915. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
916. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
917. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
918. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
919. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
920. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
921. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
922. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
923. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
924. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
925. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
926. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
927. gbgen.idx - Index of the entries according to gene symbols.
928. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
929. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
930. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
931. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
932. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
933. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
934. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
935. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
936. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
937. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
938. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
939. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
940. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
941. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
942. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
943. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
944. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
945. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
946. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
947. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
948. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
949. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
950. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
951. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
952. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
953. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
954. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
955. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
956. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
957. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
958. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
959. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
960. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
961. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
962. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
963. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
964. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
965. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
966. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
967. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
968. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
969. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
970. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
971. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
972. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
973. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
974. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
975. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
976. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
977. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
978. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
979. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
980. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
981. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
982. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
983. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
984. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
985. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
986. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
987. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
988. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
989. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
990. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
991. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
992. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
993. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
994. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
995. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
996. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
997. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
998. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
999. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1000. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1001. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1002. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1003. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1004. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1005. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1006. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1007. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1008. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1009. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1010. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1011. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1012. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1013. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1014. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1015. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1016. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1017. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1018. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1019. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1020. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1021. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1022. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1023. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1024. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1025. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1026. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1027. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1028. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1029. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1030. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1031. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1032. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1033. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1034. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1035. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1036. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1037. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1038. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1039. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1040. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1041. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1042. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1043. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1044. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1045. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1046. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1047. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1048. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1049. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1050. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1051. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1052. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1053. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1054. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1055. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1056. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1057. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1058. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1059. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1060. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1061. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1062. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1063. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1064. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1065. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1066. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1067. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1068. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1069. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1070. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1071. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1072. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1073. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1074. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1075. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1076. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1077. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1078. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1079. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1080. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1081. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1082. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1083. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1084. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1085. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1086. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1087. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1088. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1089. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1090. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1091. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1092. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1093. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1094. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1095. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1096. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1097. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1098. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1099. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1100. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1101. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1102. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1103. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1104. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1105. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1106. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1107. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1108. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1109. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1110. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1111. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1112. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1113. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1114. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1115. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1116. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1117. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1118. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1119. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1120. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1121. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1122. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1123. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1124. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1125. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1126. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1127. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1128. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1129. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1130. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1131. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1132. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1133. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1134. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1135. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1136. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1137. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1138. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1139. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1140. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1141. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1142. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1143. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1144. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1145. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1146. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1147. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1148. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1149. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1150. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1151. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1152. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1153. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1154. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1155. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1156. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1157. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1158. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1159. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1160. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1161. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1162. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1163. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1164. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1165. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1166. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1167. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1168. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1169. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1170. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1171. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1172. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1173. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1174. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1175. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1176. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1177. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1178. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1179. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1180. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1181. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1182. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1183. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1184. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1185. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1186. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1187. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1188. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1189. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1190. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1191. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1192. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1193. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1194. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1195. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1196. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1197. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1198. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1199. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1200. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1201. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1202. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1203. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1204. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1205. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1206. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1207. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1208. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1209. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1210. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1211. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1212. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1213. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1214. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1215. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1216. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1217. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1218. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1219. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1220. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1221. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1222. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1223. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1224. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1225. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1226. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1227. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1228. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1229. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1230. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1231. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1232. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1233. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1234. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1235. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1236. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1237. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1238. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1239. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1240. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1241. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1242. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1243. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1244. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1245. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1246. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1247. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1248. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1249. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1250. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1251. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1252. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1253. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1254. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1255. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1256. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1257. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1258. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1259. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1260. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1261. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1262. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1263. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1264. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1265. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1266. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1267. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1268. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1269. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1270. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1271. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1272. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1273. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1274. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1275. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1276. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1277. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1278. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1279. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1280. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1281. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1282. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1283. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1284. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1285. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1286. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1287. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1288. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1289. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1290. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1291. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1292. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1293. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1294. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1295. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1296. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1297. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1298. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1299. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1300. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1301. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1302. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1303. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1304. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1305. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1306. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1307. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1308. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1309. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1310. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1311. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1312. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1313. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1314. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1315. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1316. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1317. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1318. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1319. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1320. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1321. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1322. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1323. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1324. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1325. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1326. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1327. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1328. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1329. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1330. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1331. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1332. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1333. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1334. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1335. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1336. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1337. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1338. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1339. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1340. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1341. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1342. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1343. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1344. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1345. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1346. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1347. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1348. gbinv1.seq - Invertebrate sequence entries, part 1.
1349. gbinv10.seq - Invertebrate sequence entries, part 10.
1350. gbinv11.seq - Invertebrate sequence entries, part 11.
1351. gbinv12.seq - Invertebrate sequence entries, part 12.
1352. gbinv2.seq - Invertebrate sequence entries, part 2.
1353. gbinv3.seq - Invertebrate sequence entries, part 3.
1354. gbinv4.seq - Invertebrate sequence entries, part 4.
1355. gbinv5.seq - Invertebrate sequence entries, part 5.
1356. gbinv6.seq - Invertebrate sequence entries, part 6.
1357. gbinv7.seq - Invertebrate sequence entries, part 7.
1358. gbinv8.seq - Invertebrate sequence entries, part 8.
1359. gbinv9.seq - Invertebrate sequence entries, part 9.
1360. gbjou1.idx - Index of the entries according to journal citation, part 1.
1361. gbjou2.idx - Index of the entries according to journal citation, part 2.
1362. gbjou3.idx - Index of the entries according to journal citation, part 3.
1363. gbjou4.idx - Index of the entries according to journal citation, part 4.
1364. gbjou5.idx - Index of the entries according to journal citation, part 5.
1365. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1366. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1367. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1368. gbmam1.seq - Other mammalian sequence entries, part 1.
1369. gbmam2.seq - Other mammalian sequence entries, part 2.
1370. gbmam3.seq - Other mammalian sequence entries, part 3.
1371. gbmam4.seq - Other mammalian sequence entries, part 4.
1372. gbnew.txt - Accession numbers of entries new since the previous release.
1373. gbpat1.seq - Patent sequence entries, part 1.
1374. gbpat10.seq - Patent sequence entries, part 10.
1375. gbpat11.seq - Patent sequence entries, part 11.
1376. gbpat12.seq - Patent sequence entries, part 12.
1377. gbpat13.seq - Patent sequence entries, part 13.
1378. gbpat14.seq - Patent sequence entries, part 14.
1379. gbpat15.seq - Patent sequence entries, part 15.
1380. gbpat16.seq - Patent sequence entries, part 16.
1381. gbpat17.seq - Patent sequence entries, part 17.
1382. gbpat18.seq - Patent sequence entries, part 18.
1383. gbpat19.seq - Patent sequence entries, part 19.
1384. gbpat2.seq - Patent sequence entries, part 2.
1385. gbpat20.seq - Patent sequence entries, part 20.
1386. gbpat21.seq - Patent sequence entries, part 21.
1387. gbpat22.seq - Patent sequence entries, part 22.
1388. gbpat23.seq - Patent sequence entries, part 23.
1389. gbpat24.seq - Patent sequence entries, part 24.
1390. gbpat25.seq - Patent sequence entries, part 25.
1391. gbpat26.seq - Patent sequence entries, part 26.
1392. gbpat27.seq - Patent sequence entries, part 27.
1393. gbpat28.seq - Patent sequence entries, part 28.
1394. gbpat29.seq - Patent sequence entries, part 29.
1395. gbpat3.seq - Patent sequence entries, part 3.
1396. gbpat30.seq - Patent sequence entries, part 30.
1397. gbpat31.seq - Patent sequence entries, part 31.
1398. gbpat32.seq - Patent sequence entries, part 32.
1399. gbpat33.seq - Patent sequence entries, part 33.
1400. gbpat34.seq - Patent sequence entries, part 34.
1401. gbpat35.seq - Patent sequence entries, part 35.
1402. gbpat36.seq - Patent sequence entries, part 36.
1403. gbpat37.seq - Patent sequence entries, part 37.
1404. gbpat38.seq - Patent sequence entries, part 38.
1405. gbpat39.seq - Patent sequence entries, part 39.
1406. gbpat4.seq - Patent sequence entries, part 4.
1407. gbpat40.seq - Patent sequence entries, part 40.
1408. gbpat41.seq - Patent sequence entries, part 41.
1409. gbpat42.seq - Patent sequence entries, part 42.
1410. gbpat5.seq - Patent sequence entries, part 5.
1411. gbpat6.seq - Patent sequence entries, part 6.
1412. gbpat7.seq - Patent sequence entries, part 7.
1413. gbpat8.seq - Patent sequence entries, part 8.
1414. gbpat9.seq - Patent sequence entries, part 9.
1415. gbphg.seq - Phage sequence entries.
1416. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1417. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1418. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1419. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1420. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1421. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1422. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1423. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1424. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1425. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1426. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1427. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1428. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1429. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1430. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1431. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1432. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1433. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1434. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1435. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1436. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1437. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1438. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1439. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1440. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1441. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1442. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1443. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1444. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1445. gbpri1.seq - Primate sequence entries, part 1.
1446. gbpri10.seq - Primate sequence entries, part 10.
1447. gbpri11.seq - Primate sequence entries, part 11.
1448. gbpri12.seq - Primate sequence entries, part 12.
1449. gbpri13.seq - Primate sequence entries, part 13.
1450. gbpri14.seq - Primate sequence entries, part 14.
1451. gbpri15.seq - Primate sequence entries, part 15.
1452. gbpri16.seq - Primate sequence entries, part 16.
1453. gbpri17.seq - Primate sequence entries, part 17.
1454. gbpri18.seq - Primate sequence entries, part 18.
1455. gbpri19.seq - Primate sequence entries, part 19.
1456. gbpri2.seq - Primate sequence entries, part 2.
1457. gbpri20.seq - Primate sequence entries, part 20.
1458. gbpri21.seq - Primate sequence entries, part 21.
1459. gbpri22.seq - Primate sequence entries, part 22.
1460. gbpri23.seq - Primate sequence entries, part 23.
1461. gbpri24.seq - Primate sequence entries, part 24.
1462. gbpri25.seq - Primate sequence entries, part 25.
1463. gbpri26.seq - Primate sequence entries, part 26.
1464. gbpri27.seq - Primate sequence entries, part 27.
1465. gbpri28.seq - Primate sequence entries, part 28.
1466. gbpri29.seq - Primate sequence entries, part 29.
1467. gbpri3.seq - Primate sequence entries, part 3.
1468. gbpri30.seq - Primate sequence entries, part 30.
1469. gbpri31.seq - Primate sequence entries, part 31.
1470. gbpri32.seq - Primate sequence entries, part 32.
1471. gbpri33.seq - Primate sequence entries, part 33.
1472. gbpri34.seq - Primate sequence entries, part 34.
1473. gbpri35.seq - Primate sequence entries, part 35.
1474. gbpri36.seq - Primate sequence entries, part 36.
1475. gbpri4.seq - Primate sequence entries, part 4.
1476. gbpri5.seq - Primate sequence entries, part 5.
1477. gbpri6.seq - Primate sequence entries, part 6.
1478. gbpri7.seq - Primate sequence entries, part 7.
1479. gbpri8.seq - Primate sequence entries, part 8.
1480. gbpri9.seq - Primate sequence entries, part 9.
1481. gbrel.txt - Release notes (this document).
1482. gbrod1.seq - Rodent sequence entries, part 1.
1483. gbrod10.seq - Rodent sequence entries, part 10.
1484. gbrod11.seq - Rodent sequence entries, part 11.
1485. gbrod12.seq - Rodent sequence entries, part 12.
1486. gbrod13.seq - Rodent sequence entries, part 13.
1487. gbrod14.seq - Rodent sequence entries, part 14.
1488. gbrod15.seq - Rodent sequence entries, part 15.
1489. gbrod16.seq - Rodent sequence entries, part 16.
1490. gbrod17.seq - Rodent sequence entries, part 17.
1491. gbrod18.seq - Rodent sequence entries, part 18.
1492. gbrod19.seq - Rodent sequence entries, part 19.
1493. gbrod2.seq - Rodent sequence entries, part 2.
1494. gbrod20.seq - Rodent sequence entries, part 20.
1495. gbrod21.seq - Rodent sequence entries, part 21.
1496. gbrod22.seq - Rodent sequence entries, part 22.
1497. gbrod23.seq - Rodent sequence entries, part 23.
1498. gbrod24.seq - Rodent sequence entries, part 24.
1499. gbrod25.seq - Rodent sequence entries, part 25.
1500. gbrod26.seq - Rodent sequence entries, part 26.
1501. gbrod3.seq - Rodent sequence entries, part 3.
1502. gbrod4.seq - Rodent sequence entries, part 4.
1503. gbrod5.seq - Rodent sequence entries, part 5.
1504. gbrod6.seq - Rodent sequence entries, part 6.
