Release Notes For GenBank Release 167
GBREL.TXT Genetic Sequence Data Bank
August 15 2008
NCBI-GenBank Flat File Release 167.0
Distribution Release Notes
92748599 loci, 95033791652 bases, from 92748599 reported sequences
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at [email protected] or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
Phone: (301) 496-2475
Fax: (301) 480-9241
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 167.0
1.2 Cutoff Date
1.3 Important Changes in Release 167.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.2 Directory Files
3.2.1 Short Directory File
3.3 Index Files
3.3.1 Accession Number Index File
3.3.2 Keyword Phrase Index File
3.3.3 Author Name Index File
3.3.4 Journal Citation Index File
3.3.5 Gene Name Index
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 167.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form. See Section 1.5 below for details.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
E-MAIL: [email protected]
Updates and changes to existing GenBank records:
E-MAIL: [email protected]
URL for GenBank's web-based submission tool (BankIt) :
http://www.ncbi.nlm.nih.gov/BankIt
(see Section 1.5 for additional details about submitting data to GenBank.)
*****************************************************************************
GenBank Release 167.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
A mirror of the GenBank FTP site at the NCBI is available at the University
of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. Other Bio-mirror sites to consider include:
ftp://bio-mirror.jp.apan.net/pub/biomirror/genbank/ (Japan)
ftp://bio-mirror.kr.apan.net/pub/biomirror/genbank/ (Korea)
ftp://bio-mirror.sg.apan.net/biomirrors/genbank/ (Singapore)
1.2 Cutoff Date
This full release, 167.0, incorporates data available to the collaborating
databases as of August 19, 2008 at approximately 1:30am EDT. For more recent
data, users are advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotides' database (see Section 6.4 of this document).
1.3 Important Changes in Release 167.0
1.3.1 Announcements for upcoming changes absent from Release 166.0
An oversight during GenBank Release 166.0 processing resulted in the
exclusion of several announcements for changes that will be implemented
as of GenBank Release 168.0 in October 2008 (see section 1.4, below).
This means that only two months advance notice can be provided for those
changes, rather than the customary four months. Our apologies for this
oversight and any inconvenience that it may cause.
1.3.2 Organizational changes
The total number of sequence data files increased by 58 with this release:
- the BCT division is now comprised of 30 files (+1)
- the CON division is now comprised of 97 files (+6)
- the ENV division is now comprised of 10 files (+1)
- the EST division is now comprised of 762 files (+24)
- the GSS division is now comprised of 306 files (+16)
- the HTG division is now comprised of 120 files (+3)
- the INV division is now comprised of 13 files (+1)
- the PAT division is now comprised of 46 files (+4)
- the PLN division is now comprised of 30 files (+1)
- the VRL division is now comprised of 10 files (+1)
- the VRT division is now comprised of 16 files (+1)
The total number of index files increased by 5 with this release:
- the AUT index is now comprised of 59 files (+5)
1.3.3 Comprehensive protein FASTA file has been discontinued
'Divisional' protein FASTA files :
ftp://ftp.ncbi.nih.gov/ncbi-asn1/gbXXX.fsa_aa.gz
where 'XXX' represents an alphanumeric GenBank division code (such as
pri10) were made available starting with GenBank Release 164.0 . Given
their availability, support for the single, comprehensive protein FASTA
file:
ftp://ftp.ncbi.nih.gov/genbank/relNNN.fsa_aa.gz
(where 'NNN' represents a three-digit GenBank release number) was
discontinued as of GenBank Release 166.0 in June 2008. The size of the
comprehensive file had exceeded 4GB, which was unmanageable for many users.
The final comprehensive protein FASTA file was: rel166.fsa_aa .
1.3.4 Changes in the content of index files
As described in the GB 153 release notes, the 'index' files which accompany
GenBank releases (see Section 3.3) are considered to be a legacy data product by
NCBI, generated mostly for historical reasons. FTP statistics of January 2005
seem to support this: the index files were transferred only half as frequently as
the files of sequence records. The inherent inefficiencies of the index file
format also lead us to suspect that they have little serious use by the user
community, particularly for EST and GSS records.
The software that generated the index file products received little
attention over the years, and finally reached its limitations in
February 2006 (Release 152.0). The required multi-server queries which
obtained and sorted many millions of rows of terms from several different
databases simply outgrew the capacity of the hardware used for GenBank
Release generation.
Our short-term solution is to cease generating some index-file content
for all EST sequence records, and for GSS sequence records that originate
via direct submission to NCBI.
The three gbacc*.idx index files continue to reflect the entirety of the
release, including all EST and GSS records, however the file contents are
unsorted.
These 'solutions' are really just stop-gaps, and we will likely pursue
one of two options:
a) Cease support of the 'index' file products altogether.
b) Provide new products that present some of the most useful data from
the legacy 'index' files, and cease support for other types of index data.
If you are a user of the 'index' files associated with GenBank releases, we
encourage you to make your wishes known, either via the GenBank newsgroup,
or via email to NCBI's Service Desk:
[email protected]
Our apologies for any inconvenience that these changes may cause.
1.3.5 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for
fifty-nine of the GSS flatfiles in Release 167.0. Consider gbgss248.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
August 15 2008
NCBI-GenBank Flat File Release 167.0
GSS Sequences (Part 1)
87184 loci, 64446495 bases, from 87184 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "248" based on the number of files dumped from the other
system. We will work to resolve this discrepancy in future releases, but the
priority is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 Changes related to ncRNA features, /ncRNA_class, and /moltype
The list of allowed values for the /ncRNA_class qualifier, which is
mandatory for all ncRNA features, will be expanded to include:
/ncRNA_class="ribozyme"
Non-coding RNAs which are not yet in the INSDC's controlled vocabulary:
http://www.insdc.org/page.php?page=rna_vocab
previously required /ncRNA_class="other" plus an accompanying /note
qualifer to describes the nature of the ncRNA. This requirement will
be changed, such that *either* a /product or a /note qualifier must
accompany "other" ncRNAs features.
The list of allowed /mol_type qualifiers for the source feature
currently includes:
/mol_type="snoRNA"
/mol_type="snRNA"
/mol_type="scRNA"
/mol_type="tmRNA"
All of these molecule types will be collapsed into a single value:
/mol_type="transcribed RNA"
Sequence records which represent one of these four types of molecules
will thus have:
an ncRNA feature with /ncRNA_class of "snoRNA", "scRNA" or "snRNA"
a source feature with /mol_type of "transcribed RNA"
or
a tmRNA feature
a source feature with /mol_type of "transcribed RNA"
All of these changes will take effect as of Release 169.0 in October 2008.
1.4.2 Merging the satellite and repeat_unit features into repeat_region
Satellites, minisatellites and microsatellites are comprised of repetitive
units of DNA, with a variety of lengths and repeat patterns. With the
addition of a new qualifier (/satellite), the satellite and repeat_unit
features can be represented by the repeat_region feature.
Qualifier /satellite=
Definition identifier for satellite DNA marker; many tandem repeats
(identical or related) of a short basic repeating unit; many
have a base composition or other property different from the
genome average that allows them to be separated from the bulk
genomic DNA;
Value format "<satellite_type>[:<class>][ <identifier>]"
where satellite_type is one of the following
"satellite", "microsatellite", "minisatellite"
Example /satellite="satellite: S1a"
/satellite="satellite: alpha"
/satellite="satellite: gamma III"
/satellite="microsatellite: DC130"
As of the October 2008 GenBank release, all satellite features will be
transformed into repeat_region features with /satellite qualifiers of
type "satellite", and all repeat_unit features will be transformed into
repeat_region features.
1.4.3 New /gene_synonym qualifier
Gene symbols are presented via the /gene qualifier. When synonymous or
alternative gene symbols are available, they have often been presented via
multiple /gene qualifiers.
To distinguish what might be an approved or official gene symbol from its
synonyms or alternatives, a new /gene_synonym qualifier will be introduced
for GenBank Release 168.0 .
Qualifier /gene_synonym=
Definition synonymous or alternative symbol for a gene corresponding to
a sequence region
Value format "text"
Examples /gene="CF"
/gene="ABCC7"
1.4.4 New /mating_type qualifier
Because the /sex qualifier has a free-text value format, is has been
innapropriately utilized for certain organisms, such as bacteria, fungi,
and some insects and worms. In such cases, a more appropriate term would
be 'mating type'.
In October 2008, a new qualifier will be made available for non-sexual
reproductive strategies:
Qualifier /mating_type=
Definition mating type of the organism from which the sequence was obtained
Value format "text"
Example /mating_type="Mating type A"
1.4.5 Renaming of /specific_host as /host
The definition of /specific_host in the Feature Table document is as follows:
Qualifier /specific_host=
Definition natural host from which the sequence was obtained
Value format "text"
Example /specific_host="Rhizobium NGR234"
The usage of /specific_host, and particularly the distinction between it and
/lab_host, is not made clear with this definition. So the qualifier is going
to be renamed and redefined, starting with Release 168.0 in October 2008 :
Qualifier /host=
Definition Natural (as opposed to laboratory) host to the organism from
which the sequenced molecule was obtained
Value format "text"
Example /host="Homo sapiens"
/host="Homo sapiens 12 year old girl"
1.4.6 New value for /organelle
In October 2008, the list of allowed values for /organelle will be expanded
to include:
/organelle="chromatophore"
1.4.7 Modification to value format for /frequency
The current definition of /frequency is :
Qualifier /frequency=
Definition frequency of the occurrence of a feature
Value format text representing the fraction of population carrying the
variation expressed as a decimal fraction
Example /frequency=".85"
Although this format is appropriate and useful in some contexts (for
example, within a global population of individuals), it does not convey
the number of sequences that might have been included in a variation
study. As of Release 168.0, the format of /frequency will be expanded:
Value format text representing the fraction of population carrying the
variation expressed as a decimal fraction, or the number
observed instances vs the total number of sequenced isolates
Example /frequency=".85"
/frequency="23/108"
/frequency="1 in 12"
1.4.8 /cons_splice qualifier to be removed
The /cons_splice qualifier has almost no usage within the sequence
database. In addition, it does not account for the variation in splice
signals that might be used by different classes of introns. So this
qualfier will be removed from sequence records, and the Feature Table
document, as of Release 168.0 in October 2008.
1.4.9 /virion qualifier to be removed
The intent of /virion is to indicate that a sequenced molecule
is from an encapsidated viral particle (as opposed to the proviral
form of a virus, integrated into the host's genome). Viral sequences
derived from a blood sample taken from an infected organism might
typically be flagged with /virion, if it is believed that the sample
contained viral particles.
However, a review of the database reveals that this qualifier is
not used consistently, and furthermore, submitters often are unable
to conclusively state that a virus sequence derives from the
encapsidated form. So the /virion qualifier will be removed from
sequence records, and the Feature Table document, as of Release 168.0
in October 2008.
1.4.10 Updated value format for /exception
Only three values for the /exception qualifier have been approved
for use by the INSDC :
"rearrangement required for product"
"RNA editing"
"reasons given in citation"
However, the definition of /exception in the Feature Table document
does not indicate that the contents of /exception are controlled.
This oversight will be corrected in the October 2008.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank. Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.
SEQUIN. Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation. Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking. E-mail
the completed submission file to : [email protected]
Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:
ftp://ftp.ncbi.nih.gov/sequin
BANKIT. BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank. Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:
http://www.ncbi.nlm.nih.gov/
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: [email protected] or 301-496-2475.
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental "index" files are also supplied,
containing comprehensive lists of author names, journal citations,
gene names, and keywords, along with the accession numbers of the records
in which they can be found (see Section 3.3). The line-lengths of
these files is variable.
2.2 Files
This GenBank flat file release consists of 1617 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbacc1.idx - Index of the entries according to accession number, part 1.
2. gbacc2.idx - Index of the entries according to accession number, part 2.
3. gbacc3.idx - Index of the entries according to accession number, part 3.
4. gbaut1.idx - Index of the entries according to author name, part 1.
5. gbaut10.idx - Index of the entries according to author name, part 10.
6. gbaut11.idx - Index of the entries according to author name, part 11.
7. gbaut12.idx - Index of the entries according to author name, part 12.
8. gbaut13.idx - Index of the entries according to author name, part 13.
9. gbaut14.idx - Index of the entries according to author name, part 14.
10. gbaut15.idx - Index of the entries according to author name, part 15.
11. gbaut16.idx - Index of the entries according to author name, part 16.
12. gbaut17.idx - Index of the entries according to author name, part 17.
13. gbaut18.idx - Index of the entries according to author name, part 18.
14. gbaut19.idx - Index of the entries according to author name, part 19.
15. gbaut2.idx - Index of the entries according to author name, part 2.
16. gbaut20.idx - Index of the entries according to author name, part 20.
17. gbaut21.idx - Index of the entries according to author name, part 21.
18. gbaut22.idx - Index of the entries according to author name, part 22.
19. gbaut23.idx - Index of the entries according to author name, part 23.
20. gbaut24.idx - Index of the entries according to author name, part 24.
21. gbaut25.idx - Index of the entries according to author name, part 25.
22. gbaut26.idx - Index of the entries according to author name, part 26.
23. gbaut27.idx - Index of the entries according to author name, part 27.
24. gbaut28.idx - Index of the entries according to author name, part 28.
25. gbaut29.idx - Index of the entries according to author name, part 29.
26. gbaut3.idx - Index of the entries according to author name, part 3.
27. gbaut30.idx - Index of the entries according to author name, part 30.
28. gbaut31.idx - Index of the entries according to author name, part 31.
29. gbaut32.idx - Index of the entries according to author name, part 32.
30. gbaut33.idx - Index of the entries according to author name, part 33.
31. gbaut34.idx - Index of the entries according to author name, part 34.
32. gbaut35.idx - Index of the entries according to author name, part 35.
33. gbaut36.idx - Index of the entries according to author name, part 36.
34. gbaut37.idx - Index of the entries according to author name, part 37.
35. gbaut38.idx - Index of the entries according to author name, part 38.
36. gbaut39.idx - Index of the entries according to author name, part 39.
37. gbaut4.idx - Index of the entries according to author name, part 4.
38. gbaut40.idx - Index of the entries according to author name, part 40.
39. gbaut41.idx - Index of the entries according to author name, part 41.
40. gbaut42.idx - Index of the entries according to author name, part 42.
41. gbaut43.idx - Index of the entries according to author name, part 43.
42. gbaut44.idx - Index of the entries according to author name, part 44.
43. gbaut45.idx - Index of the entries according to author name, part 45.
44. gbaut46.idx - Index of the entries according to author name, part 46.
45. gbaut47.idx - Index of the entries according to author name, part 47.
46. gbaut48.idx - Index of the entries according to author name, part 48.
47. gbaut49.idx - Index of the entries according to author name, part 49.
48. gbaut5.idx - Index of the entries according to author name, part 5.
49. gbaut50.idx - Index of the entries according to author name, part 50.
50. gbaut51.idx - Index of the entries according to author name, part 51.
51. gbaut52.idx - Index of the entries according to author name, part 52.
52. gbaut53.idx - Index of the entries according to author name, part 53.
53. gbaut54.idx - Index of the entries according to author name, part 54.
54. gbaut55.idx - Index of the entries according to author name, part 55.
55. gbaut56.idx - Index of the entries according to author name, part 56.
56. gbaut57.idx - Index of the entries according to author name, part 57.
57. gbaut58.idx - Index of the entries according to author name, part 58.
58. gbaut59.idx - Index of the entries according to author name, part 59.
59. gbaut6.idx - Index of the entries according to author name, part 6.
60. gbaut7.idx - Index of the entries according to author name, part 7.
61. gbaut8.idx - Index of the entries according to author name, part 8.