1505. gbrod7.seq - Rodent sequence entries, part 7.
1506. gbrod8.seq - Rodent sequence entries, part 8.
1507. gbrod9.seq - Rodent sequence entries, part 9.
1508. gbsdr1.txt - Short directory of the data bank, part 1.
1509. gbsdr2.txt - Short directory of the data bank, part 2.
1510. gbsdr3.txt - Short directory of the data bank, part 3.
1511. gbsec.idx - Index of the entries according to secondary accession number.
1512. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1513. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1514. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1515. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1516. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1517. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1518. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1519. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1520. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1521. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1522. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1523. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1524. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1525. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1526. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1527. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1528. gbtsa.seq - TSA (transcriptome shotgun assembly) sequence entries.
1529. gbuna.seq - Unannotated sequence entries.
1530. gbvrl1.seq - Viral sequence entries, part 1.
1531. gbvrl2.seq - Viral sequence entries, part 2.
1532. gbvrl3.seq - Viral sequence entries, part 3.
1533. gbvrl4.seq - Viral sequence entries, part 4.
1534. gbvrl5.seq - Viral sequence entries, part 5.
1535. gbvrl6.seq - Viral sequence entries, part 6.
1536. gbvrl7.seq - Viral sequence entries, part 7.
1537. gbvrl8.seq - Viral sequence entries, part 8.
1538. gbvrl9.seq - Viral sequence entries, part 9.
1539. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1540. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1541. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1542. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1543. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1544. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1545. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1546. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1547. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1548. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1549. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1550. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1551. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1552. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1553. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 166.0 flatfiles require roughly 343 GB (sequence
files only) or 366 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
739326431 gbacc1.idx
1750396866 gbacc2.idx
581202012 gbacc3.idx
188801102 gbaut1.idx
222024867 gbaut10.idx
202340903 gbaut11.idx
183730340 gbaut12.idx
227353991 gbaut13.idx
183976302 gbaut14.idx
185098977 gbaut15.idx
207166674 gbaut16.idx
193571756 gbaut17.idx
209619575 gbaut18.idx
185139014 gbaut19.idx
213143613 gbaut2.idx
206781974 gbaut20.idx
184405166 gbaut21.idx
184095266 gbaut22.idx
183787349 gbaut23.idx
183773542 gbaut24.idx
185657873 gbaut25.idx
184165447 gbaut26.idx
185867865 gbaut27.idx
183637212 gbaut28.idx
183802535 gbaut29.idx
228694331 gbaut3.idx
184178897 gbaut30.idx
184804545 gbaut31.idx
230761361 gbaut32.idx
183690532 gbaut33.idx
183483998 gbaut34.idx
185781805 gbaut35.idx
218775885 gbaut36.idx
184701480 gbaut37.idx
183869970 gbaut38.idx
185828107 gbaut39.idx
188224649 gbaut4.idx
189616243 gbaut40.idx
185024421 gbaut41.idx
183867940 gbaut42.idx
190071561 gbaut43.idx
185100649 gbaut44.idx
214227286 gbaut45.idx
208444005 gbaut46.idx
197532368 gbaut47.idx
183885844 gbaut48.idx
191224223 gbaut49.idx
184258561 gbaut5.idx
194411090 gbaut50.idx
185029790 gbaut51.idx
184492623 gbaut52.idx
183904228 gbaut53.idx
111368902 gbaut54.idx
203232339 gbaut6.idx
189441425 gbaut7.idx
186037568 gbaut8.idx
183801345 gbaut9.idx
250155760 gbbct1.seq
255320229 gbbct10.seq
250545785 gbbct11.seq
255220272 gbbct12.seq
252021603 gbbct13.seq
254073213 gbbct14.seq
255794368 gbbct15.seq
255959445 gbbct16.seq
258576397 gbbct17.seq
255572149 gbbct18.seq
252061411 gbbct19.seq
253338622 gbbct2.seq
255006423 gbbct20.seq
252084333 gbbct21.seq
261562814 gbbct22.seq
258952172 gbbct23.seq
260863995 gbbct24.seq
253912537 gbbct25.seq
256493234 gbbct26.seq
250001584 gbbct27.seq
250001152 gbbct28.seq
245988743 gbbct29.seq
260920173 gbbct3.seq
250000899 gbbct4.seq
250013854 gbbct5.seq
252053715 gbbct6.seq
250002686 gbbct7.seq
251814711 gbbct8.seq
256277258 gbbct9.seq
5698601 gbchg.txt
250294690 gbcon1.seq
250001803 gbcon10.seq
250616317 gbcon11.seq
250001029 gbcon12.seq
250000025 gbcon13.seq
250000738 gbcon14.seq
250465625 gbcon15.seq
250000535 gbcon16.seq
250001156 gbcon17.seq
250000136 gbcon18.seq
250001385 gbcon19.seq
251081424 gbcon2.seq
250000579 gbcon20.seq
250000522 gbcon21.seq
250000197 gbcon22.seq
250000547 gbcon23.seq
250000824 gbcon24.seq
250004923 gbcon25.seq
250005826 gbcon26.seq
250001221 gbcon27.seq
250000173 gbcon28.seq
250001593 gbcon29.seq
250062861 gbcon3.seq
250002541 gbcon30.seq
250005819 gbcon31.seq
250004227 gbcon32.seq
250002238 gbcon33.seq
250003641 gbcon34.seq
250003013 gbcon35.seq
250005720 gbcon36.seq
250001242 gbcon37.seq
250003489 gbcon38.seq
250003450 gbcon39.seq
250000910 gbcon4.seq
250001101 gbcon40.seq
250003432 gbcon41.seq
250001853 gbcon42.seq
250005138 gbcon43.seq
250000052 gbcon44.seq
250003961 gbcon45.seq
250002084 gbcon46.seq
250002187 gbcon47.seq
250003773 gbcon48.seq
250002980 gbcon49.seq
250001001 gbcon5.seq
250003772 gbcon50.seq
250002144 gbcon51.seq
250003349 gbcon52.seq
250000755 gbcon53.seq
250001324 gbcon54.seq
250002116 gbcon55.seq
250004218 gbcon56.seq
250002026 gbcon57.seq
250001093 gbcon58.seq
250000162 gbcon59.seq
250001727 gbcon6.seq
250000610 gbcon60.seq
250003613 gbcon61.seq
250004992 gbcon62.seq
250002921 gbcon63.seq
250004236 gbcon64.seq
250004009 gbcon65.seq
250006698 gbcon66.seq
250005229 gbcon67.seq
250001416 gbcon68.seq
250003902 gbcon69.seq
250001246 gbcon7.seq
250002536 gbcon70.seq
250004862 gbcon71.seq
250002381 gbcon72.seq
250000178 gbcon73.seq
250003188 gbcon74.seq
250000703 gbcon75.seq
250000097 gbcon76.seq
250004436 gbcon77.seq
250000258 gbcon78.seq
250001792 gbcon79.seq
250000157 gbcon8.seq
250005586 gbcon80.seq
250001976 gbcon81.seq
250000012 gbcon82.seq
250002797 gbcon83.seq
250002157 gbcon84.seq
250001117 gbcon85.seq
250004294 gbcon86.seq
250003846 gbcon87.seq
250000911 gbcon88.seq
250010898 gbcon89.seq
250285555 gbcon9.seq
228836987 gbcon90.seq
21400431 gbcon91.seq
116721 gbdel.txt
250001160 gbenv1.seq
250000337 gbenv2.seq
250000530 gbenv3.seq
250001979 gbenv4.seq
250001571 gbenv5.seq
250001429 gbenv6.seq
250000595 gbenv7.seq
250000717 gbenv8.seq
61547664 gbenv9.seq
230688948 gbest1.seq
230688243 gbest10.seq
230690231 gbest100.seq
230688330 gbest101.seq
230687726 gbest102.seq
230688230 gbest103.seq
230687523 gbest104.seq
230688046 gbest105.seq
230688940 gbest106.seq
230687535 gbest107.seq
230690524 gbest108.seq
230688809 gbest109.seq
230688240 gbest11.seq
230689246 gbest110.seq
230688671 gbest111.seq
230687625 gbest112.seq
230688073 gbest113.seq
230688888 gbest114.seq
230688101 gbest115.seq
230690868 gbest116.seq
230688986 gbest117.seq
230689259 gbest118.seq
229978215 gbest119.seq
230689913 gbest12.seq
230688299 gbest120.seq
230691023 gbest121.seq
230689667 gbest122.seq
230688258 gbest123.seq
230687462 gbest124.seq
230688557 gbest125.seq
230688546 gbest126.seq
230688847 gbest127.seq
230687958 gbest128.seq
230690118 gbest129.seq
230689204 gbest13.seq
230690427 gbest130.seq
230690542 gbest131.seq
230688036 gbest132.seq
230687817 gbest133.seq
227395785 gbest134.seq
230689755 gbest135.seq
230690037 gbest136.seq
230688570 gbest137.seq
230690079 gbest138.seq
230688347 gbest139.seq
230690612 gbest14.seq
230687735 gbest140.seq
230688150 gbest141.seq
230690167 gbest142.seq
230690859 gbest143.seq
230690006 gbest144.seq
230691366 gbest145.seq
230689313 gbest146.seq
230691431 gbest147.seq
230688227 gbest148.seq
230689831 gbest149.seq
230690090 gbest15.seq
230689555 gbest150.seq
230687848 gbest151.seq
230689537 gbest152.seq
230687823 gbest153.seq
230689842 gbest154.seq
230688284 gbest155.seq
230689900 gbest156.seq
230689166 gbest157.seq
230688580 gbest158.seq
230690328 gbest159.seq
230689082 gbest16.seq
230688722 gbest160.seq
230690428 gbest161.seq
230688537 gbest162.seq
230688702 gbest163.seq
230689417 gbest164.seq
230688436 gbest165.seq
230688528 gbest166.seq
230689852 gbest167.seq
230689791 gbest168.seq
230688651 gbest169.seq
230688017 gbest17.seq
230687930 gbest170.seq
230689614 gbest171.seq
230690148 gbest172.seq
230688308 gbest173.seq
230687636 gbest174.seq
230688966 gbest175.seq
230687663 gbest176.seq
230688552 gbest177.seq
230687550 gbest178.seq
230688427 gbest179.seq
230689140 gbest18.seq
228448947 gbest180.seq
230688682 gbest181.seq
230687472 gbest182.seq
230690694 gbest183.seq
230688767 gbest184.seq
230690691 gbest185.seq
230689103 gbest186.seq
230687989 gbest187.seq
230334034 gbest188.seq
230687551 gbest189.seq
230690352 gbest19.seq
230689454 gbest190.seq
230689875 gbest191.seq
230687691 gbest192.seq
230687895 gbest193.seq
230689619 gbest194.seq
230689549 gbest195.seq
230687671 gbest196.seq
230687881 gbest197.seq
230687527 gbest198.seq
230688005 gbest199.seq
230689740 gbest2.seq
230688164 gbest20.seq
230687666 gbest200.seq
230690378 gbest201.seq
230690677 gbest202.seq
230689852 gbest203.seq
230690376 gbest204.seq
230690224 gbest205.seq
230691153 gbest206.seq
230690410 gbest207.seq
230688653 gbest208.seq
230689706 gbest209.seq
230691927 gbest21.seq
230688327 gbest210.seq
230689335 gbest211.seq
230688029 gbest212.seq
230689376 gbest213.seq
230688766 gbest214.seq
230688481 gbest215.seq
230688930 gbest216.seq
230689145 gbest217.seq
230688566 gbest218.seq
230689331 gbest219.seq
230687537 gbest22.seq
230688098 gbest220.seq
230688457 gbest221.seq
230689974 gbest222.seq
230687861 gbest223.seq
230688291 gbest224.seq
230687850 gbest225.seq
230687993 gbest226.seq
230688817 gbest227.seq
230688366 gbest228.seq
230690675 gbest229.seq
230689526 gbest23.seq
164014341 gbest230.seq
161152572 gbest231.seq
165440887 gbest232.seq
168359856 gbest233.seq
168550662 gbest234.seq
163015882 gbest235.seq
163915623 gbest236.seq
163247508 gbest237.seq
163245752 gbest238.seq
163326322 gbest239.seq
230689717 gbest24.seq
163181024 gbest240.seq
162681132 gbest241.seq
163192504 gbest242.seq
165936815 gbest243.seq
160582078 gbest244.seq
163068381 gbest245.seq
167778592 gbest246.seq
165838066 gbest247.seq
164467330 gbest248.seq
164597732 gbest249.seq
230690253 gbest25.seq
164240174 gbest250.seq
163751454 gbest251.seq
163044643 gbest252.seq
163140851 gbest253.seq
164432003 gbest254.seq
169123647 gbest255.seq
177406448 gbest256.seq
170391546 gbest257.seq
226391997 gbest258.seq
230690481 gbest259.seq
230688262 gbest26.seq
230687919 gbest260.seq
230689747 gbest261.seq
230688621 gbest262.seq
230690257 gbest263.seq
230689946 gbest264.seq
230690236 gbest265.seq
230688249 gbest266.seq
230688897 gbest267.seq
230690004 gbest268.seq
230687745 gbest269.seq
230690226 gbest27.seq
230689049 gbest270.seq
230689909 gbest271.seq
230689315 gbest272.seq
230688276 gbest273.seq
230687814 gbest274.seq
230687949 gbest275.seq
230691690 gbest276.seq
230688442 gbest277.seq
230690205 gbest278.seq
230689220 gbest279.seq
230688467 gbest28.seq
230688523 gbest280.seq
230690422 gbest281.seq
230688501 gbest282.seq
230688880 gbest283.seq
230688536 gbest284.seq
230689832 gbest285.seq
230688525 gbest286.seq
230687589 gbest287.seq
230690723 gbest288.seq
215315603 gbest289.seq
230687512 gbest29.seq
230688627 gbest290.seq
230689929 gbest291.seq
230692367 gbest292.seq
230687603 gbest293.seq
230690080 gbest294.seq
230687447 gbest295.seq
230692337 gbest296.seq
230688008 gbest297.seq
230688379 gbest298.seq
230687462 gbest299.seq
230690712 gbest3.seq
230689476 gbest30.seq
230689228 gbest300.seq
230688441 gbest301.seq
230688592 gbest302.seq
230688086 gbest303.seq
230689141 gbest304.seq
230689712 gbest305.seq
230687922 gbest306.seq
230692669 gbest307.seq
230688450 gbest308.seq
230688925 gbest309.seq
230688948 gbest31.seq
230690929 gbest310.seq
230689130 gbest311.seq
230688856 gbest312.seq
230690922 gbest313.seq
230688869 gbest314.seq
230689667 gbest315.seq
230689318 gbest316.seq
230690294 gbest317.seq
230689043 gbest318.seq
230689366 gbest319.seq
230690102 gbest32.seq
230689488 gbest320.seq
230689792 gbest321.seq
230688281 gbest322.seq
230688019 gbest323.seq
230689585 gbest324.seq
230688508 gbest325.seq
230689510 gbest326.seq
230690178 gbest327.seq
230689075 gbest328.seq
230688048 gbest329.seq
230688304 gbest33.seq
230688616 gbest330.seq
230688573 gbest331.seq
230688766 gbest332.seq
230689451 gbest333.seq
230688134 gbest334.seq
230687755 gbest335.seq
230688983 gbest336.seq
230688950 gbest337.seq
230689424 gbest338.seq
230689560 gbest339.seq
230687739 gbest34.seq
224823026 gbest340.seq
220125717 gbest341.seq
230688312 gbest342.seq
230689209 gbest343.seq
230688921 gbest344.seq
230691236 gbest345.seq
230689409 gbest346.seq
178828736 gbest347.seq
152184915 gbest348.seq
230689940 gbest349.seq
230688601 gbest35.seq
230690674 gbest350.seq
230688838 gbest351.seq
230690147 gbest352.seq
230688978 gbest353.seq
230689467 gbest354.seq
230688492 gbest355.seq
230689001 gbest356.seq
230690524 gbest357.seq
230687493 gbest358.seq
230689163 gbest359.seq
230687639 gbest36.seq
230691452 gbest360.seq
230689145 gbest361.seq
230690834 gbest362.seq
230689842 gbest363.seq
230688051 gbest364.seq
230690431 gbest365.seq
230688891 gbest366.seq
230688470 gbest367.seq
230688135 gbest368.seq
230690870 gbest369.seq
230687935 gbest37.seq
222090467 gbest370.seq
230691013 gbest371.seq
230688523 gbest372.seq
230689944 gbest373.seq
230689934 gbest374.seq
230689162 gbest375.seq
230688850 gbest376.seq
230687679 gbest377.seq
230690255 gbest378.seq
230687916 gbest379.seq
230689184 gbest38.seq
230689395 gbest380.seq
230690314 gbest381.seq
230690492 gbest382.seq
230688902 gbest383.seq
230688451 gbest384.seq
230688457 gbest385.seq
230687484 gbest386.seq
230689312 gbest387.seq
230688886 gbest388.seq
230687930 gbest389.seq
230688446 gbest39.seq
230688878 gbest390.seq
230688011 gbest391.seq
230688896 gbest392.seq
230689194 gbest393.seq
230688891 gbest394.seq
230687861 gbest395.seq
230689032 gbest396.seq
230687871 gbest397.seq
230688254 gbest398.seq
222413328 gbest399.seq
230689469 gbest4.seq
230690233 gbest40.seq
230691091 gbest400.seq
230688733 gbest401.seq
230688224 gbest402.seq
230690297 gbest403.seq
230687562 gbest404.seq
230690364 gbest405.seq
230689270 gbest406.seq
230687669 gbest407.seq
230689528 gbest408.seq
230687494 gbest409.seq
230688807 gbest41.seq
230687577 gbest410.seq
230689539 gbest411.seq
230688576 gbest412.seq
230688899 gbest413.seq
230689545 gbest414.seq
230690022 gbest415.seq
230688663 gbest416.seq
230692108 gbest417.seq
230688412 gbest418.seq
230689825 gbest419.seq
230689046 gbest42.seq
230691615 gbest420.seq
230689197 gbest421.seq
230693902 gbest422.seq
230687732 gbest423.seq
214370619 gbest424.seq
208304807 gbest425.seq
208244605 gbest426.seq
208409205 gbest427.seq
208319110 gbest428.seq
208503897 gbest429.seq
230689095 gbest43.seq
208847611 gbest430.seq
210045290 gbest431.seq
209586986 gbest432.seq
209195237 gbest433.seq
212328657 gbest434.seq
209707850 gbest435.seq
208740813 gbest436.seq
208763936 gbest437.seq
208905330 gbest438.seq
208227781 gbest439.seq
230688584 gbest44.seq
208259099 gbest440.seq
208314491 gbest441.seq
208083767 gbest442.seq
210842358 gbest443.seq
230689136 gbest444.seq
230689898 gbest445.seq
230689220 gbest446.seq
230690284 gbest447.seq
230687582 gbest448.seq
230690355 gbest449.seq
230687808 gbest45.seq
230689258 gbest450.seq
230688402 gbest451.seq
230690218 gbest452.seq
230687928 gbest453.seq
230688766 gbest454.seq
230689327 gbest455.seq
230688204 gbest456.seq
230688648 gbest457.seq
230688914 gbest458.seq
230689301 gbest459.seq
211192662 gbest46.seq
230688247 gbest460.seq
230689835 gbest461.seq
230690646 gbest462.seq
230687784 gbest463.seq
230688057 gbest464.seq
230688152 gbest465.seq
230688725 gbest466.seq
230688148 gbest467.seq
230688752 gbest468.seq
230691169 gbest469.seq
188827655 gbest47.seq
230689422 gbest470.seq
230691620 gbest471.seq
230689064 gbest472.seq
230688073 gbest473.seq
230687836 gbest474.seq
230688561 gbest475.seq
230690177 gbest476.seq
230690940 gbest477.seq
230689236 gbest478.seq
230687681 gbest479.seq
191189792 gbest48.seq
230687636 gbest480.seq
230690918 gbest481.seq
230690904 gbest482.seq
230689789 gbest483.seq
230687994 gbest484.seq
230688738 gbest485.seq
230689735 gbest486.seq
230691045 gbest487.seq
230689455 gbest488.seq
230688596 gbest489.seq
214994154 gbest49.seq
230690272 gbest490.seq
230689911 gbest491.seq
230687829 gbest492.seq
230690052 gbest493.seq
230687981 gbest494.seq
230688944 gbest495.seq
230687642 gbest496.seq
230689899 gbest497.seq
230689980 gbest498.seq
230689120 gbest499.seq
164140234 gbest5.seq
214892628 gbest50.seq
230690195 gbest500.seq
230689574 gbest501.seq
230691451 gbest502.seq
230687790 gbest503.seq
230688706 gbest504.seq
230688001 gbest505.seq
230691696 gbest506.seq
230690093 gbest507.seq
230689230 gbest508.seq
230689618 gbest509.seq
215011069 gbest51.seq
230690047 gbest510.seq
230689127 gbest511.seq
230688448 gbest512.seq
230688911 gbest513.seq
230689221 gbest514.seq
230689067 gbest515.seq
230688752 gbest516.seq
230687727 gbest517.seq
225015225 gbest518.seq
230690573 gbest519.seq
215524678 gbest52.seq
230688011 gbest520.seq
230690640 gbest521.seq
230688185 gbest522.seq
230688869 gbest523.seq
230687486 gbest524.seq
230687717 gbest525.seq
230688859 gbest526.seq
230689344 gbest527.seq
230688347 gbest528.seq
230688226 gbest529.seq
230688613 gbest53.seq
230688287 gbest530.seq
230689755 gbest531.seq
230689410 gbest532.seq
198187698 gbest533.seq
196049962 gbest534.seq
230688402 gbest535.seq
230687783 gbest536.seq
230690335 gbest537.seq
230690254 gbest538.seq
230690272 gbest539.seq
230688979 gbest54.seq
230689531 gbest540.seq
230687993 gbest541.seq
230687467 gbest542.seq
230689495 gbest543.seq
230689630 gbest544.seq
230688747 gbest545.seq
230688520 gbest546.seq
230689997 gbest547.seq
222462985 gbest548.seq
230689774 gbest549.seq
230689117 gbest55.seq
230687976 gbest550.seq
230688477 gbest551.seq
230690254 gbest552.seq
230690047 gbest553.seq
230689023 gbest554.seq
230688543 gbest555.seq
219599967 gbest556.seq
230688934 gbest557.seq
230688973 gbest558.seq
230688131 gbest559.seq
219607951 gbest56.seq
230689572 gbest560.seq
230688218 gbest561.seq
230688113 gbest562.seq
230688549 gbest563.seq
230689615 gbest564.seq
230691185 gbest565.seq
230690504 gbest566.seq
230689070 gbest567.seq
230687572 gbest568.seq
230687485 gbest569.seq
230689252 gbest57.seq
230689598 gbest570.seq
229399812 gbest571.seq
230688804 gbest572.seq
230688122 gbest573.seq
230689237 gbest574.seq
230690650 gbest575.seq
230689181 gbest576.seq
230689458 gbest577.seq
230689990 gbest578.seq
230689466 gbest579.seq
230689059 gbest58.seq
230688368 gbest580.seq
230689214 gbest581.seq
230689339 gbest582.seq
230689102 gbest583.seq
230687772 gbest584.seq
230690759 gbest585.seq
230687701 gbest586.seq
230689074 gbest587.seq
230689655 gbest588.seq
230689212 gbest589.seq
230687661 gbest59.seq
230687611 gbest590.seq
230688762 gbest591.seq
224453362 gbest592.seq
230688386 gbest593.seq
230687773 gbest594.seq
230690157 gbest595.seq
230690159 gbest596.seq