62. gbaut9.idx - Index of the entries according to author name, part 9.
63. gbbct1.seq - Bacterial sequence entries, part 1.
64. gbbct10.seq - Bacterial sequence entries, part 10.
65. gbbct11.seq - Bacterial sequence entries, part 11.
66. gbbct12.seq - Bacterial sequence entries, part 12.
67. gbbct13.seq - Bacterial sequence entries, part 13.
68. gbbct14.seq - Bacterial sequence entries, part 14.
69. gbbct15.seq - Bacterial sequence entries, part 15.
70. gbbct16.seq - Bacterial sequence entries, part 16.
71. gbbct17.seq - Bacterial sequence entries, part 17.
72. gbbct18.seq - Bacterial sequence entries, part 18.
73. gbbct19.seq - Bacterial sequence entries, part 19.
74. gbbct2.seq - Bacterial sequence entries, part 2.
75. gbbct20.seq - Bacterial sequence entries, part 20.
76. gbbct21.seq - Bacterial sequence entries, part 21.
77. gbbct22.seq - Bacterial sequence entries, part 22.
78. gbbct23.seq - Bacterial sequence entries, part 23.
79. gbbct24.seq - Bacterial sequence entries, part 24.
80. gbbct25.seq - Bacterial sequence entries, part 25.
81. gbbct26.seq - Bacterial sequence entries, part 26.
82. gbbct27.seq - Bacterial sequence entries, part 27.
83. gbbct28.seq - Bacterial sequence entries, part 28.
84. gbbct29.seq - Bacterial sequence entries, part 29.
85. gbbct3.seq - Bacterial sequence entries, part 3.
86. gbbct30.seq - Bacterial sequence entries, part 30.
87. gbbct4.seq - Bacterial sequence entries, part 4.
88. gbbct5.seq - Bacterial sequence entries, part 5.
89. gbbct6.seq - Bacterial sequence entries, part 6.
90. gbbct7.seq - Bacterial sequence entries, part 7.
91. gbbct8.seq - Bacterial sequence entries, part 8.
92. gbbct9.seq - Bacterial sequence entries, part 9.
93. gbchg.txt - Accession numbers of entries updated since the previous release.
94. gbcon1.seq - Constructed sequence entries, part 1.
95. gbcon10.seq - Constructed sequence entries, part 10.
96. gbcon11.seq - Constructed sequence entries, part 11.
97. gbcon12.seq - Constructed sequence entries, part 12.
98. gbcon13.seq - Constructed sequence entries, part 13.
99. gbcon14.seq - Constructed sequence entries, part 14.
100. gbcon15.seq - Constructed sequence entries, part 15.
101. gbcon16.seq - Constructed sequence entries, part 16.
102. gbcon17.seq - Constructed sequence entries, part 17.
103. gbcon18.seq - Constructed sequence entries, part 18.
104. gbcon19.seq - Constructed sequence entries, part 19.
105. gbcon2.seq - Constructed sequence entries, part 2.
106. gbcon20.seq - Constructed sequence entries, part 20.
107. gbcon21.seq - Constructed sequence entries, part 21.
108. gbcon22.seq - Constructed sequence entries, part 22.
109. gbcon23.seq - Constructed sequence entries, part 23.
110. gbcon24.seq - Constructed sequence entries, part 24.
111. gbcon25.seq - Constructed sequence entries, part 25.
112. gbcon26.seq - Constructed sequence entries, part 26.
113. gbcon27.seq - Constructed sequence entries, part 27.
114. gbcon28.seq - Constructed sequence entries, part 28.
115. gbcon29.seq - Constructed sequence entries, part 29.
116. gbcon3.seq - Constructed sequence entries, part 3.
117. gbcon30.seq - Constructed sequence entries, part 30.
118. gbcon31.seq - Constructed sequence entries, part 31.
119. gbcon32.seq - Constructed sequence entries, part 32.
120. gbcon33.seq - Constructed sequence entries, part 33.
121. gbcon34.seq - Constructed sequence entries, part 34.
122. gbcon35.seq - Constructed sequence entries, part 35.
123. gbcon36.seq - Constructed sequence entries, part 36.
124. gbcon37.seq - Constructed sequence entries, part 37.
125. gbcon38.seq - Constructed sequence entries, part 38.
126. gbcon39.seq - Constructed sequence entries, part 39.
127. gbcon4.seq - Constructed sequence entries, part 4.
128. gbcon40.seq - Constructed sequence entries, part 40.
129. gbcon41.seq - Constructed sequence entries, part 41.
130. gbcon42.seq - Constructed sequence entries, part 42.
131. gbcon43.seq - Constructed sequence entries, part 43.
132. gbcon44.seq - Constructed sequence entries, part 44.
133. gbcon45.seq - Constructed sequence entries, part 45.
134. gbcon46.seq - Constructed sequence entries, part 46.
135. gbcon47.seq - Constructed sequence entries, part 47.
136. gbcon48.seq - Constructed sequence entries, part 48.
137. gbcon49.seq - Constructed sequence entries, part 49.
138. gbcon5.seq - Constructed sequence entries, part 5.
139. gbcon50.seq - Constructed sequence entries, part 50.
140. gbcon51.seq - Constructed sequence entries, part 51.
141. gbcon52.seq - Constructed sequence entries, part 52.
142. gbcon53.seq - Constructed sequence entries, part 53.
143. gbcon54.seq - Constructed sequence entries, part 54.
144. gbcon55.seq - Constructed sequence entries, part 55.
145. gbcon56.seq - Constructed sequence entries, part 56.
146. gbcon57.seq - Constructed sequence entries, part 57.
147. gbcon58.seq - Constructed sequence entries, part 58.
148. gbcon59.seq - Constructed sequence entries, part 59.
149. gbcon6.seq - Constructed sequence entries, part 6.
150. gbcon60.seq - Constructed sequence entries, part 60.
151. gbcon61.seq - Constructed sequence entries, part 61.
152. gbcon62.seq - Constructed sequence entries, part 62.
153. gbcon63.seq - Constructed sequence entries, part 63.
154. gbcon64.seq - Constructed sequence entries, part 64.
155. gbcon65.seq - Constructed sequence entries, part 65.
156. gbcon66.seq - Constructed sequence entries, part 66.
157. gbcon67.seq - Constructed sequence entries, part 67.
158. gbcon68.seq - Constructed sequence entries, part 68.
159. gbcon69.seq - Constructed sequence entries, part 69.
160. gbcon7.seq - Constructed sequence entries, part 7.
161. gbcon70.seq - Constructed sequence entries, part 70.
162. gbcon71.seq - Constructed sequence entries, part 71.
163. gbcon72.seq - Constructed sequence entries, part 72.
164. gbcon73.seq - Constructed sequence entries, part 73.
165. gbcon74.seq - Constructed sequence entries, part 74.
166. gbcon75.seq - Constructed sequence entries, part 75.
167. gbcon76.seq - Constructed sequence entries, part 76.
168. gbcon77.seq - Constructed sequence entries, part 77.
169. gbcon78.seq - Constructed sequence entries, part 78.
170. gbcon79.seq - Constructed sequence entries, part 79.
171. gbcon8.seq - Constructed sequence entries, part 8.
172. gbcon80.seq - Constructed sequence entries, part 80.
173. gbcon81.seq - Constructed sequence entries, part 81.
174. gbcon82.seq - Constructed sequence entries, part 82.
175. gbcon83.seq - Constructed sequence entries, part 83.
176. gbcon84.seq - Constructed sequence entries, part 84.
177. gbcon85.seq - Constructed sequence entries, part 85.
178. gbcon86.seq - Constructed sequence entries, part 86.
179. gbcon87.seq - Constructed sequence entries, part 87.
180. gbcon88.seq - Constructed sequence entries, part 88.
181. gbcon89.seq - Constructed sequence entries, part 89.
182. gbcon9.seq - Constructed sequence entries, part 9.
183. gbcon90.seq - Constructed sequence entries, part 90.
184. gbcon91.seq - Constructed sequence entries, part 91.
185. gbcon92.seq - Constructed sequence entries, part 92.
186. gbcon93.seq - Constructed sequence entries, part 93.
187. gbcon94.seq - Constructed sequence entries, part 94.
188. gbcon95.seq - Constructed sequence entries, part 95.
189. gbcon96.seq - Constructed sequence entries, part 96.
190. gbcon97.seq - Constructed sequence entries, part 97.
191. gbdel.txt - Accession numbers of entries deleted since the previous release.
192. gbenv1.seq - Environmental sampling sequence entries, part 1.
193. gbenv10.seq - Environmental sampling sequence entries, part 10.
194. gbenv2.seq - Environmental sampling sequence entries, part 2.
195. gbenv3.seq - Environmental sampling sequence entries, part 3.
196. gbenv4.seq - Environmental sampling sequence entries, part 4.
197. gbenv5.seq - Environmental sampling sequence entries, part 5.
198. gbenv6.seq - Environmental sampling sequence entries, part 6.
199. gbenv7.seq - Environmental sampling sequence entries, part 7.
200. gbenv8.seq - Environmental sampling sequence entries, part 8.
201. gbenv9.seq - Environmental sampling sequence entries, part 9.
202. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
203. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
204. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
205. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
206. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
207. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
208. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
209. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
210. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
211. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
212. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
213. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
214. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
215. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
216. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
217. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
218. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
219. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
220. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
221. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
222. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
223. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
224. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
225. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
226. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
227. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
228. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
229. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
230. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
231. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
232. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
233. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
234. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
235. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
236. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
237. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
238. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
239. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
240. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
241. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
242. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
243. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
244. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
245. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
246. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
247. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
248. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
249. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
250. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
251. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
252. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
253. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
254. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
255. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
256. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
257. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
258. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
259. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
260. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
261. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
262. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
263. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
264. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
265. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
266. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
267. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
268. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
269. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
270. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
271. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
272. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
273. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
274. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
275. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
276. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
277. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
278. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
279. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
280. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
281. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
282. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
283. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
284. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
285. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
286. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
287. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
288. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
289. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
290. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
291. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
292. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
293. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
294. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
295. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
296. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
297. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
298. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
299. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
300. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
301. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
302. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
303. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
304. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
305. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
306. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
307. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
308. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
309. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
310. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
311. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
312. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
313. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
314. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
315. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
316. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
317. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
318. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
319. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
320. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
321. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
322. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
323. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
324. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
325. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
326. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
327. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
328. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
329. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
330. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
331. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
332. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
333. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
334. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
335. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
336. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
337. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
338. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
339. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
340. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
341. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
342. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
343. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
344. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
345. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
346. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
347. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
348. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
349. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
350. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
351. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
352. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
353. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
354. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
355. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
356. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
357. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
358. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
359. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
360. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
361. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
362. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
363. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
364. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
365. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
366. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
367. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
368. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
369. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
370. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
371. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
372. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
373. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
374. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
375. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
376. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
377. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
378. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
379. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
380. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
381. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
382. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
383. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
384. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
385. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
386. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
387. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
388. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
389. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
390. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
391. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
392. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
393. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
394. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
395. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
396. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
397. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
398. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
399. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
400. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
401. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
402. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
403. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
404. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
405. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
406. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
407. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
408. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
409. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
410. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
411. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
412. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
413. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
414. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
415. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
416. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
417. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
418. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
419. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
420. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
421. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
422. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
423. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
424. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
425. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
426. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
427. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
428. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
429. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
430. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
431. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
432. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
433. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
434. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
435. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
436. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
437. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
438. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
439. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
440. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
441. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
442. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
443. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
444. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
445. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
446. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
447. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
448. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
449. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
450. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
451. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
452. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
453. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
454. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
455. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
456. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
457. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
458. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
459. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
460. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
461. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
462. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
463. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
464. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
465. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
466. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
467. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
468. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
469. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
470. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
471. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
472. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
473. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
474. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
475. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
476. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
477. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
478. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
479. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
480. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
481. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
482. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
483. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
484. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
485. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
486. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
487. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
488. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
489. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
490. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
491. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
492. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
493. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
494. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
495. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
496. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
497. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
498. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
499. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
500. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
501. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
502. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
503. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
504. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
505. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
506. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
507. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
508. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
509. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
510. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
511. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
512. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
513. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
514. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
515. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
516. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
517. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
518. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
519. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
520. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
521. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
522. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
523. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
524. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
525. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
526. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
527. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
528. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
529. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
530. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
531. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
532. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
533. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
534. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
535. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
536. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
537. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
538. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
539. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
540. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
541. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
542. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
543. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
544. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
545. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
546. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
547. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
548. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
549. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
550. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
551. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
552. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
553. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
554. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
555. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
556. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
557. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
558. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
559. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
560. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
561. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
562. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
563. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
564. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
565. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
566. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
567. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
568. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
569. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
570. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
571. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
572. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
573. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
574. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
575. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
576. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
577. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
578. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
579. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
580. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
581. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
582. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
583. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
584. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
585. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
586. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
587. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
588. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
589. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
590. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
591. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
592. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
593. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
594. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
595. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
596. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
597. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
598. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
599. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
600. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
601. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
602. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
603. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
604. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
605. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
606. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
607. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
608. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
609. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
610. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
611. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
612. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
613. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
614. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
615. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
616. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
617. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
618. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
619. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
620. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
621. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
622. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
623. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
624. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
625. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
626. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
627. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
628. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
629. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
630. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
631. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
632. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
633. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
634. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
635. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
636. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
637. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
638. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
639. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
640. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
641. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
642. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
643. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
644. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
645. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
646. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
647. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
648. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
649. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
650. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
651. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
652. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
653. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
654. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
655. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
656. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
657. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
658. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
659. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
660. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
661. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
662. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
663. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
664. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
665. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
666. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
667. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
668. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
669. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
670. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
671. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
672. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
673. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
674. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
675. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
676. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
677. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
678. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
679. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
680. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
681. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
682. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
683. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
684. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
685. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
686. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
687. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
688. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
689. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
690. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
691. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
692. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
693. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
694. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
695. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
696. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
697. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
698. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
699. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
700. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
701. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
702. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
703. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
704. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
705. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
706. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
707. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
708. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
709. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
710. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
711. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
712. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
713. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
714. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
715. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
716. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
717. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
718. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
719. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
720. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
721. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
722. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
723. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
724. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
725. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
726. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
727. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
728. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
729. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
730. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
731. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
732. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
733. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
734. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
735. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
736. gbest580.seq - EST (expressed sequence tag) sequence entries, part 580.
737. gbest581.seq - EST (expressed sequence tag) sequence entries, part 581.
738. gbest582.seq - EST (expressed sequence tag) sequence entries, part 582.
739. gbest583.seq - EST (expressed sequence tag) sequence entries, part 583.
740. gbest584.seq - EST (expressed sequence tag) sequence entries, part 584.
741. gbest585.seq - EST (expressed sequence tag) sequence entries, part 585.
742. gbest586.seq - EST (expressed sequence tag) sequence entries, part 586.
743. gbest587.seq - EST (expressed sequence tag) sequence entries, part 587.
744. gbest588.seq - EST (expressed sequence tag) sequence entries, part 588.
745. gbest589.seq - EST (expressed sequence tag) sequence entries, part 589.
746. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
747. gbest590.seq - EST (expressed sequence tag) sequence entries, part 590.
748. gbest591.seq - EST (expressed sequence tag) sequence entries, part 591.
749. gbest592.seq - EST (expressed sequence tag) sequence entries, part 592.
750. gbest593.seq - EST (expressed sequence tag) sequence entries, part 593.
751. gbest594.seq - EST (expressed sequence tag) sequence entries, part 594.
752. gbest595.seq - EST (expressed sequence tag) sequence entries, part 595.
753. gbest596.seq - EST (expressed sequence tag) sequence entries, part 596.