230687919 gbest597.seq
230688172 gbest598.seq
230688871 gbest599.seq
177421852 gbest6.seq
230691372 gbest60.seq
230688226 gbest600.seq
230691042 gbest601.seq
230687635 gbest602.seq
230688155 gbest603.seq
230688297 gbest604.seq
230689162 gbest605.seq
230689754 gbest606.seq
230688042 gbest607.seq
230690032 gbest608.seq
230689598 gbest609.seq
230689095 gbest61.seq
230691008 gbest610.seq
230688429 gbest611.seq
230689138 gbest612.seq
230688057 gbest613.seq
230687617 gbest614.seq
230687879 gbest615.seq
230687735 gbest616.seq
230687802 gbest617.seq
230688032 gbest618.seq
230688983 gbest619.seq
230689061 gbest62.seq
230689439 gbest620.seq
230687699 gbest621.seq
230687526 gbest622.seq
230687930 gbest623.seq
230690817 gbest624.seq
230687805 gbest625.seq
230687458 gbest626.seq
230690147 gbest627.seq
230690526 gbest628.seq
230690380 gbest629.seq
230688830 gbest63.seq
222548132 gbest630.seq
230687442 gbest631.seq
230688764 gbest632.seq
230688195 gbest633.seq
217398812 gbest634.seq
227104417 gbest635.seq
230687590 gbest636.seq
199569642 gbest637.seq
191352591 gbest638.seq
190548996 gbest639.seq
230688398 gbest64.seq
194292612 gbest640.seq
190937573 gbest641.seq
192311296 gbest642.seq
191257206 gbest643.seq
193337227 gbest644.seq
191781979 gbest645.seq
191097596 gbest646.seq
195091275 gbest647.seq
230687623 gbest648.seq
230688762 gbest649.seq
230690141 gbest65.seq
230687997 gbest650.seq
230691150 gbest651.seq
230688433 gbest652.seq
230687887 gbest653.seq
228946710 gbest654.seq
175928962 gbest655.seq
229120072 gbest656.seq
230687551 gbest657.seq
230689680 gbest658.seq
230688853 gbest659.seq
230689912 gbest66.seq
230688206 gbest660.seq
230687484 gbest661.seq
230688398 gbest662.seq
230688943 gbest663.seq
230688882 gbest664.seq
230687777 gbest665.seq
230689083 gbest666.seq
230688606 gbest667.seq
230688192 gbest668.seq
230687509 gbest669.seq
230689028 gbest67.seq
230688327 gbest670.seq
230687961 gbest671.seq
230690293 gbest672.seq
230688399 gbest673.seq
230688670 gbest674.seq
230689075 gbest675.seq
230688911 gbest676.seq
230690307 gbest677.seq
230689176 gbest678.seq
230688510 gbest679.seq
230691169 gbest68.seq
230688653 gbest680.seq
230689931 gbest681.seq
230689496 gbest682.seq
230688368 gbest683.seq
230690140 gbest684.seq
230689764 gbest685.seq
230691507 gbest686.seq
230687840 gbest687.seq
230688385 gbest688.seq
230690027 gbest689.seq
230688775 gbest69.seq
230689131 gbest690.seq
230689415 gbest691.seq
230690601 gbest692.seq
230688649 gbest693.seq
230690025 gbest694.seq
230689280 gbest695.seq
230690541 gbest696.seq
230688907 gbest697.seq
230690301 gbest698.seq
230691014 gbest699.seq
230687642 gbest7.seq
230689543 gbest70.seq
230688489 gbest700.seq
230687723 gbest701.seq
230687518 gbest702.seq
230689775 gbest703.seq
230691289 gbest704.seq
230689420 gbest705.seq
230687972 gbest706.seq
230690155 gbest707.seq
230689539 gbest708.seq
230687769 gbest709.seq
230688932 gbest71.seq
230690910 gbest710.seq
230687998 gbest711.seq
230690535 gbest712.seq
230688936 gbest713.seq
230690152 gbest714.seq
230688103 gbest715.seq
205230554 gbest716.seq
227603638 gbest717.seq
230688833 gbest718.seq
230689831 gbest719.seq
228247970 gbest72.seq
230688496 gbest720.seq
230691133 gbest721.seq
230689409 gbest722.seq
230690587 gbest723.seq
230687580 gbest724.seq
230691341 gbest725.seq
230689945 gbest726.seq
230690680 gbest727.seq
230689080 gbest728.seq
230687560 gbest729.seq
208557993 gbest73.seq
230687876 gbest730.seq
230690270 gbest731.seq
230689071 gbest732.seq
230688006 gbest733.seq
230689381 gbest734.seq
230689265 gbest735.seq
230684714 gbest736.seq
230688389 gbest737.seq
101824091 gbest738.seq
207810011 gbest74.seq
207560203 gbest75.seq
207999626 gbest76.seq
209244040 gbest77.seq
208341489 gbest78.seq
207063578 gbest79.seq
230688273 gbest8.seq
208762416 gbest80.seq
209050478 gbest81.seq
204394706 gbest82.seq
206105089 gbest83.seq
206434436 gbest84.seq
207730604 gbest85.seq
217289956 gbest86.seq
230688454 gbest87.seq
230687926 gbest88.seq
225147627 gbest89.seq
230689556 gbest9.seq
214981936 gbest90.seq
212261356 gbest91.seq
225604937 gbest92.seq
230687454 gbest93.seq
230689864 gbest94.seq
230688196 gbest95.seq
230688584 gbest96.seq
230687682 gbest97.seq
230688194 gbest98.seq
230688551 gbest99.seq
81689854 gbgen.idx
230688965 gbgss1.seq
230690079 gbgss10.seq
230689183 gbgss100.seq
227817866 gbgss101.seq
228816050 gbgss102.seq
228519687 gbgss103.seq
228615643 gbgss104.seq
227731269 gbgss105.seq
230689722 gbgss106.seq
230689867 gbgss107.seq
230688912 gbgss108.seq
230688409 gbgss109.seq
230689764 gbgss11.seq
230687468 gbgss110.seq
230689467 gbgss111.seq
230689587 gbgss112.seq
230688378 gbgss113.seq
230689636 gbgss114.seq
230687884 gbgss115.seq
230689096 gbgss116.seq
230688113 gbgss117.seq
230688869 gbgss118.seq
230687489 gbgss119.seq
230687679 gbgss12.seq
230688165 gbgss120.seq
230689591 gbgss121.seq
230688989 gbgss122.seq
230689475 gbgss123.seq
230688300 gbgss124.seq
230689896 gbgss125.seq
230690277 gbgss126.seq
230687932 gbgss127.seq
230688873 gbgss128.seq
230689782 gbgss129.seq
230690347 gbgss13.seq
230690054 gbgss130.seq
230690033 gbgss131.seq
230688719 gbgss132.seq
230689747 gbgss133.seq
230688576 gbgss134.seq
230689965 gbgss135.seq
230688728 gbgss136.seq
230688916 gbgss137.seq
230689061 gbgss138.seq
230688304 gbgss139.seq
230689893 gbgss14.seq
230689197 gbgss140.seq
230688921 gbgss141.seq
230688815 gbgss142.seq
230688143 gbgss143.seq
230688800 gbgss144.seq
224495128 gbgss145.seq
230689276 gbgss146.seq
230688235 gbgss147.seq
195673979 gbgss148.seq
230690316 gbgss149.seq
230689648 gbgss15.seq
230688304 gbgss150.seq
230688386 gbgss151.seq
230688470 gbgss152.seq
230690496 gbgss153.seq
230688337 gbgss154.seq
230689648 gbgss155.seq
230688987 gbgss156.seq
230687753 gbgss157.seq
230689348 gbgss158.seq
230687925 gbgss159.seq
230689778 gbgss16.seq
230690016 gbgss160.seq
230687815 gbgss161.seq
230687635 gbgss162.seq
230687711 gbgss163.seq
230689726 gbgss164.seq
230688593 gbgss165.seq
230688195 gbgss166.seq
230689438 gbgss167.seq
230687975 gbgss168.seq
230687744 gbgss169.seq
230688655 gbgss17.seq
229163388 gbgss170.seq
230690136 gbgss171.seq
230690421 gbgss172.seq
230687773 gbgss173.seq
213072893 gbgss174.seq
207612803 gbgss175.seq
210343080 gbgss176.seq
210645462 gbgss177.seq
209586268 gbgss178.seq
209277065 gbgss179.seq
230688580 gbgss18.seq
207491743 gbgss180.seq
207265835 gbgss181.seq
207680359 gbgss182.seq
209591563 gbgss183.seq
209301916 gbgss184.seq
208157107 gbgss185.seq
205715803 gbgss186.seq
205673072 gbgss187.seq
205236847 gbgss188.seq
205412951 gbgss189.seq
230688247 gbgss19.seq
205273767 gbgss190.seq
206451832 gbgss191.seq
207550674 gbgss192.seq
208586602 gbgss193.seq
207819113 gbgss194.seq
208047455 gbgss195.seq
208740788 gbgss196.seq
208869443 gbgss197.seq
208622703 gbgss198.seq
205800882 gbgss199.seq
230688628 gbgss2.seq
230689216 gbgss20.seq
206120994 gbgss200.seq
206380413 gbgss201.seq
205439217 gbgss202.seq
206351402 gbgss203.seq
207218813 gbgss204.seq
207181512 gbgss205.seq
207125415 gbgss206.seq
207222731 gbgss207.seq
207012558 gbgss208.seq
207159248 gbgss209.seq
230690186 gbgss21.seq
206838808 gbgss210.seq
206942425 gbgss211.seq
206806003 gbgss212.seq
207734263 gbgss213.seq
208021711 gbgss214.seq
209657493 gbgss215.seq
210072874 gbgss216.seq
209291791 gbgss217.seq
210474742 gbgss218.seq
218859302 gbgss219.seq
230690133 gbgss22.seq
218860001 gbgss220.seq
230689682 gbgss221.seq
230688775 gbgss222.seq
230688639 gbgss223.seq
230688820 gbgss224.seq
230687920 gbgss225.seq
227209592 gbgss226.seq
217906383 gbgss227.seq
217942849 gbgss228.seq
230689666 gbgss229.seq
230689062 gbgss23.seq
230689204 gbgss230.seq
215297313 gbgss231.seq
250002759 gbgss232.seq
250001137 gbgss233.seq
250002459 gbgss234.seq
250000158 gbgss235.seq
250003258 gbgss236.seq
250000291 gbgss237.seq
250001291 gbgss238.seq
250002745 gbgss239.seq
230688100 gbgss24.seq
250002252 gbgss240.seq
250000108 gbgss241.seq
250002110 gbgss242.seq
250000507 gbgss243.seq
250000358 gbgss244.seq
250002807 gbgss245.seq
250002339 gbgss246.seq
250002772 gbgss247.seq
250000418 gbgss248.seq
250001202 gbgss249.seq
230687876 gbgss25.seq
250001484 gbgss250.seq
250000986 gbgss251.seq
250001883 gbgss252.seq
250000325 gbgss253.seq
250001266 gbgss254.seq
250001373 gbgss255.seq
250001271 gbgss256.seq
250002219 gbgss257.seq
250000383 gbgss258.seq
250000149 gbgss259.seq
230691504 gbgss26.seq
250000150 gbgss260.seq
250000764 gbgss261.seq
250000974 gbgss262.seq
250002359 gbgss263.seq
250002248 gbgss264.seq
250000413 gbgss265.seq
250001327 gbgss266.seq
250001623 gbgss267.seq
250002931 gbgss268.seq
250000245 gbgss269.seq
230690309 gbgss27.seq
250000004 gbgss270.seq
250000959 gbgss271.seq
250000644 gbgss272.seq
250001366 gbgss273.seq
250001971 gbgss274.seq
250000797 gbgss275.seq
250002675 gbgss276.seq
250001632 gbgss277.seq
250000834 gbgss278.seq
250000945 gbgss279.seq
230689913 gbgss28.seq
250002476 gbgss280.seq
250001601 gbgss281.seq
250000555 gbgss282.seq
250001549 gbgss283.seq
250001048 gbgss284.seq
250000242 gbgss285.seq
250002227 gbgss286.seq
250001922 gbgss287.seq
250001614 gbgss288.seq
250001498 gbgss289.seq
230689340 gbgss29.seq
60438546 gbgss290.seq
230689286 gbgss3.seq
230687533 gbgss30.seq
230688932 gbgss31.seq
230689492 gbgss32.seq
230689759 gbgss33.seq
230689716 gbgss34.seq
230689209 gbgss35.seq
230689522 gbgss36.seq
230689286 gbgss37.seq
230688422 gbgss38.seq
230690318 gbgss39.seq
230688064 gbgss4.seq
230689168 gbgss40.seq
230688008 gbgss41.seq
230688857 gbgss42.seq
230688640 gbgss43.seq
230689137 gbgss44.seq
230690180 gbgss45.seq
230689493 gbgss46.seq
230689696 gbgss47.seq
230687868 gbgss48.seq
230688869 gbgss49.seq
230688342 gbgss5.seq
230687880 gbgss50.seq
230689390 gbgss51.seq
230689605 gbgss52.seq
230689539 gbgss53.seq
230689182 gbgss54.seq
230687469 gbgss55.seq
230687758 gbgss56.seq
230687893 gbgss57.seq