754. gbest597.seq - EST (expressed sequence tag) sequence entries, part 597.
755. gbest598.seq - EST (expressed sequence tag) sequence entries, part 598.
756. gbest599.seq - EST (expressed sequence tag) sequence entries, part 599.
757. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
758. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
759. gbest600.seq - EST (expressed sequence tag) sequence entries, part 600.
760. gbest601.seq - EST (expressed sequence tag) sequence entries, part 601.
761. gbest602.seq - EST (expressed sequence tag) sequence entries, part 602.
762. gbest603.seq - EST (expressed sequence tag) sequence entries, part 603.
763. gbest604.seq - EST (expressed sequence tag) sequence entries, part 604.
764. gbest605.seq - EST (expressed sequence tag) sequence entries, part 605.
765. gbest606.seq - EST (expressed sequence tag) sequence entries, part 606.
766. gbest607.seq - EST (expressed sequence tag) sequence entries, part 607.
767. gbest608.seq - EST (expressed sequence tag) sequence entries, part 608.
768. gbest609.seq - EST (expressed sequence tag) sequence entries, part 609.
769. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
770. gbest610.seq - EST (expressed sequence tag) sequence entries, part 610.
771. gbest611.seq - EST (expressed sequence tag) sequence entries, part 611.
772. gbest612.seq - EST (expressed sequence tag) sequence entries, part 612.
773. gbest613.seq - EST (expressed sequence tag) sequence entries, part 613.
774. gbest614.seq - EST (expressed sequence tag) sequence entries, part 614.
775. gbest615.seq - EST (expressed sequence tag) sequence entries, part 615.
776. gbest616.seq - EST (expressed sequence tag) sequence entries, part 616.
777. gbest617.seq - EST (expressed sequence tag) sequence entries, part 617.
778. gbest618.seq - EST (expressed sequence tag) sequence entries, part 618.
779. gbest619.seq - EST (expressed sequence tag) sequence entries, part 619.
780. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
781. gbest620.seq - EST (expressed sequence tag) sequence entries, part 620.
782. gbest621.seq - EST (expressed sequence tag) sequence entries, part 621.
783. gbest622.seq - EST (expressed sequence tag) sequence entries, part 622.
784. gbest623.seq - EST (expressed sequence tag) sequence entries, part 623.
785. gbest624.seq - EST (expressed sequence tag) sequence entries, part 624.
786. gbest625.seq - EST (expressed sequence tag) sequence entries, part 625.
787. gbest626.seq - EST (expressed sequence tag) sequence entries, part 626.
788. gbest627.seq - EST (expressed sequence tag) sequence entries, part 627.
789. gbest628.seq - EST (expressed sequence tag) sequence entries, part 628.
790. gbest629.seq - EST (expressed sequence tag) sequence entries, part 629.
791. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
792. gbest630.seq - EST (expressed sequence tag) sequence entries, part 630.
793. gbest631.seq - EST (expressed sequence tag) sequence entries, part 631.
794. gbest632.seq - EST (expressed sequence tag) sequence entries, part 632.
795. gbest633.seq - EST (expressed sequence tag) sequence entries, part 633.
796. gbest634.seq - EST (expressed sequence tag) sequence entries, part 634.
797. gbest635.seq - EST (expressed sequence tag) sequence entries, part 635.
798. gbest636.seq - EST (expressed sequence tag) sequence entries, part 636.
799. gbest637.seq - EST (expressed sequence tag) sequence entries, part 637.
800. gbest638.seq - EST (expressed sequence tag) sequence entries, part 638.
801. gbest639.seq - EST (expressed sequence tag) sequence entries, part 639.
802. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
803. gbest640.seq - EST (expressed sequence tag) sequence entries, part 640.
804. gbest641.seq - EST (expressed sequence tag) sequence entries, part 641.
805. gbest642.seq - EST (expressed sequence tag) sequence entries, part 642.
806. gbest643.seq - EST (expressed sequence tag) sequence entries, part 643.
807. gbest644.seq - EST (expressed sequence tag) sequence entries, part 644.
808. gbest645.seq - EST (expressed sequence tag) sequence entries, part 645.
809. gbest646.seq - EST (expressed sequence tag) sequence entries, part 646.
810. gbest647.seq - EST (expressed sequence tag) sequence entries, part 647.
811. gbest648.seq - EST (expressed sequence tag) sequence entries, part 648.
812. gbest649.seq - EST (expressed sequence tag) sequence entries, part 649.
813. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
814. gbest650.seq - EST (expressed sequence tag) sequence entries, part 650.
815. gbest651.seq - EST (expressed sequence tag) sequence entries, part 651.
816. gbest652.seq - EST (expressed sequence tag) sequence entries, part 652.
817. gbest653.seq - EST (expressed sequence tag) sequence entries, part 653.
818. gbest654.seq - EST (expressed sequence tag) sequence entries, part 654.
819. gbest655.seq - EST (expressed sequence tag) sequence entries, part 655.
820. gbest656.seq - EST (expressed sequence tag) sequence entries, part 656.
821. gbest657.seq - EST (expressed sequence tag) sequence entries, part 657.
822. gbest658.seq - EST (expressed sequence tag) sequence entries, part 658.
823. gbest659.seq - EST (expressed sequence tag) sequence entries, part 659.
824. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
825. gbest660.seq - EST (expressed sequence tag) sequence entries, part 660.
826. gbest661.seq - EST (expressed sequence tag) sequence entries, part 661.
827. gbest662.seq - EST (expressed sequence tag) sequence entries, part 662.
828. gbest663.seq - EST (expressed sequence tag) sequence entries, part 663.
829. gbest664.seq - EST (expressed sequence tag) sequence entries, part 664.
830. gbest665.seq - EST (expressed sequence tag) sequence entries, part 665.
831. gbest666.seq - EST (expressed sequence tag) sequence entries, part 666.
832. gbest667.seq - EST (expressed sequence tag) sequence entries, part 667.
833. gbest668.seq - EST (expressed sequence tag) sequence entries, part 668.
834. gbest669.seq - EST (expressed sequence tag) sequence entries, part 669.
835. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
836. gbest670.seq - EST (expressed sequence tag) sequence entries, part 670.
837. gbest671.seq - EST (expressed sequence tag) sequence entries, part 671.
838. gbest672.seq - EST (expressed sequence tag) sequence entries, part 672.
839. gbest673.seq - EST (expressed sequence tag) sequence entries, part 673.
840. gbest674.seq - EST (expressed sequence tag) sequence entries, part 674.
841. gbest675.seq - EST (expressed sequence tag) sequence entries, part 675.
842. gbest676.seq - EST (expressed sequence tag) sequence entries, part 676.
843. gbest677.seq - EST (expressed sequence tag) sequence entries, part 677.
844. gbest678.seq - EST (expressed sequence tag) sequence entries, part 678.
845. gbest679.seq - EST (expressed sequence tag) sequence entries, part 679.
846. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
847. gbest680.seq - EST (expressed sequence tag) sequence entries, part 680.
848. gbest681.seq - EST (expressed sequence tag) sequence entries, part 681.
849. gbest682.seq - EST (expressed sequence tag) sequence entries, part 682.
850. gbest683.seq - EST (expressed sequence tag) sequence entries, part 683.
851. gbest684.seq - EST (expressed sequence tag) sequence entries, part 684.
852. gbest685.seq - EST (expressed sequence tag) sequence entries, part 685.
853. gbest686.seq - EST (expressed sequence tag) sequence entries, part 686.
854. gbest687.seq - EST (expressed sequence tag) sequence entries, part 687.
855. gbest688.seq - EST (expressed sequence tag) sequence entries, part 688.
856. gbest689.seq - EST (expressed sequence tag) sequence entries, part 689.
857. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
858. gbest690.seq - EST (expressed sequence tag) sequence entries, part 690.
859. gbest691.seq - EST (expressed sequence tag) sequence entries, part 691.
860. gbest692.seq - EST (expressed sequence tag) sequence entries, part 692.
861. gbest693.seq - EST (expressed sequence tag) sequence entries, part 693.
862. gbest694.seq - EST (expressed sequence tag) sequence entries, part 694.
863. gbest695.seq - EST (expressed sequence tag) sequence entries, part 695.
864. gbest696.seq - EST (expressed sequence tag) sequence entries, part 696.
865. gbest697.seq - EST (expressed sequence tag) sequence entries, part 697.
866. gbest698.seq - EST (expressed sequence tag) sequence entries, part 698.
867. gbest699.seq - EST (expressed sequence tag) sequence entries, part 699.
868. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
869. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
870. gbest700.seq - EST (expressed sequence tag) sequence entries, part 700.
871. gbest701.seq - EST (expressed sequence tag) sequence entries, part 701.
872. gbest702.seq - EST (expressed sequence tag) sequence entries, part 702.
873. gbest703.seq - EST (expressed sequence tag) sequence entries, part 703.
874. gbest704.seq - EST (expressed sequence tag) sequence entries, part 704.
875. gbest705.seq - EST (expressed sequence tag) sequence entries, part 705.
876. gbest706.seq - EST (expressed sequence tag) sequence entries, part 706.
877. gbest707.seq - EST (expressed sequence tag) sequence entries, part 707.
878. gbest708.seq - EST (expressed sequence tag) sequence entries, part 708.
879. gbest709.seq - EST (expressed sequence tag) sequence entries, part 709.
880. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
881. gbest710.seq - EST (expressed sequence tag) sequence entries, part 710.
882. gbest711.seq - EST (expressed sequence tag) sequence entries, part 711.
883. gbest712.seq - EST (expressed sequence tag) sequence entries, part 712.
884. gbest713.seq - EST (expressed sequence tag) sequence entries, part 713.
885. gbest714.seq - EST (expressed sequence tag) sequence entries, part 714.
886. gbest715.seq - EST (expressed sequence tag) sequence entries, part 715.
887. gbest716.seq - EST (expressed sequence tag) sequence entries, part 716.
888. gbest717.seq - EST (expressed sequence tag) sequence entries, part 717.
889. gbest718.seq - EST (expressed sequence tag) sequence entries, part 718.
890. gbest719.seq - EST (expressed sequence tag) sequence entries, part 719.
891. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
892. gbest720.seq - EST (expressed sequence tag) sequence entries, part 720.
893. gbest721.seq - EST (expressed sequence tag) sequence entries, part 721.
894. gbest722.seq - EST (expressed sequence tag) sequence entries, part 722.
895. gbest723.seq - EST (expressed sequence tag) sequence entries, part 723.
896. gbest724.seq - EST (expressed sequence tag) sequence entries, part 724.
897. gbest725.seq - EST (expressed sequence tag) sequence entries, part 725.
898. gbest726.seq - EST (expressed sequence tag) sequence entries, part 726.
899. gbest727.seq - EST (expressed sequence tag) sequence entries, part 727.
900. gbest728.seq - EST (expressed sequence tag) sequence entries, part 728.
901. gbest729.seq - EST (expressed sequence tag) sequence entries, part 729.
902. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
903. gbest730.seq - EST (expressed sequence tag) sequence entries, part 730.
904. gbest731.seq - EST (expressed sequence tag) sequence entries, part 731.
905. gbest732.seq - EST (expressed sequence tag) sequence entries, part 732.
906. gbest733.seq - EST (expressed sequence tag) sequence entries, part 733.
907. gbest734.seq - EST (expressed sequence tag) sequence entries, part 734.
908. gbest735.seq - EST (expressed sequence tag) sequence entries, part 735.
909. gbest736.seq - EST (expressed sequence tag) sequence entries, part 736.
910. gbest737.seq - EST (expressed sequence tag) sequence entries, part 737.
911. gbest738.seq - EST (expressed sequence tag) sequence entries, part 738.
912. gbest739.seq - EST (expressed sequence tag) sequence entries, part 739.
913. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
914. gbest740.seq - EST (expressed sequence tag) sequence entries, part 740.
915. gbest741.seq - EST (expressed sequence tag) sequence entries, part 741.
916. gbest742.seq - EST (expressed sequence tag) sequence entries, part 742.
917. gbest743.seq - EST (expressed sequence tag) sequence entries, part 743.
918. gbest744.seq - EST (expressed sequence tag) sequence entries, part 744.
919. gbest745.seq - EST (expressed sequence tag) sequence entries, part 745.
920. gbest746.seq - EST (expressed sequence tag) sequence entries, part 746.
921. gbest747.seq - EST (expressed sequence tag) sequence entries, part 747.
922. gbest748.seq - EST (expressed sequence tag) sequence entries, part 748.
923. gbest749.seq - EST (expressed sequence tag) sequence entries, part 749.
924. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
925. gbest750.seq - EST (expressed sequence tag) sequence entries, part 750.
926. gbest751.seq - EST (expressed sequence tag) sequence entries, part 751.
927. gbest752.seq - EST (expressed sequence tag) sequence entries, part 752.
928. gbest753.seq - EST (expressed sequence tag) sequence entries, part 753.
929. gbest754.seq - EST (expressed sequence tag) sequence entries, part 754.
930. gbest755.seq - EST (expressed sequence tag) sequence entries, part 755.
931. gbest756.seq - EST (expressed sequence tag) sequence entries, part 756.
932. gbest757.seq - EST (expressed sequence tag) sequence entries, part 757.
933. gbest758.seq - EST (expressed sequence tag) sequence entries, part 758.
934. gbest759.seq - EST (expressed sequence tag) sequence entries, part 759.
935. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
936. gbest760.seq - EST (expressed sequence tag) sequence entries, part 760.
937. gbest761.seq - EST (expressed sequence tag) sequence entries, part 761.
938. gbest762.seq - EST (expressed sequence tag) sequence entries, part 762.
939. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
940. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
941. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
942. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
943. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
944. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
945. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
946. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
947. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
948. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
949. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
950. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
951. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
952. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
953. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
954. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
955. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
956. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
957. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
958. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
959. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
960. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
961. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
962. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
963. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
964. gbgen.idx - Index of the entries according to gene symbols.
965. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
966. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
967. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
968. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
969. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
970. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
971. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
972. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
973. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
974. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
975. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
976. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
977. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
978. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
979. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
980. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
981. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
982. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
983. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
984. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
985. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
986. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
987. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
988. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
989. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
990. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
991. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
992. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
993. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
994. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
995. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
996. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
997. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
998. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
999. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1000. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1001. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1002. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1003. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1004. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1005. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1006. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1007. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1008. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1009. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1010. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1011. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1012. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1013. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1014. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1015. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1016. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1017. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1018. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1019. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1020. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1021. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1022. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1023. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1024. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1025. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1026. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1027. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1028. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1029. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1030. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1031. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1032. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1033. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1034. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1035. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1036. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1037. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1038. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1039. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1040. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1041. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1042. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1043. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1044. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1045. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1046. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1047. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1048. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1049. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1050. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1051. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1052. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1053. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1054. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1055. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1056. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1057. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1058. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1059. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1060. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1061. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1062. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1063. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1064. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1065. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1066. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1067. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1068. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1069. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1070. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1071. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1072. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1073. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1074. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1075. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1076. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1077. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1078. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1079. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1080. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1081. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1082. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1083. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1084. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1085. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1086. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1087. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1088. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1089. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1090. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1091. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1092. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1093. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1094. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1095. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1096. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1097. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1098. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1099. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1100. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1101. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1102. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1103. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1104. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1105. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1106. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1107. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1108. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1109. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1110. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1111. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1112. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1113. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1114. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1115. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1116. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1117. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1118. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1119. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1120. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1121. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1122. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1123. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1124. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1125. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1126. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1127. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1128. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1129. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1130. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1131. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1132. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1133. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1134. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1135. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1136. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1137. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1138. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1139. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1140. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1141. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1142. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1143. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1144. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1145. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1146. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1147. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1148. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1149. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1150. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1151. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1152. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1153. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1154. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1155. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1156. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1157. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1158. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1159. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1160. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1161. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1162. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1163. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1164. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1165. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1166. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1167. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1168. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1169. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1170. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1171. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1172. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1173. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1174. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1175. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1176. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1177. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1178. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1179. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1180. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1181. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1182. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1183. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1184. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1185. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1186. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1187. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1188. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1189. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1190. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1191. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1192. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1193. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1194. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1195. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1196. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1197. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1198. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1199. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1200. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1201. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1202. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1203. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1204. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1205. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1206. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1207. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1208. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1209. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1210. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1211. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1212. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1213. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1214. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1215. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1216. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1217. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1218. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1219. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1220. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1221. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1222. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1223. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1224. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1225. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1226. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1227. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1228. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1229. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1230. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1231. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1232. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1233. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1234. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1235. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1236. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1237. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1238. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1239. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1240. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1241. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1242. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1243. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1244. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1245. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1246. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1247. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1248. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1249. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1250. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1251. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1252. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1253. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1254. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1255. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1256. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1257. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1258. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1259. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1260. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1261. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1262. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1263. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1264. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1265. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1266. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1267. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1268. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1269. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1270. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1271. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1272. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1273. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1274. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1275. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1276. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1277. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1278. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1279. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1280. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1281. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1282. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1283. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1284. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1285. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1286. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1287. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1288. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1289. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1290. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1291. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1292. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1293. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1294. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1295. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1296. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1297. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1298. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1299. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1300. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1301. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1302. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1303. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1304. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1305. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1306. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1307. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1308. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1309. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1310. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1311. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1312. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1313. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1314. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1315. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1316. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1317. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1318. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1319. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1320. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1321. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1322. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1323. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1324. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1325. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1326. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1327. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1328. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1329. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1330. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1331. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1332. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1333. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1334. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1335. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1336. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1337. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1338. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1339. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1340. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1341. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1342. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1343. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1344. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1345. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1346. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1347. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1348. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1349. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1350. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1351. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1352. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1353. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1354. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1355. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1356. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1357. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1358. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1359. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1360. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1361. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1362. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1363. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1364. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1365. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1366. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1367. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1368. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1369. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1370. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1371. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1372. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1373. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1374. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1375. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1376. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1377. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1378. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1379. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1380. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1381. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1382. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1383. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1384. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1385. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1386. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1387. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1388. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1389. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1390. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1391. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1392. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1393. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1394. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1395. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1396. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1397. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1398. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1399. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1400. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1401. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1402. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1403. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1404. gbinv1.seq - Invertebrate sequence entries, part 1.
1405. gbinv10.seq - Invertebrate sequence entries, part 10.
1406. gbinv11.seq - Invertebrate sequence entries, part 11.
1407. gbinv12.seq - Invertebrate sequence entries, part 12.
1408. gbinv13.seq - Invertebrate sequence entries, part 13.
1409. gbinv2.seq - Invertebrate sequence entries, part 2.
1410. gbinv3.seq - Invertebrate sequence entries, part 3.
1411. gbinv4.seq - Invertebrate sequence entries, part 4.
1412. gbinv5.seq - Invertebrate sequence entries, part 5.
1413. gbinv6.seq - Invertebrate sequence entries, part 6.
1414. gbinv7.seq - Invertebrate sequence entries, part 7.
1415. gbinv8.seq - Invertebrate sequence entries, part 8.
1416. gbinv9.seq - Invertebrate sequence entries, part 9.
1417. gbjou1.idx - Index of the entries according to journal citation, part 1.
1418. gbjou2.idx - Index of the entries according to journal citation, part 2.
1419. gbjou3.idx - Index of the entries according to journal citation, part 3.
1420. gbjou4.idx - Index of the entries according to journal citation, part 4.
1421. gbjou5.idx - Index of the entries according to journal citation, part 5.
1422. gbkey1.idx - Index of the entries according to keyword phrase, part 1.
1423. gbkey2.idx - Index of the entries according to keyword phrase, part 2.
1424. gbkey3.idx - Index of the entries according to keyword phrase, part 3.
1425. gbmam1.seq - Other mammalian sequence entries, part 1.
1426. gbmam2.seq - Other mammalian sequence entries, part 2.
1427. gbmam3.seq - Other mammalian sequence entries, part 3.
1428. gbmam4.seq - Other mammalian sequence entries, part 4.
1429. gbnew.txt - Accession numbers of entries new since the previous release.
1430. gbpat1.seq - Patent sequence entries, part 1.
1431. gbpat10.seq - Patent sequence entries, part 10.
1432. gbpat11.seq - Patent sequence entries, part 11.
1433. gbpat12.seq - Patent sequence entries, part 12.
1434. gbpat13.seq - Patent sequence entries, part 13.
1435. gbpat14.seq - Patent sequence entries, part 14.
1436. gbpat15.seq - Patent sequence entries, part 15.
1437. gbpat16.seq - Patent sequence entries, part 16.
1438. gbpat17.seq - Patent sequence entries, part 17.
1439. gbpat18.seq - Patent sequence entries, part 18.
1440. gbpat19.seq - Patent sequence entries, part 19.
1441. gbpat2.seq - Patent sequence entries, part 2.
1442. gbpat20.seq - Patent sequence entries, part 20.
1443. gbpat21.seq - Patent sequence entries, part 21.
1444. gbpat22.seq - Patent sequence entries, part 22.
1445. gbpat23.seq - Patent sequence entries, part 23.
1446. gbpat24.seq - Patent sequence entries, part 24.
1447. gbpat25.seq - Patent sequence entries, part 25.
1448. gbpat26.seq - Patent sequence entries, part 26.
1449. gbpat27.seq - Patent sequence entries, part 27.
1450. gbpat28.seq - Patent sequence entries, part 28.
1451. gbpat29.seq - Patent sequence entries, part 29.
1452. gbpat3.seq - Patent sequence entries, part 3.
1453. gbpat30.seq - Patent sequence entries, part 30.
1454. gbpat31.seq - Patent sequence entries, part 31.
1455. gbpat32.seq - Patent sequence entries, part 32.
1456. gbpat33.seq - Patent sequence entries, part 33.
1457. gbpat34.seq - Patent sequence entries, part 34.
1458. gbpat35.seq - Patent sequence entries, part 35.
1459. gbpat36.seq - Patent sequence entries, part 36.
1460. gbpat37.seq - Patent sequence entries, part 37.
1461. gbpat38.seq - Patent sequence entries, part 38.
1462. gbpat39.seq - Patent sequence entries, part 39.
1463. gbpat4.seq - Patent sequence entries, part 4.
1464. gbpat40.seq - Patent sequence entries, part 40.
1465. gbpat41.seq - Patent sequence entries, part 41.
1466. gbpat42.seq - Patent sequence entries, part 42.
1467. gbpat43.seq - Patent sequence entries, part 43.
1468. gbpat44.seq - Patent sequence entries, part 44.
1469. gbpat45.seq - Patent sequence entries, part 45.
1470. gbpat46.seq - Patent sequence entries, part 46.
1471. gbpat5.seq - Patent sequence entries, part 5.
1472. gbpat6.seq - Patent sequence entries, part 6.
1473. gbpat7.seq - Patent sequence entries, part 7.
1474. gbpat8.seq - Patent sequence entries, part 8.
1475. gbpat9.seq - Patent sequence entries, part 9.
1476. gbphg.seq - Phage sequence entries.
1477. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1478. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1479. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1480. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1481. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1482. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1483. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1484. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1485. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1486. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1487. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1488. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1489. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1490. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1491. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1492. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1493. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1494. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1495. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1496. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1497. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1498. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1499. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1500. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1501. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1502. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1503. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1504. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1505. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1506. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1507. gbpri1.seq - Primate sequence entries, part 1.
1508. gbpri10.seq - Primate sequence entries, part 10.
1509. gbpri11.seq - Primate sequence entries, part 11.
1510. gbpri12.seq - Primate sequence entries, part 12.
1511. gbpri13.seq - Primate sequence entries, part 13.
1512. gbpri14.seq - Primate sequence entries, part 14.
1513. gbpri15.seq - Primate sequence entries, part 15.
1514. gbpri16.seq - Primate sequence entries, part 16.
1515. gbpri17.seq - Primate sequence entries, part 17.
1516. gbpri18.seq - Primate sequence entries, part 18.
1517. gbpri19.seq - Primate sequence entries, part 19.
1518. gbpri2.seq - Primate sequence entries, part 2.
1519. gbpri20.seq - Primate sequence entries, part 20.
1520. gbpri21.seq - Primate sequence entries, part 21.
1521. gbpri22.seq - Primate sequence entries, part 22.
1522. gbpri23.seq - Primate sequence entries, part 23.
1523. gbpri24.seq - Primate sequence entries, part 24.
1524. gbpri25.seq - Primate sequence entries, part 25.
1525. gbpri26.seq - Primate sequence entries, part 26.
1526. gbpri27.seq - Primate sequence entries, part 27.
1527. gbpri28.seq - Primate sequence entries, part 28.
1528. gbpri29.seq - Primate sequence entries, part 29.
1529. gbpri3.seq - Primate sequence entries, part 3.
1530. gbpri30.seq - Primate sequence entries, part 30.
1531. gbpri31.seq - Primate sequence entries, part 31.
1532. gbpri32.seq - Primate sequence entries, part 32.
1533. gbpri33.seq - Primate sequence entries, part 33.
1534. gbpri34.seq - Primate sequence entries, part 34.
1535. gbpri35.seq - Primate sequence entries, part 35.
1536. gbpri36.seq - Primate sequence entries, part 36.
1537. gbpri4.seq - Primate sequence entries, part 4.
1538. gbpri5.seq - Primate sequence entries, part 5.
1539. gbpri6.seq - Primate sequence entries, part 6.
1540. gbpri7.seq - Primate sequence entries, part 7.
1541. gbpri8.seq - Primate sequence entries, part 8.
1542. gbpri9.seq - Primate sequence entries, part 9.
1543. gbrel.txt - Release notes (this document).
1544. gbrod1.seq - Rodent sequence entries, part 1.
1545. gbrod10.seq - Rodent sequence entries, part 10.
1546. gbrod11.seq - Rodent sequence entries, part 11.
1547. gbrod12.seq - Rodent sequence entries, part 12.
1548. gbrod13.seq - Rodent sequence entries, part 13.
1549. gbrod14.seq - Rodent sequence entries, part 14.
1550. gbrod15.seq - Rodent sequence entries, part 15.
1551. gbrod16.seq - Rodent sequence entries, part 16.
1552. gbrod17.seq - Rodent sequence entries, part 17.
1553. gbrod18.seq - Rodent sequence entries, part 18.
1554. gbrod19.seq - Rodent sequence entries, part 19.
1555. gbrod2.seq - Rodent sequence entries, part 2.
1556. gbrod20.seq - Rodent sequence entries, part 20.
1557. gbrod21.seq - Rodent sequence entries, part 21.
1558. gbrod22.seq - Rodent sequence entries, part 22.
1559. gbrod23.seq - Rodent sequence entries, part 23.
1560. gbrod24.seq - Rodent sequence entries, part 24.
1561. gbrod25.seq - Rodent sequence entries, part 25.
1562. gbrod26.seq - Rodent sequence entries, part 26.
1563. gbrod3.seq - Rodent sequence entries, part 3.
1564. gbrod4.seq - Rodent sequence entries, part 4.
1565. gbrod5.seq - Rodent sequence entries, part 5.
1566. gbrod6.seq - Rodent sequence entries, part 6.
1567. gbrod7.seq - Rodent sequence entries, part 7.
1568. gbrod8.seq - Rodent sequence entries, part 8.
1569. gbrod9.seq - Rodent sequence entries, part 9.
1570. gbsdr1.txt - Short directory of the data bank, part 1.
1571. gbsdr2.txt - Short directory of the data bank, part 2.
1572. gbsdr3.txt - Short directory of the data bank, part 3.
1573. gbsec.idx - Index of the entries according to secondary accession number.
1574. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
1575. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
1576. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
1577. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
1578. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
1579. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
1580. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
1581. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
1582. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
1583. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
1584. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
1585. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
1586. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
1587. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
1588. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
1589. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
1590. gbtsa.seq - TSA (transcriptome shotgun assembly) sequence entries.
1591. gbuna.seq - Unannotated sequence entries.
1592. gbvrl1.seq - Viral sequence entries, part 1.
1593. gbvrl10.seq - Viral sequence entries, part 10.
1594. gbvrl2.seq - Viral sequence entries, part 2.
1595. gbvrl3.seq - Viral sequence entries, part 3.
1596. gbvrl4.seq - Viral sequence entries, part 4.
1597. gbvrl5.seq - Viral sequence entries, part 5.
1598. gbvrl6.seq - Viral sequence entries, part 6.
1599. gbvrl7.seq - Viral sequence entries, part 7.
1600. gbvrl8.seq - Viral sequence entries, part 8.
1601. gbvrl9.seq - Viral sequence entries, part 9.
1602. gbvrt1.seq - Other vertebrate sequence entries, part 1.
1603. gbvrt10.seq - Other vertebrate sequence entries, part 10.
1604. gbvrt11.seq - Other vertebrate sequence entries, part 11.
1605. gbvrt12.seq - Other vertebrate sequence entries, part 12.
1606. gbvrt13.seq - Other vertebrate sequence entries, part 13.
1607. gbvrt14.seq - Other vertebrate sequence entries, part 14.
1608. gbvrt15.seq - Other vertebrate sequence entries, part 15.
1609. gbvrt16.seq - Other vertebrate sequence entries, part 16.
1610. gbvrt2.seq - Other vertebrate sequence entries, part 2.
1611. gbvrt3.seq - Other vertebrate sequence entries, part 3.
1612. gbvrt4.seq - Other vertebrate sequence entries, part 4.
1613. gbvrt5.seq - Other vertebrate sequence entries, part 5.
1614. gbvrt6.seq - Other vertebrate sequence entries, part 6.
1615. gbvrt7.seq - Other vertebrate sequence entries, part 7.
1616. gbvrt8.seq - Other vertebrate sequence entries, part 8.