230689383 gbgss58.seq
230689447 gbgss59.seq
230689182 gbgss6.seq
230687800 gbgss60.seq
229072014 gbgss61.seq
230688250 gbgss62.seq
230688760 gbgss63.seq
230688705 gbgss64.seq
230689648 gbgss65.seq
230688781 gbgss66.seq
230689584 gbgss67.seq
230689519 gbgss68.seq
230687509 gbgss69.seq
230687458 gbgss7.seq
230689198 gbgss70.seq
230688722 gbgss71.seq
230689543 gbgss72.seq
230688892 gbgss73.seq
230689214 gbgss74.seq
230688801 gbgss75.seq
230688974 gbgss76.seq
230689901 gbgss77.seq
230689589 gbgss78.seq
230689227 gbgss79.seq
230690430 gbgss8.seq
230687441 gbgss80.seq
224564448 gbgss81.seq
194176901 gbgss82.seq
194286413 gbgss83.seq
230688198 gbgss84.seq
230687908 gbgss85.seq
230687613 gbgss86.seq
230688523 gbgss87.seq
230689693 gbgss88.seq
230689537 gbgss89.seq
230689298 gbgss9.seq
230690147 gbgss90.seq
230687643 gbgss91.seq
230690390 gbgss92.seq
230688637 gbgss93.seq
230688008 gbgss94.seq
230691062 gbgss95.seq
230687491 gbgss96.seq
230690256 gbgss97.seq
230687710 gbgss98.seq
230688622 gbgss99.seq
250005012 gbhtc1.seq
250001397 gbhtc10.seq
250000041 gbhtc11.seq
250001029 gbhtc12.seq
30905579 gbhtc13.seq
250016613 gbhtc2.seq
250005703 gbhtc3.seq
250002241 gbhtc4.seq
250012414 gbhtc5.seq
250007004 gbhtc6.seq
250002603 gbhtc7.seq
250001168 gbhtc8.seq
250000386 gbhtc9.seq
250095790 gbhtg1.seq
250059677 gbhtg10.seq
250109659 gbhtg100.seq
250164109 gbhtg101.seq
250209568 gbhtg102.seq
250162900 gbhtg103.seq
250196175 gbhtg104.seq
250043014 gbhtg105.seq
250117734 gbhtg106.seq
250133743 gbhtg107.seq
250117007 gbhtg108.seq
250218872 gbhtg109.seq
250041995 gbhtg11.seq
250170619 gbhtg110.seq
250049647 gbhtg111.seq
250044227 gbhtg112.seq
250063179 gbhtg113.seq
250025059 gbhtg114.seq
250129173 gbhtg115.seq
250189666 gbhtg116.seq
70432799 gbhtg117.seq
250314168 gbhtg12.seq
250259211 gbhtg13.seq
250032869 gbhtg14.seq
250130173 gbhtg15.seq
250073391 gbhtg16.seq
250176118 gbhtg17.seq
250090631 gbhtg18.seq
250144331 gbhtg19.seq
250020825 gbhtg2.seq
250179508 gbhtg20.seq
250079452 gbhtg21.seq
250030788 gbhtg22.seq
250231671 gbhtg23.seq
250255350 gbhtg24.seq
250093455 gbhtg25.seq
250291230 gbhtg26.seq
250254655 gbhtg27.seq
250244694 gbhtg28.seq
250048863 gbhtg29.seq
250039054 gbhtg3.seq
250013140 gbhtg30.seq
250112551 gbhtg31.seq
250171750 gbhtg32.seq
250088822 gbhtg33.seq
250077254 gbhtg34.seq
250169826 gbhtg35.seq
250233081 gbhtg36.seq
250268159 gbhtg37.seq
250261998 gbhtg38.seq
250252098 gbhtg39.seq
250101899 gbhtg4.seq
250056382 gbhtg40.seq
250060052 gbhtg41.seq
250290167 gbhtg42.seq
250071541 gbhtg43.seq
250027340 gbhtg44.seq
250022885 gbhtg45.seq
250104522 gbhtg46.seq
250182886 gbhtg47.seq
250048452 gbhtg48.seq
250051389 gbhtg49.seq
250209196 gbhtg5.seq
250220576 gbhtg50.seq
250197700 gbhtg51.seq
250132920 gbhtg52.seq
250269043 gbhtg53.seq
250085992 gbhtg54.seq
250105313 gbhtg55.seq
250020769 gbhtg56.seq
250051020 gbhtg57.seq
250201746 gbhtg58.seq
250220279 gbhtg59.seq
250053315 gbhtg6.seq
250133537 gbhtg60.seq
250007131 gbhtg61.seq
250121792 gbhtg62.seq
250007443 gbhtg63.seq
250166157 gbhtg64.seq
250005637 gbhtg65.seq
250106644 gbhtg66.seq
250156698 gbhtg67.seq
250149382 gbhtg68.seq
250254925 gbhtg69.seq
250004174 gbhtg7.seq
250039751 gbhtg70.seq
250079246 gbhtg71.seq
250059412 gbhtg72.seq
250210461 gbhtg73.seq
250154799 gbhtg74.seq
250009651 gbhtg75.seq
250052850 gbhtg76.seq
250211753 gbhtg77.seq
250120482 gbhtg78.seq
250078736 gbhtg79.seq
250124022 gbhtg8.seq
250051177 gbhtg80.seq
250196050 gbhtg81.seq
250071991 gbhtg82.seq
250003103 gbhtg83.seq
250096397 gbhtg84.seq
250185016 gbhtg85.seq
250107299 gbhtg86.seq
250076244 gbhtg87.seq
250268861 gbhtg88.seq
250251837 gbhtg89.seq
250009869 gbhtg9.seq
250099407 gbhtg90.seq
250079514 gbhtg91.seq
250204124 gbhtg92.seq
250045857 gbhtg93.seq
250118694 gbhtg94.seq
250060670 gbhtg95.seq
250043102 gbhtg96.seq
250148811 gbhtg97.seq
250061042 gbhtg98.seq
250169943 gbhtg99.seq
250170619 gbinv1.seq
250001028 gbinv10.seq
250003619 gbinv11.seq
211244218 gbinv12.seq
250131830 gbinv2.seq
263893072 gbinv3.seq
250000214 gbinv4.seq
250133157 gbinv5.seq
250001303 gbinv6.seq
250005776 gbinv7.seq
250269871 gbinv8.seq
250000262 gbinv9.seq
150654176 gbjou1.idx
142492121 gbjou2.idx
222042921 gbjou3.idx
283669338 gbjou4.idx
133597532 gbjou5.idx
185197400 gbkey1.idx
222763828 gbkey2.idx
60864345 gbkey3.idx
250103154 gbmam1.seq
250002985 gbmam2.seq
250001857 gbmam3.seq
121931647 gbmam4.seq
54719110 gbnew.txt
250000443 gbpat1.seq
250001150 gbpat10.seq
250000356 gbpat11.seq
250001775 gbpat12.seq
250000695 gbpat13.seq
250000499 gbpat14.seq
250001400 gbpat15.seq
250001580 gbpat16.seq
250002041 gbpat17.seq
250000090 gbpat18.seq
250000336 gbpat19.seq
250000202 gbpat2.seq
250002304 gbpat20.seq
250000891 gbpat21.seq
250170059 gbpat22.seq
250000005 gbpat23.seq
250000069 gbpat24.seq
250004493 gbpat25.seq
250054314 gbpat26.seq
250007011 gbpat27.seq
250001351 gbpat28.seq
250013657 gbpat29.seq
250003351 gbpat3.seq
250001521 gbpat30.seq
250000815 gbpat31.seq
250001275 gbpat32.seq
250001076 gbpat33.seq
250000341 gbpat34.seq
250000257 gbpat35.seq
250022716 gbpat36.seq
250000247 gbpat37.seq
250000740 gbpat38.seq
250003426 gbpat39.seq
250002404 gbpat4.seq
250026053 gbpat40.seq
250000262 gbpat41.seq
155677079 gbpat42.seq
250000082 gbpat5.seq
250000132 gbpat6.seq
250001767 gbpat7.seq
250003072 gbpat8.seq
250000020 gbpat9.seq
70136575 gbphg.seq
250068711 gbpln1.seq
250002783 gbpln10.seq
250010266 gbpln11.seq
250008371 gbpln12.seq
250022637 gbpln13.seq
250139936 gbpln14.seq
250208877 gbpln15.seq
288520840 gbpln16.seq
256537862 gbpln17.seq
250174499 gbpln18.seq
250002646 gbpln19.seq
250067847 gbpln2.seq
250000925 gbpln20.seq
250000520 gbpln21.seq
252043455 gbpln22.seq
257604226 gbpln23.seq
250001275 gbpln24.seq
250002461 gbpln25.seq
250002110 gbpln26.seq
250000207 gbpln27.seq
250002413 gbpln28.seq
213850097 gbpln29.seq
250154084 gbpln3.seq
250112047 gbpln4.seq
250000775 gbpln5.seq
250000445 gbpln6.seq
250000139 gbpln7.seq
250003551 gbpln8.seq
250162033 gbpln9.seq
250125096 gbpri1.seq
250155727 gbpri10.seq
250097814 gbpri11.seq
250020417 gbpri12.seq
250173548 gbpri13.seq
250047561 gbpri14.seq
250014728 gbpri15.seq
250080593 gbpri16.seq
250130808 gbpri17.seq
250186927 gbpri18.seq
250001352 gbpri19.seq
250112557 gbpri2.seq
250000918 gbpri20.seq
250004126 gbpri21.seq
250034091 gbpri22.seq
250109527 gbpri23.seq
250038448 gbpri24.seq
250031079 gbpri25.seq
250041990 gbpri26.seq
250003712 gbpri27.seq
250041835 gbpri28.seq
250000404 gbpri29.seq
250150511 gbpri3.seq
250006918 gbpri30.seq
250003908 gbpri31.seq
250098854 gbpri32.seq
250002029 gbpri33.seq
250002795 gbpri34.seq
250159458 gbpri35.seq
27470888 gbpri36.seq
250197367 gbpri4.seq
250018852 gbpri5.seq
250186659 gbpri6.seq
250066610 gbpri7.seq
250118502 gbpri8.seq
250159568 gbpri9.seq
295928 gbrel.txt
250173244 gbrod1.seq
250161035 gbrod10.seq
250259647 gbrod11.seq
250124387 gbrod12.seq
250126193 gbrod13.seq
250190987 gbrod14.seq
250013857 gbrod15.seq
250059630 gbrod16.seq
250028330 gbrod17.seq
250135427 gbrod18.seq
250028805 gbrod19.seq
250034745 gbrod2.seq
250140350 gbrod20.seq
250001369 gbrod21.seq
250006534 gbrod22.seq
250127013 gbrod23.seq
250001416 gbrod24.seq
250001452 gbrod25.seq
151333905 gbrod26.seq
250217806 gbrod3.seq
250087683 gbrod4.seq
250121636 gbrod5.seq
250203557 gbrod6.seq
250282886 gbrod7.seq
250023378 gbrod8.seq
250213254 gbrod9.seq
1374034056 gbsdr1.txt
4253472315 gbsdr2.txt
1836320299 gbsdr3.txt
109542786 gbsec.idx
250002011 gbsts1.seq
250002347 gbsts10.seq
250000919 gbsts11.seq
250001518 gbsts12.seq
250002657 gbsts13.seq
228943686 gbsts14.seq
250002002 gbsts2.seq
250002125 gbsts3.seq
250002390 gbsts4.seq
250004546 gbsts5.seq
250003582 gbsts6.seq
250002767 gbsts7.seq
250001975 gbsts8.seq
250001446 gbsts9.seq
250001206 gbsyn1.seq
133439459 gbsyn2.seq
1069519 gbtsa.seq
422714 gbuna.seq
250001165 gbvrl1.seq
250002011 gbvrl2.seq
250001531 gbvrl3.seq
250002571 gbvrl4.seq
250001885 gbvrl5.seq
250000809 gbvrl6.seq
250000934 gbvrl7.seq
250002351 gbvrl8.seq
155318719 gbvrl9.seq
250215878 gbvrt1.seq
250087533 gbvrt10.seq
250065387 gbvrt11.seq
250092731 gbvrt12.seq
250000494 gbvrt13.seq
250000851 gbvrt14.seq
247206657 gbvrt15.seq
250000014 gbvrt2.seq
250055176 gbvrt3.seq
250002163 gbvrt4.seq
250005048 gbvrt5.seq
250069479 gbvrt6.seq
250061204 gbvrt7.seq
250187878 gbvrt8.seq
250149940 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 35528 100140537
BCT10 27966 105110236
BCT11 185 97209018
BCT12 85 111538705
BCT13 46 112988402
BCT14 54 114935705
BCT15 58 118953436
BCT16 66 116786530
BCT17 50 114367438
BCT18 45 112962480
BCT19 59 110366070
BCT2 3423 110264120
BCT20 73 113929811
BCT21 51 110444477
BCT22 65 113408951
BCT23 57 113456085
BCT24 54 115356157
BCT25 67 111574753
BCT26 237 107045331
BCT27 51939 91822342
BCT28 75869 80106453
BCT29 46943 90514449
BCT3 159 115987743
BCT4 22462 103652144
BCT5 54641 86800663
BCT6 5649 95824395
BCT7 14503 96474632
BCT8 4334 116099084
BCT9 41791 99316208
ENV1 91164 71495908
ENV2 95328 69640626
ENV3 83790 81749064
ENV4 89648 86303114
ENV5 113380 53051166
ENV6 124539 38264840
ENV7 90065 75853114
ENV8 87108 87326934
ENV9 24874 18545955
EST1 68126 26289737
EST10 76524 29834102
EST100 76440 39399400
EST101 71371 40690027
EST102 73786 32048292
EST103 74864 41778418
EST104 70315 34076786
EST105 76916 49981770
EST106 64824 34036974
EST107 71768 36987340
EST108 73299 43669619
EST109 72494 42729257
EST11 75175 28789994
EST110 70097 42172896
EST111 73533 41158575
EST112 69239 29938680
EST113 69732 32869664
EST114 64546 35182288
EST115 69061 39441745
EST116 70482 45960972
EST117 75853 34072426
EST118 74003 29363349
EST119 75490 25722987
EST12 77544 30745348
EST120 73355 35314499
EST121 63883 34873844
EST122 78142 42874930
EST123 79138 44698550
EST124 72494 47028594
EST125 68396 42141133
EST126 71965 48677832
EST127 69124 44293878
EST128 72631 45383497
EST129 74687 42789345