1617. gbvrt9.seq - Other vertebrate sequence entries, part 9.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 167.0 flatfiles require roughly 357 GB (sequence
files only) or 381 GB (including the 'short directory', 'index' and the
*.txt files). The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
780100423 gbacc1.idx
1804376616 gbacc2.idx
628914963 gbacc3.idx
238918373 gbaut1.idx
184342927 gbaut10.idx
184838442 gbaut11.idx
183872388 gbaut12.idx
225165568 gbaut13.idx
241279952 gbaut14.idx
252497843 gbaut15.idx
240983344 gbaut16.idx
184129451 gbaut17.idx
184168871 gbaut18.idx
183914697 gbaut19.idx
233735650 gbaut2.idx
183787332 gbaut20.idx
186846488 gbaut21.idx
198603546 gbaut22.idx
183764720 gbaut23.idx
183973246 gbaut24.idx
184328419 gbaut25.idx
183847365 gbaut26.idx
183639097 gbaut27.idx
220781272 gbaut28.idx
185071351 gbaut29.idx
183708230 gbaut3.idx
186396516 gbaut30.idx
188234295 gbaut31.idx
188404459 gbaut32.idx
184513820 gbaut33.idx
185627499 gbaut34.idx
185681682 gbaut35.idx
184500518 gbaut36.idx
184274256 gbaut37.idx
183728712 gbaut38.idx
183832471 gbaut39.idx
184886389 gbaut4.idx
185007068 gbaut40.idx
187553069 gbaut41.idx
212903201 gbaut42.idx
233859084 gbaut43.idx
187215960 gbaut44.idx
184928334 gbaut45.idx
207912176 gbaut46.idx
222932539 gbaut47.idx
228105666 gbaut48.idx
184984678 gbaut49.idx
250020531 gbaut5.idx
235436359 gbaut50.idx
184281062 gbaut51.idx
239142295 gbaut52.idx
183703478 gbaut53.idx
183858735 gbaut54.idx
186655786 gbaut55.idx
184756949 gbaut56.idx
184239186 gbaut57.idx
185967868 gbaut58.idx
145036791 gbaut59.idx
185544638 gbaut6.idx
184805009 gbaut7.idx
186271089 gbaut8.idx
184819928 gbaut9.idx
256569046 gbbct1.seq
255809926 gbbct10.seq
250682882 gbbct11.seq
251360417 gbbct12.seq
256138920 gbbct13.seq
255351775 gbbct14.seq
256612328 gbbct15.seq
250980809 gbbct16.seq
272143467 gbbct17.seq
250847047 gbbct18.seq
251598768 gbbct19.seq
253387342 gbbct2.seq
253401435 gbbct20.seq
254408565 gbbct21.seq
260569046 gbbct22.seq
259692982 gbbct23.seq
255061629 gbbct24.seq
257249409 gbbct25.seq
252456819 gbbct26.seq
256585747 gbbct27.seq
250002525 gbbct28.seq
250001860 gbbct29.seq
260920174 gbbct3.seq
232701989 gbbct30.seq
250004816 gbbct4.seq
250013643 gbbct5.seq
252396923 gbbct6.seq
251646875 gbbct7.seq
258783494 gbbct8.seq
250014862 gbbct9.seq
14625441 gbchg.txt
250191830 gbcon1.seq
250008277 gbcon10.seq
252904240 gbcon11.seq
250006510 gbcon12.seq
251113149 gbcon13.seq
250000541 gbcon14.seq
250005565 gbcon15.seq
250002594 gbcon16.seq
250000503 gbcon17.seq
250002092 gbcon18.seq
250036286 gbcon19.seq
251495535 gbcon2.seq
250000726 gbcon20.seq
250001292 gbcon21.seq
250001078 gbcon22.seq
250006315 gbcon23.seq
250002370 gbcon24.seq
250001365 gbcon25.seq
250000587 gbcon26.seq
250000155 gbcon27.seq
250000399 gbcon28.seq
250001146 gbcon29.seq
250119853 gbcon3.seq
250005244 gbcon30.seq
250001561 gbcon31.seq
250003323 gbcon32.seq
250001813 gbcon33.seq
250003486 gbcon34.seq
250002748 gbcon35.seq
250005619 gbcon36.seq
250004929 gbcon37.seq
250002120 gbcon38.seq
250005837 gbcon39.seq
250000457 gbcon4.seq
250001071 gbcon40.seq
250000308 gbcon41.seq
250004430 gbcon42.seq
250000576 gbcon43.seq
250000069 gbcon44.seq
250006375 gbcon45.seq
250001970 gbcon46.seq
250004036 gbcon47.seq
250004103 gbcon48.seq
250003544 gbcon49.seq
250000751 gbcon5.seq
250004779 gbcon50.seq
250000855 gbcon51.seq
250001006 gbcon52.seq
250001911 gbcon53.seq
250001180 gbcon54.seq
250000491 gbcon55.seq
250000531 gbcon56.seq
250000131 gbcon57.seq
250001394 gbcon58.seq
250000648 gbcon59.seq
250007297 gbcon6.seq
250000917 gbcon60.seq
250005218 gbcon61.seq
250003315 gbcon62.seq
250005275 gbcon63.seq
250004100 gbcon64.seq
250001532 gbcon65.seq
250002533 gbcon66.seq
250003589 gbcon67.seq
250003215 gbcon68.seq
250000608 gbcon69.seq
250001359 gbcon7.seq
250004484 gbcon70.seq
250004909 gbcon71.seq
250002779 gbcon72.seq
250002004 gbcon73.seq
250000445 gbcon74.seq
250000285 gbcon75.seq
250001671 gbcon76.seq
250002888 gbcon77.seq
250000131 gbcon78.seq
250004723 gbcon79.seq
250000873 gbcon8.seq
250001310 gbcon80.seq
250001054 gbcon81.seq
250005646 gbcon82.seq
250000060 gbcon83.seq
250003905 gbcon84.seq
250004259 gbcon85.seq
250004187 gbcon86.seq
250004116 gbcon87.seq
250000333 gbcon88.seq
250004294 gbcon89.seq
250006299 gbcon9.seq
250002412 gbcon90.seq
250003497 gbcon91.seq
250002501 gbcon92.seq
250004085 gbcon93.seq
250002161 gbcon94.seq
250001678 gbcon95.seq
199646369 gbcon96.seq
21418186 gbcon97.seq
106132 gbdel.txt
250001215 gbenv1.seq
44199440 gbenv10.seq
250000277 gbenv2.seq
250000388 gbenv3.seq
250000742 gbenv4.seq
250001188 gbenv5.seq
250000163 gbenv6.seq
250001460 gbenv7.seq
250000505 gbenv8.seq
250002323 gbenv9.seq
230688615 gbest1.seq
230687850 gbest10.seq
230688869 gbest100.seq
230688509 gbest101.seq
230687761 gbest102.seq
230690325 gbest103.seq
230689487 gbest104.seq
230688320 gbest105.seq
230688226 gbest106.seq
230689929 gbest107.seq
230688837 gbest108.seq
230688628 gbest109.seq
230688467 gbest11.seq
230688413 gbest110.seq
230687453 gbest111.seq
230689437 gbest112.seq
230689758 gbest113.seq
230691549 gbest114.seq
230692103 gbest115.seq
230688725 gbest116.seq
230689527 gbest117.seq
230687750 gbest118.seq
230535338 gbest119.seq
230689872 gbest12.seq
230688657 gbest120.seq
230689578 gbest121.seq
230688691 gbest122.seq
230689238 gbest123.seq
230690215 gbest124.seq
230689367 gbest125.seq
230689909 gbest126.seq
230687858 gbest127.seq
230688620 gbest128.seq
230688224 gbest129.seq
230689821 gbest13.seq
230689575 gbest130.seq
230689241 gbest131.seq
230689717 gbest132.seq
230688836 gbest133.seq
230689764 gbest134.seq
230687650 gbest135.seq
230689603 gbest136.seq
230689684 gbest137.seq
230688476 gbest138.seq
230688035 gbest139.seq
230690064 gbest14.seq
230690794 gbest140.seq
230687462 gbest141.seq
230690334 gbest142.seq
230687906 gbest143.seq
230689493 gbest144.seq
230688893 gbest145.seq
230690268 gbest146.seq
230690664 gbest147.seq
230687629 gbest148.seq
230688776 gbest149.seq
230689448 gbest15.seq
230687807 gbest150.seq
230689702 gbest151.seq
230687648 gbest152.seq
230688409 gbest153.seq
230690929 gbest154.seq
230688809 gbest155.seq
230689336 gbest156.seq
230688462 gbest157.seq
230688190 gbest158.seq
230688555 gbest159.seq
230688640 gbest16.seq
230687967 gbest160.seq
230689480 gbest161.seq
230688463 gbest162.seq
230687965 gbest163.seq
230690896 gbest164.seq
230690671 gbest165.seq
230688433 gbest166.seq
230690152 gbest167.seq
230690624 gbest168.seq
230687942 gbest169.seq
230688616 gbest17.seq
230690418 gbest170.seq
230689977 gbest171.seq
230689503 gbest172.seq
230690337 gbest173.seq
230688265 gbest174.seq
230688525 gbest175.seq
230687708 gbest176.seq
230687851 gbest177.seq
230689289 gbest178.seq
230688666 gbest179.seq
230689787 gbest18.seq
218651035 gbest180.seq
230688169 gbest181.seq
230687890 gbest182.seq
230688795 gbest183.seq
230691288 gbest184.seq
230688139 gbest185.seq
230687514 gbest186.seq
230689655 gbest187.seq
230689490 gbest188.seq
230690633 gbest189.seq
230689707 gbest19.seq
230687953 gbest190.seq
230690099 gbest191.seq
230691812 gbest192.seq
230689203 gbest193.seq
230690233 gbest194.seq
230688390 gbest195.seq
230688592 gbest196.seq
230688809 gbest197.seq
230689207 gbest198.seq
230690600 gbest199.seq
230689833 gbest2.seq
230688635 gbest20.seq
230690018 gbest200.seq
230688047 gbest201.seq
230689348 gbest202.seq
230689334 gbest203.seq
230690977 gbest204.seq
230688704 gbest205.seq
230690841 gbest206.seq
230688940 gbest207.seq
230689411 gbest208.seq
230687519 gbest209.seq
230688774 gbest21.seq
230688247 gbest210.seq
230688648 gbest211.seq
230689026 gbest212.seq
230689424 gbest213.seq
230687525 gbest214.seq
230688452 gbest215.seq
230689119 gbest216.seq
230687859 gbest217.seq
230688276 gbest218.seq
230689769 gbest219.seq
230688401 gbest22.seq
230688675 gbest220.seq
230690959 gbest221.seq
230689535 gbest222.seq
230690450 gbest223.seq
230689102 gbest224.seq
230690206 gbest225.seq
230688717 gbest226.seq
230689986 gbest227.seq
230689681 gbest228.seq
230689546 gbest229.seq
230689475 gbest23.seq
183718735 gbest230.seq
161530825 gbest231.seq
162793143 gbest232.seq
170073688 gbest233.seq
169000543 gbest234.seq
162335322 gbest235.seq
164000064 gbest236.seq
163571066 gbest237.seq
162945086 gbest238.seq
163491161 gbest239.seq
230688532 gbest24.seq
162977230 gbest240.seq
163117190 gbest241.seq
161800884 gbest242.seq
167280080 gbest243.seq
161254058 gbest244.seq
162175175 gbest245.seq
166648398 gbest246.seq
166406146 gbest247.seq
164737796 gbest248.seq
164576554 gbest249.seq
230688793 gbest25.seq
164255308 gbest250.seq
164026196 gbest251.seq
163108634 gbest252.seq
163113005 gbest253.seq
164272402 gbest254.seq
165521019 gbest255.seq
179895945 gbest256.seq
169985881 gbest257.seq
198815132 gbest258.seq
230689190 gbest259.seq
230688426 gbest26.seq
230687701 gbest260.seq
230689434 gbest261.seq
230690530 gbest262.seq
230688336 gbest263.seq
230689664 gbest264.seq
230687539 gbest265.seq
230688778 gbest266.seq
230690712 gbest267.seq
230691222 gbest268.seq
230688861 gbest269.seq
230688935 gbest27.seq
230688160 gbest270.seq
230689068 gbest271.seq
230689136 gbest272.seq
230689742 gbest273.seq
230687443 gbest274.seq
230691095 gbest275.seq
230690305 gbest276.seq
230688753 gbest277.seq
230689065 gbest278.seq
230690106 gbest279.seq
230688309 gbest28.seq
230689526 gbest280.seq
230688955 gbest281.seq
230688264 gbest282.seq
230688896 gbest283.seq
230690087 gbest284.seq
230688792 gbest285.seq
230690448 gbest286.seq
230688889 gbest287.seq
230689785 gbest288.seq
230687814 gbest289.seq
230689384 gbest29.seq
207616669 gbest290.seq
230687637 gbest291.seq
230687768 gbest292.seq
230689297 gbest293.seq
230688593 gbest294.seq
230689023 gbest295.seq
230689008 gbest296.seq
230689393 gbest297.seq
230689036 gbest298.seq
230687738 gbest299.seq
230690315 gbest3.seq
230687687 gbest30.seq
230688109 gbest300.seq
230688212 gbest301.seq
230688143 gbest302.seq
230689637 gbest303.seq
230689608 gbest304.seq
230689507 gbest305.seq
230689388 gbest306.seq
230688078 gbest307.seq
230687579 gbest308.seq
230689336 gbest309.seq
230689869 gbest31.seq
230689688 gbest310.seq
230690447 gbest311.seq
230689067 gbest312.seq
230690579 gbest313.seq
230687769 gbest314.seq
230688080 gbest315.seq
230690097 gbest316.seq
230690367 gbest317.seq
230689182 gbest318.seq
230688934 gbest319.seq
230688885 gbest32.seq
230690668 gbest320.seq
230689396 gbest321.seq
230688198 gbest322.seq
230688383 gbest323.seq
230691193 gbest324.seq
230689614 gbest325.seq
230687514 gbest326.seq
230690810 gbest327.seq
230688354 gbest328.seq
230687506 gbest329.seq
230688605 gbest33.seq
230688695 gbest330.seq
230688383 gbest331.seq
230689676 gbest332.seq
230688996 gbest333.seq
230688150 gbest334.seq
230688751 gbest335.seq
230688552 gbest336.seq
230688758 gbest337.seq
230688457 gbest338.seq
230687951 gbest339.seq
230690249 gbest34.seq
230687545 gbest340.seq
208998489 gbest341.seq
230688800 gbest342.seq
230692161 gbest343.seq
230689213 gbest344.seq
230689279 gbest345.seq
230689275 gbest346.seq
230691162 gbest347.seq
156568781 gbest348.seq
165315954 gbest349.seq
230687458 gbest35.seq
230687574 gbest350.seq
230690465 gbest351.seq
230689915 gbest352.seq
230690406 gbest353.seq
230688810 gbest354.seq
230689957 gbest355.seq
230689322 gbest356.seq
230687463 gbest357.seq
230687859 gbest358.seq
230689562 gbest359.seq
230687454 gbest36.seq
230687633 gbest360.seq
230689470 gbest361.seq
230689957 gbest362.seq
230688585 gbest363.seq
230687890 gbest364.seq
230689533 gbest365.seq
230688045 gbest366.seq
230687448 gbest367.seq
230688070 gbest368.seq
230688955 gbest369.seq
230687654 gbest37.seq
230687736 gbest370.seq
230690308 gbest371.seq
230688110 gbest372.seq
230689458 gbest373.seq
230690593 gbest374.seq
230687537 gbest375.seq
230689131 gbest376.seq
230687529 gbest377.seq
230689006 gbest378.seq
230689166 gbest379.seq
230689034 gbest38.seq
230691003 gbest380.seq
230691090 gbest381.seq
230693882 gbest382.seq
230690694 gbest383.seq
230689154 gbest384.seq
230689472 gbest385.seq
230687924 gbest386.seq
230688935 gbest387.seq
230687506 gbest388.seq
230689598 gbest389.seq
230688681 gbest39.seq
230689366 gbest390.seq
230689467 gbest391.seq
230688936 gbest392.seq
230688189 gbest393.seq
228301612 gbest394.seq
230687549 gbest395.seq
230689419 gbest396.seq
230688873 gbest397.seq
230688721 gbest398.seq
230688474 gbest399.seq
230688895 gbest4.seq
230690234 gbest40.seq
222422943 gbest400.seq
230688487 gbest401.seq
230691045 gbest402.seq
230689229 gbest403.seq
230687696 gbest404.seq
230690905 gbest405.seq
230687835 gbest406.seq
228299276 gbest407.seq
230688402 gbest408.seq
230691659 gbest409.seq
230690108 gbest41.seq
230687554 gbest410.seq
230689092 gbest411.seq
230687533 gbest412.seq
230689601 gbest413.seq
230691219 gbest414.seq
230691418 gbest415.seq
230690430 gbest416.seq
230689117 gbest417.seq
230687500 gbest418.seq
230690683 gbest419.seq
230687562 gbest42.seq
230688396 gbest420.seq
230691417 gbest421.seq
230690533 gbest422.seq
230691040 gbest423.seq
230688220 gbest424.seq
214065042 gbest425.seq
208306068 gbest426.seq
208237617 gbest427.seq
208397032 gbest428.seq
208342578 gbest429.seq
230688726 gbest43.seq
208513158 gbest430.seq
209045605 gbest431.seq
209895962 gbest432.seq
209570074 gbest433.seq
209368489 gbest434.seq
212316435 gbest435.seq
209549732 gbest436.seq
208688664 gbest437.seq
208780164 gbest438.seq
208891878 gbest439.seq
230689843 gbest44.seq
208236395 gbest440.seq
208248664 gbest441.seq
208281343 gbest442.seq
208155482 gbest443.seq
215561097 gbest444.seq
230687788 gbest445.seq
230688725 gbest446.seq
230688530 gbest447.seq
230687968 gbest448.seq
230688425 gbest449.seq
230689355 gbest45.seq
230689025 gbest450.seq
230687882 gbest451.seq
230687976 gbest452.seq
230688862 gbest453.seq
230687748 gbest454.seq
230689859 gbest455.seq
230687468 gbest456.seq
230689019 gbest457.seq
230689151 gbest458.seq
230688020 gbest459.seq
226803956 gbest46.seq
230688229 gbest460.seq
230688802 gbest461.seq
230687778 gbest462.seq
230689089 gbest463.seq
230691538 gbest464.seq
230687456 gbest465.seq
230687525 gbest466.seq
230689700 gbest467.seq
230687998 gbest468.seq
230689340 gbest469.seq
189302383 gbest47.seq
230688240 gbest470.seq
230689586 gbest471.seq
230689016 gbest472.seq
230689022 gbest473.seq
230687901 gbest474.seq
230688493 gbest475.seq
230687914 gbest476.seq
230690386 gbest477.seq
230688798 gbest478.seq
230690678 gbest479.seq
188238364 gbest48.seq
230687697 gbest480.seq
230688950 gbest481.seq
230688559 gbest482.seq
230690011 gbest483.seq
230688400 gbest484.seq
230688040 gbest485.seq
230689284 gbest486.seq
230688834 gbest487.seq
230687513 gbest488.seq
230691849 gbest489.seq
212041800 gbest49.seq
230690841 gbest490.seq
230691066 gbest491.seq
230690243 gbest492.seq
230691422 gbest493.seq
230688655 gbest494.seq
230689293 gbest495.seq
230688562 gbest496.seq
230687938 gbest497.seq
230688817 gbest498.seq
230688923 gbest499.seq
164142208 gbest5.seq
214975578 gbest50.seq
230688175 gbest500.seq
230688178 gbest501.seq
230687680 gbest502.seq
230689042 gbest503.seq
230689459 gbest504.seq
230688564 gbest505.seq
230689677 gbest506.seq
230690670 gbest507.seq
230688320 gbest508.seq
230690415 gbest509.seq
214660799 gbest51.seq
230691583 gbest510.seq
230688194 gbest511.seq
230689338 gbest512.seq
230690137 gbest513.seq
230689310 gbest514.seq
230690567 gbest515.seq
230689284 gbest516.seq
230688491 gbest517.seq
230689156 gbest518.seq
230688149 gbest519.seq
215733408 gbest52.seq
224236411 gbest520.seq
227952054 gbest521.seq
230690283 gbest522.seq
230688088 gbest523.seq
230689817 gbest524.seq
230689731 gbest525.seq
230688005 gbest526.seq
230688608 gbest527.seq
230689425 gbest528.seq
230691097 gbest529.seq
230689823 gbest53.seq
230691695 gbest530.seq
230689827 gbest531.seq
230687571 gbest532.seq
230688892 gbest533.seq
230687792 gbest534.seq
212025904 gbest535.seq
196105118 gbest536.seq
230689321 gbest537.seq
230688641 gbest538.seq
230689700 gbest539.seq
230688066 gbest54.seq
230687474 gbest540.seq
230689952 gbest541.seq
230688853 gbest542.seq
230688272 gbest543.seq
230689294 gbest544.seq
230690270 gbest545.seq
230688576 gbest546.seq
230689319 gbest547.seq
230688387 gbest548.seq
230689007 gbest549.seq
230689630 gbest55.seq
222117881 gbest550.seq
230689873 gbest551.seq
230689243 gbest552.seq
230690126 gbest553.seq
230688910 gbest554.seq
230690115 gbest555.seq
230688247 gbest556.seq
230689055 gbest557.seq
220004338 gbest558.seq
224245840 gbest559.seq
220092159 gbest56.seq
230688771 gbest560.seq
230690730 gbest561.seq
230688316 gbest562.seq
230688110 gbest563.seq
230688118 gbest564.seq
230689034 gbest565.seq
230687707 gbest566.seq
230688899 gbest567.seq
230689510 gbest568.seq
230689512 gbest569.seq
230688198 gbest57.seq
230688023 gbest570.seq
230687780 gbest571.seq
230687920 gbest572.seq
230687801 gbest573.seq
230689618 gbest574.seq
230688881 gbest575.seq
230688340 gbest576.seq
230689814 gbest577.seq
230688016 gbest578.seq
230687554 gbest579.seq
230688706 gbest58.seq
230688303 gbest580.seq
230690810 gbest581.seq
230688785 gbest582.seq
230689095 gbest583.seq
230687661 gbest584.seq
230689682 gbest585.seq
230690069 gbest586.seq
230690315 gbest587.seq
230690927 gbest588.seq
230687458 gbest589.seq
230687941 gbest59.seq
230688322 gbest590.seq
230688935 gbest591.seq
230689045 gbest592.seq
230689064 gbest593.seq
230689570 gbest594.seq
230687722 gbest595.seq
230693393 gbest596.seq
230688686 gbest597.seq
230690589 gbest598.seq
230688783 gbest599.seq
177420861 gbest6.seq
230689505 gbest60.seq
230690960 gbest600.seq
230690546 gbest601.seq
230689977 gbest602.seq
230688658 gbest603.seq
230687641 gbest604.seq
230688591 gbest605.seq
230688731 gbest606.seq
230687568 gbest607.seq
230688047 gbest608.seq
230690413 gbest609.seq
230687824 gbest61.seq
230690038 gbest610.seq
230689737 gbest611.seq
230687465 gbest612.seq
230690972 gbest613.seq
230687716 gbest614.seq
230687804 gbest615.seq
230689288 gbest616.seq
230688418 gbest617.seq
230687713 gbest618.seq
230689120 gbest619.seq
230689172 gbest62.seq
230690740 gbest620.seq
230690879 gbest621.seq
230690297 gbest622.seq
230690598 gbest623.seq
230691534 gbest624.seq
230688889 gbest625.seq
230690084 gbest626.seq
230689581 gbest627.seq
230687869 gbest628.seq
230690501 gbest629.seq
230690963 gbest63.seq
230687590 gbest630.seq
230688700 gbest631.seq
230689618 gbest632.seq
230230315 gbest633.seq
230688247 gbest634.seq
230687454 gbest635.seq
226583032 gbest636.seq
217269971 gbest637.seq
230690198 gbest638.seq
226893280 gbest639.seq
230688690 gbest64.seq
190655583 gbest640.seq
190464797 gbest641.seq
193213289 gbest642.seq
192383239 gbest643.seq
191540204 gbest644.seq
191868778 gbest645.seq
193110854 gbest646.seq
191955986 gbest647.seq
191041163 gbest648.seq
191604560 gbest649.seq
230688603 gbest65.seq
230690303 gbest650.seq
230689551 gbest651.seq
230687788 gbest652.seq
230688009 gbest653.seq
230688581 gbest654.seq
230688847 gbest655.seq
230687454 gbest656.seq
172219918 gbest657.seq
192589291 gbest658.seq
230691133 gbest659.seq
230691420 gbest66.seq
230691665 gbest660.seq
230689036 gbest661.seq
230690328 gbest662.seq
230687553 gbest663.seq
230688494 gbest664.seq
230688528 gbest665.seq
230688942 gbest666.seq
230689395 gbest667.seq
230687446 gbest668.seq
230688994 gbest669.seq
230687893 gbest67.seq
230690488 gbest670.seq
230688913 gbest671.seq
230689113 gbest672.seq
230689491 gbest673.seq
230689984 gbest674.seq
230687711 gbest675.seq
230688683 gbest676.seq
230689458 gbest677.seq
230690308 gbest678.seq
230688757 gbest679.seq
230687898 gbest68.seq
230687584 gbest680.seq
230687572 gbest681.seq
230688795 gbest682.seq
230687757 gbest683.seq
230690347 gbest684.seq
230690350 gbest685.seq
230688086 gbest686.seq
230690643 gbest687.seq
230687725 gbest688.seq
230689097 gbest689.seq
230690225 gbest69.seq
230690927 gbest690.seq
230688275 gbest691.seq
230688726 gbest692.seq
230690317 gbest693.seq
230688943 gbest694.seq
230690295 gbest695.seq
230688461 gbest696.seq
230689943 gbest697.seq
230689217 gbest698.seq
230689890 gbest699.seq
230687843 gbest7.seq
230689631 gbest70.seq
230689216 gbest700.seq
230690693 gbest701.seq
230687618 gbest702.seq
230688818 gbest703.seq
230688097 gbest704.seq
230689545 gbest705.seq
230689331 gbest706.seq
230691620 gbest707.seq
230689362 gbest708.seq
230690006 gbest709.seq
230689727 gbest71.seq
230688698 gbest710.seq
230691604 gbest711.seq
230689801 gbest712.seq
230687902 gbest713.seq
230689342 gbest714.seq
230689412 gbest715.seq
230690149 gbest716.seq
230690014 gbest717.seq
230689098 gbest718.seq
205049461 gbest719.seq
230690630 gbest72.seq
230233471 gbest720.seq
230687723 gbest721.seq
230688759 gbest722.seq
230688021 gbest723.seq
230689377 gbest724.seq
230688895 gbest725.seq
230689961 gbest726.seq
230689591 gbest727.seq
230689648 gbest728.seq
230688902 gbest729.seq
208414042 gbest73.seq
230690635 gbest730.seq
230689520 gbest731.seq
230687844 gbest732.seq
230688053 gbest733.seq
230687652 gbest734.seq
230687629 gbest735.seq
230688792 gbest736.seq
230690498 gbest737.seq
230689655 gbest738.seq
230688624 gbest739.seq
208099030 gbest74.seq
230693198 gbest740.seq
230691169 gbest741.seq
230694127 gbest742.seq
230687529 gbest743.seq
230688244 gbest744.seq
230689452 gbest745.seq
230688569 gbest746.seq
230690559 gbest747.seq
230689279 gbest748.seq
230688917 gbest749.seq
207479563 gbest75.seq
230690686 gbest750.seq
230690092 gbest751.seq
230688613 gbest752.seq
230687479 gbest753.seq
230689969 gbest754.seq
230689152 gbest755.seq
230688993 gbest756.seq
230690056 gbest757.seq
230688086 gbest758.seq
230690175 gbest759.seq
207707529 gbest76.seq
220212189 gbest760.seq
230690825 gbest761.seq
207117404 gbest762.seq
209064869 gbest77.seq
208612058 gbest78.seq
207447123 gbest79.seq
230688355 gbest8.seq
207995601 gbest80.seq
209387840 gbest81.seq
205233207 gbest82.seq
205412032 gbest83.seq
206891831 gbest84.seq
207289349 gbest85.seq
214665212 gbest86.seq
230688022 gbest87.seq
230688092 gbest88.seq
228953855 gbest89.seq
230689573 gbest9.seq
214117242 gbest90.seq
213019393 gbest91.seq
218697307 gbest92.seq
230690002 gbest93.seq
230688550 gbest94.seq
230687524 gbest95.seq
230689734 gbest96.seq
230688281 gbest97.seq
230690005 gbest98.seq
230689916 gbest99.seq
90319124 gbgen.idx
230688999 gbgss1.seq
230690079 gbgss10.seq
230689050 gbgss100.seq
227721222 gbgss101.seq
228841700 gbgss102.seq
228555080 gbgss103.seq
228589280 gbgss104.seq
227709541 gbgss105.seq
230687905 gbgss106.seq
230689673 gbgss107.seq
230688375 gbgss108.seq
230688720 gbgss109.seq
230689764 gbgss11.seq
230689380 gbgss110.seq
230687472 gbgss111.seq
230689449 gbgss112.seq
230688452 gbgss113.seq
230688492 gbgss114.seq
230689280 gbgss115.seq
230687746 gbgss116.seq
230690108 gbgss117.seq
230689688 gbgss118.seq
230688196 gbgss119.seq
230687679 gbgss12.seq
230688153 gbgss120.seq
230688409 gbgss121.seq
230688419 gbgss122.seq
230687706 gbgss123.seq
230690388 gbgss124.seq
230688886 gbgss125.seq
230688651 gbgss126.seq
230688733 gbgss127.seq
230688982 gbgss128.seq
230687639 gbgss129.seq
230690347 gbgss13.seq
230689760 gbgss130.seq
230687534 gbgss131.seq
230688957 gbgss132.seq
230687960 gbgss133.seq
230688758 gbgss134.seq
230689807 gbgss135.seq
230689241 gbgss136.seq
230690256 gbgss137.seq
230688873 gbgss138.seq
230688252 gbgss139.seq
230689893 gbgss14.seq
230687963 gbgss140.seq
230689869 gbgss141.seq
230689101 gbgss142.seq
230688539 gbgss143.seq
230689376 gbgss144.seq
224492863 gbgss145.seq
230688138 gbgss146.seq
230688663 gbgss147.seq
198416753 gbgss148.seq
230688611 gbgss149.seq
230689648 gbgss15.seq
230689771 gbgss150.seq
230687903 gbgss151.seq
230689361 gbgss152.seq
230690090 gbgss153.seq
230689742 gbgss154.seq
230688366 gbgss155.seq
230688215 gbgss156.seq
230688295 gbgss157.seq
230688094 gbgss158.seq
230688109 gbgss159.seq
230689778 gbgss16.seq
230687651 gbgss160.seq
230690072 gbgss161.seq
230688469 gbgss162.seq
230690490 gbgss163.seq
230687819 gbgss164.seq
230687619 gbgss165.seq
230688502 gbgss166.seq
230688122 gbgss167.seq
230688380 gbgss168.seq
230689184 gbgss169.seq
230688655 gbgss17.seq
230652980 gbgss170.seq
230688943 gbgss171.seq
230692349 gbgss172.seq