EST13 76983 29267069
EST130 73374 47332946
EST131 74066 49585579
EST132 72024 45949972
EST133 78687 41874292
EST134 74471 24136283
EST135 80870 44862974
EST136 76333 43559141
EST137 72838 43804570
EST138 64881 31493761
EST139 69200 39082258
EST14 78695 31917937
EST140 66830 36397522
EST141 67969 39465687
EST142 71100 41664173
EST143 72383 46910996
EST144 67140 39416782
EST145 72308 40674907
EST146 69008 40302555
EST147 60005 37007291
EST148 89724 48524555
EST149 101026 57678121
EST15 74572 31521278
EST150 70630 36388688
EST151 104399 55156988
EST152 115219 62989555
EST153 102149 56277252
EST154 78060 47113007
EST155 98704 57678296
EST156 104027 62347422
EST157 95752 58243654
EST158 81998 45097211
EST159 69288 39187914
EST16 75828 33339690
EST160 66193 31056934
EST161 61363 27884016
EST162 56684 27416586
EST163 65077 31432067
EST164 55362 27884468
EST165 76432 48310439
EST166 67639 40661031
EST167 71251 50994753
EST168 74910 42892366
EST169 59419 30189260
EST17 82145 33891102
EST170 63699 33910071
EST171 65500 37000193
EST172 63942 45456573
EST173 62719 35938976
EST174 104946 47276015
EST175 85434 50488299
EST176 103835 59406410
EST177 106290 59805020
EST178 97215 52193342
EST179 83493 39436108
EST18 80729 32281770
EST180 96018 42907833
EST181 98099 49808251
EST182 93434 37214158
EST183 92873 43501330
EST184 63942 45354534
EST185 69917 36024355
EST186 57964 33552140
EST187 70593 45037646
EST188 72564 27355639
EST189 76270 42535050
EST19 78591 31758130
EST190 72697 38392899
EST191 69351 35403092
EST192 68443 37805487
EST193 69763 52091219
EST194 67203 40504899
EST195 68973 34834198
EST196 68852 50479514
EST197 68380 48341213
EST198 72513 37598193
EST199 67715 44055553
EST2 74644 28644020
EST20 74641 30713555
EST200 70402 59259756
EST201 63866 47164884
EST202 63409 46665095
EST203 63663 46175796
EST204 64989 45728279
EST205 66943 51038673
EST206 61988 39503491
EST207 61984 36920829
EST208 66129 37906688
EST209 65667 35900926
EST21 73928 34320975
EST210 89690 51949696
EST211 75407 51319998
EST212 84132 49872198
EST213 112596 69666640
EST214 115415 68702905
EST215 103880 61956544
EST216 98289 64077893
EST217 117764 57302681
EST218 98787 53521762
EST219 91482 50627279
EST22 75015 30060911
EST220 96222 43892466
EST221 82943 48782197
EST222 69984 42332835
EST223 66891 50097732
EST224 68391 58723818
EST225 74174 53380083
EST226 77766 40326005
EST227 79056 49158009
EST228 72608 52084395
EST229 71112 49536332
EST23 77374 32694695
EST230 27697 10328446
EST231 28033 10628781
EST232 27338 10158258
EST233 26836 9717453
EST234 26872 9154430
EST235 27696 10117367
EST236 27406 9840023
EST237 27446 9953510
EST238 27439 11171737
EST239 27360 11837118
EST24 74777 32836423
EST240 27428 10984584
EST241 27649 9801407
EST242 27627 8947237
EST243 27352 10542542
EST244 28122 11148741
EST245 27779 11058024
EST246 26883 11550440
EST247 26983 12226868
EST248 27338 10726578
EST249 27211 11223235
EST25 74038 31909090
EST250 27247 12032617
EST251 27428 11493816
EST252 27487 10818814
EST253 27464 11010115
EST254 27309 10389675
EST255 26459 14326143
EST256 25028 17085735
EST257 26065 17745374
EST258 89962 37155073
EST259 55351 34817488
EST26 75219 31054388
EST260 97499 38847270
EST261 77170 39771981
EST262 68739 44223464
EST263 69201 44942475
EST264 69054 44425334
EST265 64135 39562122
EST266 79934 44442423
EST267 62208 43451976
EST268 68574 41920553
EST269 62363 31385806
EST27 74389 32419462
EST270 102246 47715995
EST271 83650 44648233
EST272 71971 37892427
EST273 65701 31533704
EST274 66799 40268351
EST275 71000 34675113
EST276 71610 33713251
EST277 73494 45720922
EST278 68234 37740046
EST279 66260 39298498
EST28 108020 51114577
EST280 74278 35694737
EST281 83700 45654172
EST282 74088 48340807
EST283 78153 53981338
EST284 97230 50440056
EST285 96583 45508686
EST286 77038 42967211
EST287 69636 46726005
EST288 75286 33838287
EST289 70301 31580788
EST29 97097 45908239
EST290 71483 34354512
EST291 66506 40198064
EST292 58969 37288500
EST293 70263 41217880
EST294 66242 43495667
EST295 60940 36239830
EST296 85606 44162789
EST297 80960 40750547
EST298 69655 43986059
EST299 101455 57653134
EST3 73730 29915842
EST30 98627 53907197
EST300 119439 48519511
EST301 88846 40364069
EST302 64583 35254069
EST303 70549 43080848
EST304 83602 43854683
EST305 71120 40482920
EST306 69193 43230931
EST307 68641 37511049
EST308 63129 37317295
EST309 48011 25932765
EST31 86665 50498937
EST310 72974 52928112
EST311 71635 40657425
EST312 72330 45435596
EST313 62345 34208885
EST314 70346 35724755
EST315 56076 28178086
EST316 55200 28428396
EST317 54932 29254489
EST318 53796 28629635
EST319 55237 28809294
EST32 67564 43098004
EST320 58087 24833078
EST321 57663 24510175
EST322 56477 23135892
EST323 57675 22276555
EST324 57187 22951802
EST325 58303 23200897
EST326 57220 22210348
EST327 58381 20753646
EST328 67098 38873818
EST329 78727 35430668
EST33 71441 56992725
EST330 76646 32871670
EST331 78448 33389002
EST332 82802 40942351
EST333 81574 56330299
EST334 54634 42867923
EST335 96671 58118924
EST336 96773 58461720
EST337 101973 59946488
EST338 105850 57418606
EST339 86407 48415294
EST34 85196 48655083
EST340 73493 40332192
EST341 76135 40296989
EST342 66459 54241352
EST343 63786 48595930
EST344 61015 43095163
EST345 60457 31730898
EST346 73433 49728723
EST347 56174 34049601
EST348 50905 25464771
EST349 66816 36056924
EST35 86590 43576184
EST350 65337 34668204
EST351 62282 30514908
EST352 63423 40999397
EST353 80422 44537095
EST354 72222 40390178
EST355 68150 40936441
EST356 71240 40733594
EST357 62613 43210433
EST358 82574 47521430
EST359 84599 49713237
EST36 92195 50038393
EST360 82433 45180060
EST361 63809 34994473
EST362 67161 37849609
EST363 73552 40005798
EST364 47721 24112754
EST365 62220 35566080
EST366 71440 41227808
EST367 93504 46983341
EST368 78190 41593674
EST369 72915 49260404
EST37 87016 60750353
EST370 68766 46596808
EST371 65540 37130580
EST372 67333 35026484
EST373 86661 39048154
EST374 60279 38789742
EST375 53839 38818762
EST376 64506 35715415
EST377 84680 51949774
EST378 92678 51801000
EST379 65474 38579610
EST38 76210 51411773
EST380 78580 43311002
EST381 58034 37621793
EST382 43250 22021050
EST383 56621 34906090
EST384 84129 46083611
EST385 77908 45965490
EST386 71298 44070324
EST387 80445 47267477
EST388 76786 49109527
EST389 86420 60086854
EST39 93946 55055077
EST390 78137 70236280
EST391 82476 51845338
EST392 89675 57572064
EST393 71418 58780243
EST394 72365 44997812
EST395 62843 40803465
EST396 68004 38668913
EST397 62571 36749259
EST398 66505 32280664
EST399 79608 25627318
EST4 74560 28391053
EST40 63732 49333851
EST400 74098 40417710
EST401 67583 39752543
EST402 64947 32589764
EST403 74430 46097125
EST404 71545 47453033
EST405 65900 41128100
EST406 68561 43262897
EST407 61371 34107651
EST408 69681 42265137
EST409 73776 46308044
EST41 78309 49478902
EST410 81058 48866858
EST411 84275 47753289
EST412 61513 39698130
EST413 56418 41314188
EST414 57424 40462315
EST415 60442 40664174
EST416 77629 47868287
EST417 54267 31962096
EST418 55592 36360926
EST419 63494 40428815
EST42 98996 50888599
EST420 58510 41571597
EST421 60594 42073558
EST422 48701 34279064
EST423 72949 43001461
EST424 82224 39250789
EST425 70568 38817305
EST426 70616 38764894
EST427 70485 39246876
EST428 70515 38861961
EST429 70354 39288892
EST43 89485 45225822
EST430 70011 38847075
EST431 69807 38873188
EST432 69728 39536590
EST433 69799 38964069
EST434 67909 38489651
EST435 70024 38372786
EST436 70267 39737142
EST437 70285 39022817
EST438 70238 38229772
EST439 70698 38693366
EST44 91507 47043367
EST440 70616 38876732
EST441 70520 38797729
EST442 70836 38294021
EST443 75430 40180462
EST444 92475 52526446
EST445 82548 36724713
EST446 103324 59392339
EST447 82779 46427194
EST448 75410 47533424
EST449 83332 48889903
EST45 107200 49750598
EST450 88403 52229103
EST451 97170 60465300
EST452 83093 49289626
EST453 90659 49931713
EST454 87848 48451864
EST455 76909 57667061
EST456 72385 49860042
EST457 94094 64058125
EST458 96630 66230034
EST459 102505 62346651
EST46 86163 32449899
EST460 116109 46263998
EST461 56502 40508331
EST462 51377 40457230
EST463 76949 45247492
EST464 57361 34769390
EST465 79723 46831110
EST466 116763 58894899
EST467 73881 45171816
EST468 80858 58334664
EST469 45022 24920280
EST47 70290 18728260
EST470 48160 49488469
EST471 46428 58827618
EST472 77071 55526227
EST473 63545 35852851
EST474 72423 41816798
EST475 70165 42389400
EST476 70992 43590869
EST477 61411 51481731
EST478 80917 44338869
EST479 109118 47982253
EST48 73201 19860510
EST480 83198 53308490
EST481 61991 40162679
EST482 56835 41052422
EST483 56726 38109198
EST484 66102 49005055
EST485 64779 45232010
EST486 61630 44651870
EST487 52053 37839016
EST488 53060 38268857
EST489 59266 42345587
EST49 57016 17447555
EST490 64526 36578143
EST491 69281 44530566
EST492 57209 37950486
EST493 57326 40472494
EST494 62408 46491971
EST495 63037 47540097
EST496 66847 44024117
EST497 50377 40190262
EST498 57878 38631708
EST499 53156 35382291
EST5 48193 15292129
EST50 44286 12060587
EST500 58383 39448929
EST501 61340 37909024
EST502 70724 44766436
EST503 70985 59723539
EST504 70405 49823316
EST505 69751 51883257
EST506 46553 57560574
EST507 57917 50237326
EST508 66687 44402081
EST509 65473 40558306
EST51 43743 12125030
EST510 77415 46565609
EST511 82495 53683057
EST512 81995 51357346
EST513 66960 40643168
EST514 65241 39760471
EST515 72625 50803405
EST516 81217 48982156
EST517 76838 62393308
EST518 68982 47880092
EST519 69743 46828544
EST52 43729 11473036
EST520 71258 50852083
EST521 60637 47201504
EST522 62983 45131661
EST523 86475 46942263
EST524 78118 39715816
EST525 114428 45416508
EST526 104001 51673442
EST527 71826 51742951
EST528 50443 49550464
EST529 72261 40097493
EST53 89738 38175028
EST530 99688 11076708
EST531 99770 10941126