230689145 gbgss173.seq
214062351 gbgss174.seq
207654151 gbgss175.seq
210072912 gbgss176.seq
210674578 gbgss177.seq
209665565 gbgss178.seq
209396091 gbgss179.seq
230688580 gbgss18.seq
207488307 gbgss180.seq
207258509 gbgss181.seq
207742947 gbgss182.seq
209325720 gbgss183.seq
209295926 gbgss184.seq
208571354 gbgss185.seq
205838016 gbgss186.seq
205585204 gbgss187.seq
205282901 gbgss188.seq
205441891 gbgss189.seq
230688247 gbgss19.seq
205290251 gbgss190.seq
206109754 gbgss191.seq
207526871 gbgss192.seq
208603823 gbgss193.seq
207866277 gbgss194.seq
207973328 gbgss195.seq
208760685 gbgss196.seq
208865693 gbgss197.seq
208877076 gbgss198.seq
205750924 gbgss199.seq
230688628 gbgss2.seq
230689216 gbgss20.seq
206163101 gbgss200.seq
206444174 gbgss201.seq
205503672 gbgss202.seq
206051073 gbgss203.seq
207299104 gbgss204.seq
207139897 gbgss205.seq
207107032 gbgss206.seq
207232896 gbgss207.seq
207054507 gbgss208.seq
207148365 gbgss209.seq
230687583 gbgss21.seq
206854570 gbgss210.seq
206972921 gbgss211.seq
206664734 gbgss212.seq
207898107 gbgss213.seq
207892769 gbgss214.seq
209451332 gbgss215.seq
210070285 gbgss216.seq
209270081 gbgss217.seq
210252752 gbgss218.seq
218277243 gbgss219.seq
230690343 gbgss22.seq
218860455 gbgss220.seq
230688503 gbgss221.seq
230687448 gbgss222.seq
230690120 gbgss223.seq
230688011 gbgss224.seq
230688497 gbgss225.seq
230687474 gbgss226.seq
217916744 gbgss227.seq
217930084 gbgss228.seq
230688583 gbgss229.seq
230689056 gbgss23.seq
230688989 gbgss230.seq
230688755 gbgss231.seq
230688629 gbgss232.seq
230689541 gbgss233.seq
230687718 gbgss234.seq
230689969 gbgss235.seq
230687537 gbgss236.seq
230687497 gbgss237.seq
230688628 gbgss238.seq
230687957 gbgss239.seq
230687549 gbgss24.seq
230688504 gbgss240.seq
230689891 gbgss241.seq
230689321 gbgss242.seq
230689015 gbgss243.seq
230687572 gbgss244.seq
230688997 gbgss245.seq
230687992 gbgss246.seq
143552529 gbgss247.seq
250000654 gbgss248.seq
250001101 gbgss249.seq
230689248 gbgss25.seq
250001260 gbgss250.seq
250000873 gbgss251.seq
250001373 gbgss252.seq
250002756 gbgss253.seq
250001341 gbgss254.seq
250000021 gbgss255.seq
250002458 gbgss256.seq
250001722 gbgss257.seq
250001048 gbgss258.seq
250000337 gbgss259.seq
230689875 gbgss26.seq
250002275 gbgss260.seq
250000607 gbgss261.seq
250001919 gbgss262.seq
250001148 gbgss263.seq
250002310 gbgss264.seq
250001208 gbgss265.seq
250003287 gbgss266.seq
250002153 gbgss267.seq
250001627 gbgss268.seq
250000972 gbgss269.seq
230689928 gbgss27.seq
250000768 gbgss270.seq
250001256 gbgss271.seq
250001663 gbgss272.seq
250002105 gbgss273.seq
250001640 gbgss274.seq
250001752 gbgss275.seq
250002011 gbgss276.seq
250000930 gbgss277.seq
250000329 gbgss278.seq
250000039 gbgss279.seq
230687453 gbgss28.seq
250000843 gbgss280.seq
250000066 gbgss281.seq
250000769 gbgss282.seq
250002225 gbgss283.seq
250000183 gbgss284.seq
250000617 gbgss285.seq
250000399 gbgss286.seq
250000369 gbgss287.seq
250001012 gbgss288.seq
250000635 gbgss289.seq
230688970 gbgss29.seq
250000768 gbgss290.seq
250000371 gbgss291.seq
250000570 gbgss292.seq
250000910 gbgss293.seq
250001765 gbgss294.seq
250000350 gbgss295.seq
250000703 gbgss296.seq
250002632 gbgss297.seq
250001386 gbgss298.seq
250000231 gbgss299.seq
230689286 gbgss3.seq
230689804 gbgss30.seq
250001359 gbgss300.seq
250000885 gbgss301.seq
250000502 gbgss302.seq
250000273 gbgss303.seq
250002912 gbgss304.seq
250002625 gbgss305.seq
78965989 gbgss306.seq
230690386 gbgss31.seq
230688120 gbgss32.seq
230689077 gbgss33.seq
230687452 gbgss34.seq
230687659 gbgss35.seq
230689742 gbgss36.seq
230687950 gbgss37.seq
230687910 gbgss38.seq
230688690 gbgss39.seq
230688064 gbgss4.seq
230688763 gbgss40.seq
230688108 gbgss41.seq
230689834 gbgss42.seq
230688239 gbgss43.seq
230689976 gbgss44.seq
230690129 gbgss45.seq
230690373 gbgss46.seq
230687984 gbgss47.seq
230688577 gbgss48.seq
230689402 gbgss49.seq
230688342 gbgss5.seq
230687899 gbgss50.seq
230688301 gbgss51.seq
230688675 gbgss52.seq
230690514 gbgss53.seq
230689734 gbgss54.seq
230689855 gbgss55.seq
230687670 gbgss56.seq
230689635 gbgss57.seq
230687843 gbgss58.seq
230689656 gbgss59.seq
230689182 gbgss6.seq
230688852 gbgss60.seq
229013602 gbgss61.seq
230689901 gbgss62.seq
230689630 gbgss63.seq
230688268 gbgss64.seq
230689994 gbgss65.seq
230688671 gbgss66.seq
230689287 gbgss67.seq
230689792 gbgss68.seq
230689440 gbgss69.seq
230687458 gbgss7.seq
230689415 gbgss70.seq
230688319 gbgss71.seq
230687852 gbgss72.seq
230689709 gbgss73.seq
230689262 gbgss74.seq
230687590 gbgss75.seq
230688251 gbgss76.seq
230689034 gbgss77.seq
230688794 gbgss78.seq
230687678 gbgss79.seq
230690430 gbgss8.seq
230688851 gbgss80.seq
225373654 gbgss81.seq
194177396 gbgss82.seq
194314068 gbgss83.seq
230687821 gbgss84.seq
230687666 gbgss85.seq
230687504 gbgss86.seq
230688352 gbgss87.seq
230689471 gbgss88.seq
230688089 gbgss89.seq
230689298 gbgss9.seq
230688277 gbgss90.seq
230688150 gbgss91.seq
230688202 gbgss92.seq
230688460 gbgss93.seq
230687466 gbgss94.seq
230689879 gbgss95.seq
230690080 gbgss96.seq
230688997 gbgss97.seq
230688431 gbgss98.seq
230689413 gbgss99.seq
250005013 gbhtc1.seq
250000382 gbhtc10.seq
250001536 gbhtc11.seq
250003577 gbhtc12.seq
32005889 gbhtc13.seq
250016614 gbhtc2.seq
250005704 gbhtc3.seq
250002242 gbhtc4.seq
250012415 gbhtc5.seq
250007005 gbhtc6.seq
250002604 gbhtc7.seq
250003016 gbhtc8.seq
250001746 gbhtc9.seq
250095791 gbhtg1.seq
250059678 gbhtg10.seq
250130499 gbhtg100.seq
250105228 gbhtg101.seq
250143865 gbhtg102.seq
250249693 gbhtg103.seq
250177163 gbhtg104.seq
250089445 gbhtg105.seq
250159944 gbhtg106.seq
250832270 gbhtg107.seq
250002476 gbhtg108.seq
250246262 gbhtg109.seq
250041996 gbhtg11.seq
250128050 gbhtg110.seq
250152887 gbhtg111.seq
250146952 gbhtg112.seq
250025721 gbhtg113.seq
250014103 gbhtg114.seq
250146606 gbhtg115.seq
250066810 gbhtg116.seq
250016279 gbhtg117.seq
250162741 gbhtg118.seq
250159008 gbhtg119.seq
250314169 gbhtg12.seq
49574247 gbhtg120.seq
250259212 gbhtg13.seq
250032870 gbhtg14.seq
250130174 gbhtg15.seq
250073392 gbhtg16.seq
250176119 gbhtg17.seq
250090632 gbhtg18.seq
250144332 gbhtg19.seq
250020826 gbhtg2.seq
250179509 gbhtg20.seq
250079453 gbhtg21.seq
250030789 gbhtg22.seq
250231672 gbhtg23.seq
250255351 gbhtg24.seq
250093456 gbhtg25.seq
250291231 gbhtg26.seq
250254656 gbhtg27.seq
250248428 gbhtg28.seq
250048864 gbhtg29.seq
250039055 gbhtg3.seq
250013141 gbhtg30.seq
250161065 gbhtg31.seq
250189327 gbhtg32.seq
250060740 gbhtg33.seq
250096739 gbhtg34.seq
250083825 gbhtg35.seq
250180043 gbhtg36.seq
250174307 gbhtg37.seq
250040490 gbhtg38.seq
250252095 gbhtg39.seq
250101900 gbhtg4.seq
250056626 gbhtg40.seq
250000322 gbhtg41.seq
250114720 gbhtg42.seq
250368305 gbhtg43.seq
250027341 gbhtg44.seq
250140717 gbhtg45.seq
250163862 gbhtg46.seq
250071075 gbhtg47.seq
250260503 gbhtg48.seq
250043222 gbhtg49.seq
250209197 gbhtg5.seq
250471875 gbhtg50.seq
250063130 gbhtg51.seq
250144643 gbhtg52.seq
250160676 gbhtg53.seq
250265864 gbhtg54.seq
250222720 gbhtg55.seq
250135863 gbhtg56.seq
250095864 gbhtg57.seq
250220973 gbhtg58.seq
250167645 gbhtg59.seq
250053316 gbhtg6.seq
250135184 gbhtg60.seq
250275134 gbhtg61.seq
250231778 gbhtg62.seq
250299796 gbhtg63.seq
250027084 gbhtg64.seq
250210290 gbhtg65.seq
250017381 gbhtg66.seq
250095267 gbhtg67.seq
250028396 gbhtg68.seq
250142774 gbhtg69.seq
250004175 gbhtg7.seq
250067231 gbhtg70.seq
250004282 gbhtg71.seq
250198947 gbhtg72.seq
250006729 gbhtg73.seq
250198444 gbhtg74.seq
250061475 gbhtg75.seq
250147666 gbhtg76.seq
250174732 gbhtg77.seq
250118043 gbhtg78.seq
250153181 gbhtg79.seq
250124023 gbhtg8.seq
250042986 gbhtg80.seq
250021913 gbhtg81.seq
250016800 gbhtg82.seq
250088435 gbhtg83.seq
250001165 gbhtg84.seq
250213146 gbhtg85.seq
250133193 gbhtg86.seq
250101318 gbhtg87.seq
250124391 gbhtg88.seq
250114104 gbhtg89.seq
250009870 gbhtg9.seq
250065812 gbhtg90.seq
250101084 gbhtg91.seq
250097346 gbhtg92.seq
250025925 gbhtg93.seq
250102824 gbhtg94.seq
250160601 gbhtg95.seq
250154101 gbhtg96.seq
250218820 gbhtg97.seq
250329104 gbhtg98.seq
250212619 gbhtg99.seq
250067565 gbinv1.seq
250001024 gbinv10.seq
250000353 gbinv11.seq
250049946 gbinv12.seq
70670645 gbinv13.seq
250223415 gbinv2.seq
267725207 gbinv3.seq
250002066 gbinv4.seq
250332081 gbinv5.seq
250001749 gbinv6.seq
250000319 gbinv7.seq
250003537 gbinv8.seq
250005069 gbinv9.seq
150689630 gbjou1.idx
140047109 gbjou2.idx
213026822 gbjou3.idx
280868203 gbjou4.idx
242814073 gbjou5.idx
187635345 gbkey1.idx
232477748 gbkey2.idx
61417896 gbkey3.idx
250297016 gbmam1.seq
250003106 gbmam2.seq
250003429 gbmam3.seq
156833436 gbmam4.seq
67836334 gbnew.txt
250000525 gbpat1.seq
250001796 gbpat10.seq
250000526 gbpat11.seq
250001764 gbpat12.seq
250000646 gbpat13.seq
250000830 gbpat14.seq
250000190 gbpat15.seq
250001035 gbpat16.seq
250002101 gbpat17.seq
250000538 gbpat18.seq
250006144 gbpat19.seq
250000203 gbpat2.seq
250003359 gbpat20.seq
250001189 gbpat21.seq
250170197 gbpat22.seq
250000294 gbpat23.seq
250000637 gbpat24.seq
250007671 gbpat25.seq
250054772 gbpat26.seq
250007420 gbpat27.seq
250001564 gbpat28.seq
250014310 gbpat29.seq
250003352 gbpat3.seq
250002140 gbpat30.seq
250001880 gbpat31.seq
250000890 gbpat32.seq
250003338 gbpat33.seq
250001888 gbpat34.seq
250000571 gbpat35.seq
250000574 gbpat36.seq
250000036 gbpat37.seq
250001412 gbpat38.seq
250000583 gbpat39.seq
250002405 gbpat4.seq
250026151 gbpat40.seq
250002314 gbpat41.seq
250000211 gbpat42.seq
250000668 gbpat43.seq
250000070 gbpat44.seq
250000187 gbpat45.seq
132135294 gbpat46.seq
250000083 gbpat5.seq
250000375 gbpat6.seq
250000761 gbpat7.seq
250001452 gbpat8.seq
250000831 gbpat9.seq
73549162 gbphg.seq
250044478 gbpln1.seq
250003160 gbpln10.seq
250000628 gbpln11.seq
250011645 gbpln12.seq
250008497 gbpln13.seq
250005945 gbpln14.seq
250089800 gbpln15.seq
250099728 gbpln16.seq
278221632 gbpln17.seq
286798700 gbpln18.seq
250000480 gbpln19.seq
250169518 gbpln2.seq
250001973 gbpln20.seq
250001427 gbpln21.seq
250174954 gbpln22.seq
250068700 gbpln23.seq
250001593 gbpln24.seq
250003157 gbpln25.seq
250001582 gbpln26.seq
250001804 gbpln27.seq
250002558 gbpln28.seq
250000999 gbpln29.seq
250032130 gbpln3.seq
139686006 gbpln30.seq
250037730 gbpln4.seq
250001778 gbpln5.seq
250000201 gbpln6.seq
250003192 gbpln7.seq
250004718 gbpln8.seq
250185339 gbpln9.seq
250053823 gbpri1.seq
250153529 gbpri10.seq
250204132 gbpri11.seq
250124311 gbpri12.seq
250165432 gbpri13.seq
250193291 gbpri14.seq
250141141 gbpri15.seq
250027907 gbpri16.seq
250030960 gbpri17.seq
250023701 gbpri18.seq
250025027 gbpri19.seq
250087224 gbpri2.seq
250000628 gbpri20.seq
250002237 gbpri21.seq
250073572 gbpri22.seq
250020483 gbpri23.seq
250009271 gbpri24.seq
250137602 gbpri25.seq
250017238 gbpri26.seq
250146601 gbpri27.seq
250100275 gbpri28.seq
250003066 gbpri29.seq
250110152 gbpri3.seq
250788979 gbpri30.seq
250003773 gbpri31.seq
250076822 gbpri32.seq
250015399 gbpri33.seq
250001807 gbpri34.seq
250004658 gbpri35.seq
133087500 gbpri36.seq
250208358 gbpri4.seq
250066954 gbpri5.seq
250189590 gbpri6.seq
250063397 gbpri7.seq
250177822 gbpri8.seq
250047329 gbpri9.seq
310430 gbrel.txt
250121667 gbrod1.seq
250121809 gbrod10.seq
250236281 gbrod11.seq
250137349 gbrod12.seq
250186625 gbrod13.seq
250165128 gbrod14.seq
250048041 gbrod15.seq
250006975 gbrod16.seq
250001668 gbrod17.seq
250244445 gbrod18.seq
250056862 gbrod19.seq
250080031 gbrod2.seq
250153665 gbrod20.seq
250003864 gbrod21.seq
250003179 gbrod22.seq
250055618 gbrod23.seq
250004423 gbrod24.seq
250002580 gbrod25.seq
157670167 gbrod26.seq
250216775 gbrod3.seq
250056786 gbrod4.seq
250175829 gbrod5.seq
250248916 gbrod6.seq
250180937 gbrod7.seq
250294283 gbrod8.seq
250257448 gbrod9.seq
1471370008 gbsdr1.txt
4384333925 gbsdr2.txt
1952366013 gbsdr3.txt
112371147 gbsec.idx
250002076 gbsts1.seq
250002348 gbsts10.seq
250000920 gbsts11.seq
250001457 gbsts12.seq
250000591 gbsts13.seq
231158671 gbsts14.seq
250002003 gbsts2.seq
250002126 gbsts3.seq
250002391 gbsts4.seq
250004547 gbsts5.seq
250003583 gbsts6.seq
250002768 gbsts7.seq
250001976 gbsts8.seq
250001447 gbsts9.seq
250001810 gbsyn1.seq
146786116 gbsyn2.seq
8986229 gbtsa.seq