EST532 96401 32696344
EST533 86559 32196228
EST534 86988 31697220
EST535 73285 47859936
EST536 70347 58598461
EST537 89493 54153092
EST538 80101 44325797
EST539 67753 45770367
EST54 95781 39826683
EST540 71014 45677570
EST541 80185 53285369
EST542 82417 50304412
EST543 76166 53453413
EST544 64158 47134002
EST545 75529 55809145
EST546 88180 49616621
EST547 82348 45315422
EST548 82435 44311208
EST549 81541 41491850
EST55 96126 43690735
EST550 83575 47132054
EST551 76345 52042205
EST552 72490 55108811
EST553 76105 50157082
EST554 89309 44762980
EST555 101885 48043187
EST556 110504 49175472
EST557 126392 52900018
EST558 132459 57863727
EST559 79356 53843332
EST56 93640 48211721
EST560 80051 48304329
EST561 83473 18897537
EST562 84289 8747465
EST563 110537 55639685
EST564 110821 52202364
EST565 66773 44667869
EST566 70114 40944855
EST567 71782 49791098
EST568 74973 45163734
EST569 73778 45362670
EST57 88268 40880483
EST570 71950 47218247
EST571 70602 53361008
EST572 95470 54848384
EST573 94813 48524696
EST574 66052 37204634
EST575 62943 45211477
EST576 87657 55537615
EST577 95988 56562702
EST578 75501 43790304
EST579 80032 36116705
EST58 112344 59424239
EST580 98546 10506856
EST581 98558 10485479
EST582 96811 17365111
EST583 69554 45201057
EST584 93471 46403153
EST585 76241 49527499
EST586 77199 52889744
EST587 86177 54519704
EST588 85735 55531050
EST589 84534 56094778
EST59 95011 45670975
EST590 81020 45214481
EST591 82852 48680935
EST592 72587 47789921
EST593 65805 45292160
EST594 61689 36786826
EST595 108704 33574986
EST596 55421 37762952
EST597 51329 31963612
EST598 51119 34172791
EST599 60050 41538577
EST6 54905 17436890
EST60 74341 31287912
EST600 72607 46721409
EST601 64819 48049537
EST602 109732 20268957
EST603 118216 14547589
EST604 122588 11130812
EST605 122476 11301148
EST606 107656 20947275
EST607 65396 47495197
EST608 64053 49174104
EST609 80562 52643495
EST61 68934 30646031
EST610 75734 49599077
EST611 67983 47903530
EST612 77645 44808019
EST613 63613 42947329
EST614 71547 39326926
EST615 121454 18478790
EST616 127175 11862038
EST617 80157 36745149
EST618 75052 48109502
EST619 68599 50797974
EST62 70572 30637771
EST620 95116 47525369
EST621 87674 55599620
EST622 61034 34437299
EST623 73543 40812480
EST624 72800 61243176
EST625 84723 48080360
EST626 107718 50536055
EST627 72269 49833352
EST628 61215 48439083
EST629 68783 55963153
EST63 73418 30979078
EST630 74791 36236941
EST631 87143 52707707
EST632 89021 52642594
EST633 83674 37391079
EST634 71331 47371587
EST635 71819 49993207
EST636 81125 51844531
EST637 78576 29855792
EST638 76962 25892877
EST639 77587 25463855
EST64 82156 32493116
EST640 74867 30141678
EST641 77148 25597661
EST642 75784 30623834
EST643 76482 28721441
EST644 75561 28252519
EST645 76445 28538156
EST646 76557 29443020
EST647 76225 30774377
EST648 80231 44864951
EST649 82303 60248157
EST65 72250 28177540
EST650 81957 59797288
EST651 81406 49394040
EST652 63139 33419502
EST653 64476 42074645
EST654 75807 43697584
EST655 41108 33333012
EST656 58335 42607376
EST657 58324 45888236
EST658 62745 45818294
EST659 75399 41749486
EST66 64147 28114269
EST660 68060 37150292
EST661 83281 54039221
EST662 83781 43008657
EST663 66486 41322578
EST664 70534 47481894
EST665 79298 47346955
EST666 69529 35838120
EST667 68951 47265375
EST668 77284 51717477
EST669 58275 40437219
EST67 72571 31523498
EST670 70131 50746621
EST671 72374 52313435
EST672 74276 46314003
EST673 68555 48735265
EST674 71344 54022758
EST675 81513 69977950
EST676 82256 69052498
EST677 79162 61534847
EST678 77335 39024160
EST679 71285 32327847
EST68 74773 35463116
EST680 54329 32121118
EST681 67160 47669891
EST682 63610 40473564
EST683 66281 48880593
EST684 67733 45122567
EST685 58597 39148006
EST686 54996 37887178
EST687 63943 42724683
EST688 69023 44338325
EST689 65471 44755755
EST69 73733 32286580
EST690 65788 46167255
EST691 66125 44991668
EST692 69382 44884072
EST693 68510 58164286
EST694 65444 39360906
EST695 68765 41657275
EST696 66394 44471741
EST697 57511 38579776
EST698 68351 39885270
EST699 62012 37823489
EST7 74531 29353408
EST70 75482 27018799
EST700 67886 42585699
EST701 88924 52474768
EST702 101575 50316061
EST703 67652 39977004
EST704 54816 26852149
EST705 51079 32521379
EST706 54792 34946097
EST707 58445 40674154
EST708 58285 38278327
EST709 61321 37827696
EST71 78956 30941688
EST710 65202 41803085
EST711 55981 35031048
EST712 52492 32839410
EST713 67082 40863184
EST714 83179 42470378
EST715 80885 44322164
EST716 73816 28651838
EST717 79169 38475539
EST718 78223 47578548
EST719 84515 50949827
EST72 72300 31265997
EST720 74087 47621756
EST721 84169 46651693
EST722 57431 38402392
EST723 57746 37652715
EST724 61238 42032524
EST725 59726 39209795
EST726 59872 38841607
EST727 62659 41181208
EST728 80767 43556469
EST729 82675 44321607
EST73 40893 11632955
EST730 76976 46051303
EST731 69829 41367159
EST732 70036 24830627
EST733 73420 27653003
EST734 73678 26128102
EST735 79700 27017751
EST736 73571 26834078
EST737 68558 29381305
EST738 36437 12422758
EST74 40854 11671342
EST75 41013 12838123
EST76 41248 12456355
EST77 41277 12834954
EST78 41212 13021692
EST79 41079 12426908
EST8 75810 30584478
EST80 40712 12471132
EST81 40822 12529156
EST82 41849 12202556
EST83 41567 12877719
EST84 41477 13033449
EST85 41449 13348494
EST86 45114 12185991
EST87 45940 25472944
EST88 42864 23002473
EST89 45895 18867726
EST9 77564 29870549
EST90 50442 23060523
EST91 52187 21685487
EST92 64685 36828277
EST93 85724 43181940
EST94 75029 31269926
EST95 73985 29176349
EST96 72739 32438341
EST97 77503 46923934
EST98 76108 40661717
EST99 76791 39329897
GSS1 90430 38662943
GSS10 74787 43607320
GSS100 80625 51412757
GSS101 74529 42755867
GSS102 73373 45684621
GSS103 73714 44825146
GSS104 73230 45734767
GSS105 73262 44830525
GSS106 75263 45727363
GSS107 81431 54691312
GSS108 83868 55510710
GSS109 81045 52307512
GSS11 70802 35983221
GSS110 82200 50445579
GSS111 84242 58189720
GSS112 79855 59031496
GSS113 91243 46350557
GSS114 89931 53560767
GSS115 73592 50015461
GSS116 89786 65410603
GSS117 82175 58723619
GSS118 75870 42429548
GSS119 81837 50481912
GSS12 73150 38495437
GSS120 94953 53355311
GSS121 84420 55566909
GSS122 84916 54821741
GSS123 81890 55711804
GSS124 76056 69621612
GSS125 76821 66077756
GSS126 78847 55619022
GSS127 72480 50149808
GSS128 72482 50134404
GSS129 73143 49021920
GSS13 76795 38906116
GSS130 72128 50787366
GSS131 74446 50626685
GSS132 84090 59845866
GSS133 80772 58329954
GSS134 68665 56199301
GSS135 71858 55680873
GSS136 75828 67956101
GSS137 75882 61939396
GSS138 77003 52532600
GSS139 86870 53819595
GSS14 71379 32114760
GSS140 94775 57966448
GSS141 92648 59924495
GSS142 82277 53749863
GSS143 88034 51672874
GSS144 75736 58226163
GSS145 114879 59699217
GSS146 109528 58814661
GSS147 87594 62234762
GSS148 49987 29613675
GSS149 68132 48787425
GSS15 70493 35055254
GSS150 73001 55885502
GSS151 72980 55922450
GSS152 73002 55884958
GSS153 73012 55867933
GSS154 72974 55932651
GSS155 72975 55932446
GSS156 75746 57509811
GSS157 84181 39667849
GSS158 88494 60240145
GSS159 85434 66061520
GSS16 78213 46093569
GSS160 89556 58457865
GSS161 91109 56964521
GSS162 83740 58138514
GSS163 75281 48391404
GSS164 76667 49458580
GSS165 92881 58460964
GSS166 90573 61992638
GSS167 86160 61037355
GSS168 105353 22060115
GSS169 100342 31939300
GSS17 70895 33315071
GSS170 78166 47128460
GSS171 81727 53804496
GSS172 52904 38536250
GSS173 54927 43324036
GSS174 61264 50584908
GSS175 59060 45361614
GSS176 57612 48691988
GSS177 57509 48731646
GSS178 58260 46385895
GSS179 58482 45713177
GSS18 58792 27918452
GSS180 58807 48768100
GSS181 58943 48436583
GSS182 58658 49321655
GSS183 58153 48365825
GSS184 58631 46103127
GSS185 58954 49560291
GSS186 60198 50039939
GSS187 60238 49975241
GSS188 60541 49063397
GSS189 60417 49433593
GSS19 56814 29015258
GSS190 60514 49142121
GSS191 59819 46841340
GSS192 59160 45333303
GSS193 58434 47615834
GSS194 58971 45935894
GSS195 58812 46435486
GSS196 58326 47954433
GSS197 58238 48232483
GSS198 58379 48659558
GSS199 60092 50113368
GSS2 89000 39334171
GSS20 57683 26671178
GSS200 59873 50773448
GSS201 59921 48966431
GSS202 60705 45662626
GSS203 60075 47611186
GSS204 59471 49482221
GSS205 59498 49400041
GSS206 59536 49283070
GSS207 59468 49492752
GSS208 59614 49046087
GSS209 59514 49353526
GSS21 61527 29551920
GSS210 59735 48677959
GSS211 59662 48899490
GSS212 59750 48319518
GSS213 58975 45626639
GSS214 58783 46267596
GSS215 58333 47836420
GSS216 58240 48165585
GSS217 58706 46237174
GSS218 58094 48174438
GSS219 64818 54771499
GSS22 64704 37621344
GSS220 64820 54763123
GSS221 100424 64019609
GSS222 81406 44591955
GSS223 77743 58324124
GSS224 87946 55581731
GSS225 86695 49277831
GSS226 74443 50531198
GSS227 71275 47094596
GSS228 71239 47186122
GSS229 103200 52856422
GSS23 57535 27063987
GSS230 98063 66813135
GSS231 74801 47164725
GSS232 87182 64465152
GSS233 83577 62754047
GSS234 103558 48487000
GSS235 68486 58446619
GSS236 68305 58781573
GSS237 69368 56628300
GSS238 69626 56128071
GSS239 70567 56037763
GSS24 66458 42175333
GSS240 76223 57617106
GSS241 75915 58210646
GSS242 87248 74915094
GSS243 84888 46838325
GSS244 92320 43919149
GSS245 84283 65531790
GSS246 70533 58651808
GSS247 69703 58662601
GSS248 64726 62235402
GSS249 74466 48470500
GSS25 67918 28145143
GSS250 85701 33860083
GSS251 113327 73700908
GSS252 97600 74134474
GSS253 90837 44106448
GSS254 111163 63698762
GSS255 120659 73171829
GSS256 116933 76045198
GSS257 102540 54561431
GSS258 83514 54636157
GSS259 96031 61874804
GSS26 58155 25414254
GSS260 107465 78480107
GSS261 107915 78023792
GSS262 106101 79983638
GSS263 102982 78978267
GSS264 77980 51832067
GSS265 109385 66525234
GSS266 110070 66176077
GSS267 102732 56961489
GSS268 68448 37535952
GSS269 79818 44216559
GSS27 65596 32054593
GSS270 76307 43198346
GSS271 106530 59653418
GSS272 91429 47076246
GSS273 102318 60001038
GSS274 114546 44629880
GSS275 116953 39547048
GSS276 98030 71394920
GSS277 95453 62803556
GSS278 95871 36569261
GSS279 95389 37317829
GSS28 65171 32497374
GSS280 96742 35045950
GSS281 94168 39365333
GSS282 101814 59068144
GSS283 94697 60983894
GSS284 94554 61186822
GSS285 95283 60135107
GSS286 86807 62295024
GSS287 83727 28560312
GSS288 84358 27363337
GSS289 85432 25213220
GSS29 77737 39812956
GSS290 20536 9975775
GSS3 87422 41844005
GSS30 82634 39702934
GSS31 74190 40413538
GSS32 70525 48290302
GSS33 79852 37772820
GSS34 75886 40326877
GSS35 74175 39863155
GSS36 87464 56577344
GSS37 87595 58178309
GSS38 85545 44925829
GSS39 86586 50235704
GSS4 79227 41150659
GSS40 86504 39700345
GSS41 83054 32395138
GSS42 81250 56926804
GSS43 80041 57955797
GSS44 72010 47534288
GSS45 72050 47405536
GSS46 77623 45643371
GSS47 77879 38875725
GSS48 83290 58061973
GSS49 86558 64911459
GSS5 78819 40567994
GSS50 81736 54223535
GSS51 93800 59362797
GSS52 88481 58785262
GSS53 76369 41877727
GSS54 73084 40858704
GSS55 86366 46794230
GSS56 88127 58671741
GSS57 76346 64409162
GSS58 70882 78111853
GSS59 86059 68969246
GSS6 78088 38842501
GSS60 89093 59744839
GSS61 63429 44952744
GSS62 66512 45602333
GSS63 89647 67279502
GSS64 84931 58259323
GSS65 86111 52985075
GSS66 85494 55678504
GSS67 93569 57753022
GSS68 97811 52599140
GSS69 97518 52985728
GSS7 77657 39174963
GSS70 98229 52046549
GSS71 99261 50678111
GSS72 99227 50723941
GSS73 99068 50934874
GSS74 99601 50227676
GSS75 97771 52651416
GSS76 91738 64971993
GSS77 89865 70741279
GSS78 88891 70086550
GSS79 87855 69638410
GSS8 75881 38134490
GSS80 87865 63823866
GSS81 87995 44097694
GSS82 78265 23299838
GSS83 78174 23508729
GSS84 83853 49938801
GSS85 77494 45031925
GSS86 88966 56330462
GSS87 84258 58535087
GSS88 76274 77066915
GSS89 79321 72652315
GSS9 72240 37167492
GSS90 84603 46673379
GSS91 84675 49189908
GSS92 75664 41949479
GSS93 79233 56951998
GSS94 77452 56450988
GSS95 81281 53743322
GSS96 84896 58217148
GSS97 85349 57694314
GSS98 87354 52203026
GSS99 82024 67861903
HTC1 24998 26954535
HTC10 65223 86014610
HTC11 67000 60967078
HTC12 69474 70287785
HTC13 11623 7313801
HTC2 15993 36013431
HTC3 15970 36547861
HTC4 16191 35357336
HTC5 15927 40313070
HTC6 16010 37271080
HTC7 51463 28046115
HTC8 80376 62002116
HTC9 73872 69575684
HTG1 1318 188929277
HTG10 1300 186477873
HTG100 1170 190175935
HTG101 1428 189882293
HTG102 1133 190523744
HTG103 1174 187390096
HTG104 1554 188620972
HTG105 984 193446965
HTG106 754 169026486
HTG107 1084 193942128
HTG108 1113 193094942
HTG109 1017 189876926
HTG11 1452 184100451
HTG110 1096 191838390
HTG111 1082 192379337
HTG112 1167 191822544
HTG113 1121 192092039
HTG114 1311 192097961
HTG115 1243 191967411
HTG116 1210 191102437
HTG117 491 53546392
HTG12 876 192056419
HTG13 750 192437652
HTG14 744 192158023
HTG15 782 192230176
HTG16 803 192009637
HTG17 769 192283132
HTG18 2064 171033537
HTG19 1071 187903257
HTG2 2465 186071856
HTG20 963 189548030
HTG21 784 191909290
HTG22 923 190306412
HTG23 902 190717511
HTG24 811 191592140
HTG25 776 192067539
HTG26 868 191479631
HTG27 889 190824411
HTG28 946 190168578
HTG29 899 191050856
HTG3 2517 185290576
HTG30 927 190341026
HTG31 871 191356884
HTG32 965 189699947
HTG33 884 191153425
HTG34 862 191443956
HTG35 822 191949852
HTG36 946 190207636
HTG37 931 190916264
HTG38 937 190554424
HTG39 1042 189423761
HTG4 2553 188532563
HTG40 1206 186876566
HTG41 1261 188161791
HTG42 1175 188167658
HTG43 1152 187962620
HTG44 1119 191420899
HTG45 1274 190698601
HTG46 1177 191205869
HTG47 1131 191483893
HTG48 1034 191390647
HTG49 980 189582513
HTG5 1284 185715991
HTG50 1122 190242593
HTG51 884 189782197
HTG52 1067 189910784
HTG53 934 189808696
HTG54 1008 190014843
HTG55 985 189552893
HTG56 998 189350064
HTG57 1024 189809957
HTG58 1022 189959387
HTG59 1134 186321722
HTG6 1274 185234665
HTG60 1122 189370609
HTG61 1090 189848651
HTG62 1056 189613142
HTG63 1135 188800358
HTG64 1105 189659714
HTG65 1285 184271916
HTG66 1243 185522113
HTG67 1239 184628766
HTG68 1272 184663203
HTG69 1230 185653227
HTG7 1277 185414872
HTG70 1203 189083717
HTG71 1168 187600001
HTG72 1099 191026837
HTG73 1131 191207725
HTG74 1206 191391913
HTG75 1126 190388683
HTG76 1184 190877322
HTG77 1112 190354598
HTG78 1161 190290123
HTG79 1191 190203946
HTG8 1459 184762119
HTG80 1121 190438766
HTG81 1114 190404365
HTG82 1331 186518117
HTG83 1197 190617322
HTG84 1187 190461665
HTG85 1123 191052488
HTG86 1190 190994835
HTG87 1209 191516203
HTG88 1163 191942257
HTG89 1157 192264100
HTG9 1200 186999351
HTG90 1196 192178498
HTG91 1206 191580918
HTG92 1193 192355211
HTG93 1156 190957446
HTG94 1087 189664641
HTG95 1003 189689682
HTG96 1052 189981610
HTG97 991 189602947
HTG98 1009 189691203
HTG99 1013 189605605
INV1 83544 65927961
INV10 85248 66802620
INV11 83792 67146191
INV12 26975 93831886
INV2 1464 186621591
INV3 774 164256065
INV4 50772 97277492
INV5 70453 81486295
INV6 31473 116162733
INV7 75064 73527682
INV8 67876 80461950
INV9 76667 74049041
MAM1 12215 166541987
MAM2 69389 81350593
MAM3 39215 123599092
MAM4 42249 34598520
PAT1 222610 70141260
PAT10 125437 99518322
PAT11 141739 62608396
PAT12 105795 59941764
PAT13 103555 50226564
PAT14 121472 53274905
PAT15 113046 61292248
PAT16 145018 54899867
PAT17 155517 69893240
PAT18 97490 122598017
PAT19 147594 87373130
PAT2 194518 84655123
PAT20 117407 104542066
PAT21 123717 103465007
PAT22 119286 106149134
PAT23 146235 86276184
PAT24 175261 64171100
PAT25 140514 61008050
PAT26 100420 79560422
PAT27 108697 70803288
PAT28 111347 66582863
PAT29 113599 67362592
PAT3 171984 95898893
PAT30 129236 68268266
PAT31 111310 78154097
PAT32 138113 29117410
PAT33 158492 24106541
PAT34 123461 70471555
PAT35 135780 114780158
PAT36 155702 104303390
PAT37 122512 121936381
PAT38 199012 76788395
PAT39 41134 172766506
PAT4 153750 106059356
PAT40 60612 162513557
PAT41 233110 24708076
PAT42 155628 22199191
PAT5 184018 85619906
PAT6 156356 93378118
PAT7 152402 81705440
PAT8 104672 119401279
PAT9 143543 89226955
PHG 3817 28361165
PLN1 55823 97605162
PLN10 21869 123269190
PLN11 17546 145508414
PLN12 17668 146643657
PLN13 17621 146663790
PLN14 19582 142720833
PLN15 1259 166051294
PLN16 1089 188695099
PLN17 5 168115057
PLN18 86 166971068
PLN19 42922 101712111
PLN2 1484 167314133
PLN20 76588 78092758
PLN21 77614 76552305
PLN22 37963 105007870
PLN23 24816 133149480
PLN24 46292 113207302
PLN25 75916 78298581
PLN26 98597 56233997
PLN27 81860 72226945
PLN28 80666 75289249
PLN29 46978 79507140
PLN3 1603 182757861
PLN4 1988 192354455
PLN5 41929 113092801
PLN6 76499 78438146
PLN7 70775 68181519
PLN8 30650 52981790
PLN9 25190 112791180
PRI1 33102 117753805
PRI10 1455 182691708
PRI11 1278 179187402
PRI12 1453 178017313
PRI13 1589 180139278
PRI14 1603 182108337
PRI15 1272 191877347
PRI16 1138 193893775
PRI17 1101 194429460
PRI18 1205 193697880
PRI19 14803 167638070
PRI2 1639 172621939
PRI20 45904 116385479
PRI21 58804 75636109
PRI22 19609 134368882
PRI23 2549 180280221
PRI24 1951 181535543
PRI25 1785 183789017
PRI26 2080 182002971
PRI27 4905 174182376
PRI28 9527 165350358
PRI29 25626 134570367
PRI3 1307 183697679
PRI30 51175 78618752
PRI31 33057 63285326
PRI32 10347 161382511
PRI33 58447 107929438
PRI34 48624 93581662
PRI35 66575 90026385
PRI36 1441 18064571
PRI4 1347 185401809
PRI5 1196 181284904
PRI6 1186 179051410
PRI7 1233 181111994
PRI8 1322 176524536
PRI9 1241 174683346
ROD1 29317 146227451
ROD10 976 181471200
ROD11 1037 185951637
ROD12 943 183059369
ROD13 1038 189430474
ROD14 952 180526003
ROD15 966 181898075
ROD16 1000 186142363
ROD17 10862 173958340
ROD18 26231 141453413
ROD19 1132 183049705
ROD2 911 174891232
ROD20 1184 184298528
ROD21 14162 163079513
ROD22 38420 70468563
ROD23 19125 117025634
ROD24 2301 188652928
ROD25 153666 19464713
ROD26 42406 48884017
ROD3 913 173659765
ROD4 903 174041355
ROD5 929 174192702
ROD6 983 179516606
ROD7 957 179914723
ROD8 993 182143956
ROD9 1003 182402491
STS1 84839 36527785
STS10 57841 44812491
STS11 57925 43638168
STS12 64607 43005024
STS13 88757 38310027
STS14 80364 35154556
STS2 84165 48236598
STS3 69728 27431057
STS4 78848 37497682
STS5 54788 32164909
STS6 54863 31907576
STS7 54669 32203229
STS8 55701 35698132
STS9 57887 44483446
SYN1 47604 71408271
SYN2 27452 36390375
TSA 180 197242
UNA 211 114018
VRL1 72121 66003005
VRL2 70489 64563624
VRL3 72402 63754193
VRL4 69050 69188045
VRL5 54802 73703886
VRL6 62734 72634591
VRL7 68913 66140955
VRL8 60708 72884713
VRL9 44557 43809974
VRT1 21873 158617767
VRT10 14033 172156072
VRT11 10551 175652629
VRT12 5918 183337660
VRT13 17007 166591382
VRT14 82357 67585912
VRT15 77825 67727216
VRT2 47497 123165010
VRT3 26265 147381208
VRT4 58860 100012345
VRT5 58449 66224636
VRT6 28976 85173177
VRT7 1182 191142340
VRT8 1270 190586739
VRT9 1359 189736364
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 166.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11446685 13030388775 Homo sapiens
7251554 8351004886 Mus musculus
1640821 5988704614 Rattus norvegicus
2084839 5038805938 Bos taurus
3175570 4512823752 Zea mays
1586312 2916171886 Danio rerio
2125319 2895710456 Sus scrofa
1204686 1533066380 Oryza sativa Japonica Group
227972 1352643343 Strongylocentrotus purpuratus
1421599 1143742136 Xenopus tropicalis
212803 993604303 Pan troglodytes
2210226 911282238 Arabidopsis thaliana
777718 910123773 Drosophila melanogaster
650283 904971262 Vitis vinifera
803421 868089071 Gallus gallus
76751 800795203 Macaca mulatta
1223148 704857447 Canis lupus familiaris
1106280 663210675 Triticum aestivum
1011852 660267822 Sorghum bicolor
1177688 634539764 Oryzias latipes
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
April 15 2008
NCBI-GenBank Flat File Release 166.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 166.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