430744 gbuna.seq
250001642 gbvrl1.seq
6159148 gbvrl10.seq
250001533 gbvrl2.seq
250000722 gbvrl3.seq
250000493 gbvrl4.seq
250001087 gbvrl5.seq
250000189 gbvrl6.seq
250002004 gbvrl7.seq
250003102 gbvrl8.seq
250014446 gbvrl9.seq
250044460 gbvrt1.seq
250124976 gbvrt10.seq
250085952 gbvrt11.seq
250077840 gbvrt12.seq
250009391 gbvrt13.seq
250002586 gbvrt14.seq
250002598 gbvrt15.seq
98596272 gbvrt16.seq
250001320 gbvrt2.seq
250147936 gbvrt3.seq
250000741 gbvrt4.seq
250001048 gbvrt5.seq
250070327 gbvrt6.seq
250203695 gbvrt7.seq
250080727 gbvrt8.seq
250087145 gbvrt9.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 37309 102202315
BCT10 31941 103596214
BCT11 166 100210237
BCT12 101 106940925
BCT13 51 115048466
BCT14 54 115216029
BCT15 53 119178838
BCT16 63 114548520
BCT17 59 120777572
BCT18 41 110858034
BCT19 62 110498750
BCT2 3423 110264120
BCT20 64 112952229
BCT21 59 112144177
BCT22 67 113357173
BCT23 54 113009258
BCT24 49 113300966
BCT25 67 113140226
BCT26 60 110560818
BCT27 246 106142957
BCT28 68370 83141659
BCT29 77861 80290906
BCT3 159 115987743
BCT30 40003 86856545
BCT4 22460 103645651
BCT5 54644 86858514
BCT6 5648 95799862
BCT7 13884 100301224
BCT8 5428 115324894
BCT9 37818 98259046
ENV1 91347 71558909
ENV10 16222 13591517
ENV2 95195 69410122
ENV3 83383 81981634
ENV4 89875 86428819
ENV5 111284 55172778
ENV6 125901 36784034
ENV7 88280 75463234
ENV8 86407 83538644
ENV9 80046 94359851
EST1 68125 26289403
EST10 76524 29834002
EST100 78174 37899214
EST101 69414 40499853
EST102 74665 35691276
EST103 74688 38041908
EST104 69844 36705685
EST105 77096 49452331
EST106 67724 35995319
EST107 71456 36147190
EST108 72674 37401794
EST109 72953 44490780
EST11 75175 28789926
EST110 66677 44008528
EST111 75063 44988026
EST112 70436 28425189
EST113 70706 31559583
EST114 64535 35061215
EST115 66461 38609553
EST116 71605 48131581
EST117 75495 28112640
EST118 74710 34623852
EST119 74532 27074118
EST12 77544 30745583
EST120 73663 35495525
EST121 68724 35125321
EST122 72931 41631261
EST123 79440 44225903
EST124 74567 47814438
EST125 67265 41122534
EST126 69458 45380124
EST127 72109 46555780
EST128 70918 44652651
EST129 74279 41496783
EST13 76983 29267115
EST130 74656 46718395
EST131 73716 50408678
EST132 70611 48310825
EST133 79458 38879381
EST134 75815 30473736
EST135 78054 42392724
EST136 78282 41723761
EST137 75939 46730128
EST138 61420 29566851
EST139 71363 36816002
EST14 78759 31927337
EST140 66825 39586005
EST141 68320 36624239
EST142 70723 43688737
EST143 72772 45002333
EST144 67294 38720603
EST145 72031 41184592
EST146 70061 42631207
EST147 62251 39059335
EST148 79327 42976778
EST149 104062 57732949
EST15 74556 31516607
EST150 67689 36715487
EST151 102919 54507779
EST152 115475 61460808
EST153 103793 57866774
EST154 78553 47286833
EST155 99247 55350883
EST156 103041 63791029
EST157 94833 58558590
EST158 88484 47691138
EST159 72672 42344596
EST16 75846 33344451
EST160 64805 31529696
EST161 63744 29100729
EST162 52914 24862209
EST163 67484 32071150
EST164 60413 30808051
EST165 69358 37116721
EST166 69686 49938731
EST167 66729 46434583
EST168 80210 46798884
EST169 57857 29886006
EST17 82116 33864865
EST170 62370 31631167
EST171 66665 39618357
EST172 64690 40088478
EST173 62530 40291816
EST174 95770 46247286
EST175 88901 47148568
EST176 101104 58664178
EST177 103949 60192303
EST178 96888 52289483
EST179 87106 42695760
EST18 80714 32315414
EST180 92572 37769901
EST181 98967 52964265
EST182 92793 37776924
EST183 99811 43904601
EST184 64994 41146169
EST185 68507 39588740
EST186 61192 35873520
EST187 68633 44008930
EST188 69763 29781510
EST189 76695 34475262
EST19 78619 31740188
EST190 68182 42346207
EST191 79594 39330542
EST192 64030 33263513
EST193 68743 49298046
EST194 68700 45770849
EST195 68084 35941412
EST196 68928 44473907
EST197 68735 53107959
EST198 69833 35521367
EST199 70181 41398690
EST2 74644 28643983
EST20 74639 30731961
EST200 69888 60114127
EST201 65203 48164356
EST202 63714 46393517
EST203 63237 46875996
EST204 65210 45376169
EST205 65235 47738723
EST206 63463 45747622
EST207 62411 37455434
EST208 63674 34411625
EST209 64739 37803857
EST21 73968 34331128
EST210 84638 48393304
EST211 83788 54431201
EST212 72387 42247393
EST213 112331 70285783
EST214 115106 69053808
EST215 114091 67892554
EST216 88695 57841850
EST217 114006 60828942
EST218 108063 53340254
EST219 89135 53846587
EST22 74963 30034611
EST220 97342 42681525
EST221 86941 47058892
EST222 71944 46105036
EST223 67131 45110921
EST224 68363 58831303
EST225 69771 57087551
EST226 79591 40079103
EST227 79530 46915908
EST228 73707 52324186
EST229 70464 51400393
EST23 77386 32708730
EST230 38982 18932442
EST231 28002 10659520
EST232 27785 10283362
EST233 26527 9754111
EST234 26793 9016765
EST235 27864 10105393
EST236 27412 9977333
EST237 27399 9885361
EST238 27518 10510670
EST239 27324 12123274
EST24 74773 32808779
EST240 27434 11245023
EST241 27543 10090640
EST242 27837 9333712
EST243 27129 9475805
EST244 28017 11370055
EST245 27910 10969021
EST246 27126 11424717
EST247 26893 12101531
EST248 27290 11310685
EST249 27245 10931666
EST25 74061 31938151
EST250 27234 11870843
EST251 27375 11628574
EST252 27480 10963060
EST253 27470 10953692
EST254 27329 10498834
EST255 27098 12295355
EST256 24569 17200258
EST257 26188 17638076
EST258 61822 26870890
EST259 94278 47697850
EST26 75200 31043524
EST260 44123 29039088
EST261 110381 42317991
EST262 71272 40347272
EST263 68666 44547937
EST264 69369 44540572
EST265 69198 44305509
EST266 66725 39148659
EST267 74218 43160435
EST268 64413 47890982
EST269 65277 34239733
EST27 74401 32418497
EST270 75619 37743423
EST271 101896 47265522
EST272 75844 42540180
EST273 67135 34285854
EST274 67710 32719109
EST275 70267 42132296
EST276 73087 34902326
EST277 68701 33514765
EST278 75173 48090831
EST279 63433 33733696
EST28 107972 51088791
EST280 68039 38788490
EST281 80201 41530219
EST282 76499 43024520
EST283 77031 50736980
EST284 78670 55442470
EST285 109143 48942255
EST286 86012 43301296
EST287 74360 45011947
EST288 73459 41032880
EST289 71572 38148339
EST29 97102 45895594
EST290 70087 27693399
EST291 70657 39580172
EST292 61876 33893925
EST293 63356 42424010
EST294 71992 41139883
EST295 61706 44333163
EST296 62117 32232996
EST297 83253 42996263
EST298 83746 41397730
EST299 75263 48900207
EST3 73730 29915710
EST30 98623 53899956
EST300 104041 57542142
EST301 123226 46853581
EST302 76887 37885494
EST303 67865 35033640
EST304 69175 45965893
EST305 81900 41101949
EST306 71237 41587286
EST307 71450 40903052
EST308 60080 34269384
EST309 59278 36532992
EST31 86674 50524383
EST310 58353 34660719
EST311 70383 48890122
EST312 71325 43546917
EST313 68889 40131719
EST314 69782 36244113
EST315 63943 33543197
EST316 55950 28226289
EST317 54814 29123845
EST318 54975 29445489
EST319 53768 28117600
EST32 65118 40783465
EST320 56270 26922704
EST321 57989 25664127
EST322 57224 23988132
EST323 56695 23271848
EST324 57701 22043864
EST325 57534 23175275
EST326 57845 22885236
EST327 57557 21962517
EST328 57999 20794559
EST329 72139 42647573
EST33 70684 57555398
EST330 77894 35089373
EST331 78454 32072369
EST332 76929 32982723
EST333 85716 46528544
EST334 73233 53429066
EST335 64745 45211035
EST336 96201 59050654
EST337 96768 58496253
EST338 104212 60009270
EST339 104602 56944785
EST34 84694 48505908
EST340 79681 42872046
EST341 70649 39852915
EST342 76985 43261141
EST343 63015 55275483
EST344 63832 46143935
EST345 63555 41044239
EST346 61197 34102689
EST347 73582 51368372
EST348 50520 27758190
EST349 52767 26208672
EST35 85780 42903552
EST350 70928 38385859
EST351 60317 32734667
EST352 62493 31425364
EST353 64447 41473584
EST354 84807 43270207
EST355 70200 41820224
EST356 68180 43823759
EST357 67340 37262716
EST358 63374 41680718
EST359 86852 50244220
EST36 90012 48520040
EST360 84356 50004704
EST361 78502 42719918
EST362 63699 37312305
EST363 65871 34021232
EST364 73761 40472256
EST365 46782 24275020
EST366 67379 38033431
EST367 69096 42398268
EST368 98853 45758349
EST369 74941 45097626
EST37 86723 61644596
EST370 71484 47236105
EST371 71528 46001947
EST372 62726 35770606
EST373 74852 36499632
EST374 82500 37877976
EST375 58047 41141724
EST376 55859 38002118
EST377 63702 37360808
EST378 85946 51987637
EST379 88341 47756354
EST38 77190 50327143
EST380 67701 42516721
EST381 77922 41145007
EST382 54397 35303847
EST383 43804 22540756
EST384 63804 40211652
EST385 82100 42837412
EST386 77449 46475681
EST387 73007 45161502
EST388 78798 46886929
EST389 76799 49148754
EST39 95762 56274935
EST390 88156 62567627
EST391 76944 71226302
EST392 85269 49524062
EST393 84687 58493839
EST394 71972 59984630
EST395 72272 39766834
EST396 61065 40248048
EST397 71616 39795853
EST398 57134 34665879
EST399 71623 31665969
EST4 74560 28391201
EST40 63842 49105433
EST400 79597 25648907
EST401 70509 43516300
EST402 68053 38284560
EST403 67530 35381039
EST404 69648 42806295
EST405 73028 47846408
EST406 66263 43541559
EST407 72292 42469109
EST408 59613 33624999
EST409 66081 39892605
EST41 78073 55308860
EST410 76769 48913588
EST411 82937 48611284
EST412 81461 45846009
EST413 59404 40337764
EST414 55900 40799994
EST415 56835 40014922
EST416 62114 39707121
EST417 75344 48187615
EST418 53076 31554471
EST419 60016 37972586
EST42 100963 48155254
EST420 61774 39769583
EST421 56456 41229274
EST422 60147 41600338
EST423 47530 33483145
EST424 78491 43151178
EST425 78672 39449911
EST426 70559 38868231
EST427 70636 38747622
EST428 70488 39194525
EST429 70491 38935845
EST43 83966 45946644
EST430 70362 39291766
EST431 69901 38765087
EST432 69832 38773642
EST433 69777 39706000
EST434 69695 38771516
EST435 67920 38441832
EST436 70148 38997487
EST437 70275 39260076
EST438 70287 39098292
EST439 70247 38242782
EST44 97907 47408838
EST440 70688 38722551
EST441 70618 38783588
EST442 70562 38769391
EST443 70788 38149088
EST444 79555 43376973
EST445 90571 49787617
EST446 82218 36914794
EST447 106065 60787606
EST448 82728 46260697
EST449 75451 47764191
EST45 98540 49953323
EST450 83332 48670355
EST451 88709 52252485
EST452 96758 60362554
EST453 83468 49441007
EST454 89920 49602743
EST455 87821 48354557
EST456 77403 57572093
EST457 91629 52758040
EST458 77039 52316894
EST459 97614 65124914
EST46 99072 39467830
EST460 96278 67061153
EST461 105897 55581629
EST462 111358 44509997
EST463 65065 40619852
EST464 51502 40320523
EST465 72263 44266952
EST466 61747 37179961
EST467 73078 43229050
EST468 112784 56747225
EST469 77462 47721255
EST47 70163 18814553
EST470 83729 57752590
EST471 50278 29993995
EST472 48004 43459215
EST473 46353 59030899
EST474 71857 55682929
EST475 64962 37982852
EST476 72485 42806488
EST477 71487 42052870
EST478 67172 43718798
EST479 65437 47403101
EST48 70379 18684940
EST480 72265 46993092
EST481 109189 47936701
EST482 91470 48668557
EST483 63433 46644974
EST484 56103 40745418
EST485 56286 38775843
EST486 64802 45631764
EST487 65029 46125214
EST488 63070 46796423
EST489 53257 37126344
EST49 65474 20058402
EST490 51227 38741672
EST491 59770 41836173
EST492 60071 35650618
EST493 71727 44678402
EST494 58759 38783600
EST495 57007 39164257
EST496 62448 46410788
EST497 58381 45708541
EST498 72999 47047228
EST499 49807 39686379
EST5 48193 15292118
EST50 44265 12056155
EST500 57660 40060572
EST501 53656 34176531
EST502 57552 40534907
EST503 55924 35435607
EST504 75351 44785479
EST505 67811 57367649
EST506 69838 50982091
EST507 75588 49889831
EST508 45774 59607209
EST509 56263 49059826
EST51 43874 12147129
EST510 67441 48075937
EST511 58837 39617790
EST512 77564 44549500
EST513 83319 53690860
EST514 82824 52394335
EST515 71821 43099525
EST516 60573 38679188
EST517 72475 49496844
EST518 80384 49484834
EST519 78226 60799364
EST52 43736 11584325
EST520 69600 46625697
EST521 72925 51376975
EST522 68844 46373384
EST523 60757 48826828
EST524 62620 45745152
EST525 78463 43939809
EST526 69695 42579790
EST527 115303 45663425
EST528 113971 49789714
EST529 80687 51715610
EST53 80673 32850965
EST530 50579 49874138
EST531 62793 46251183
EST532 97655 14036505
EST533 99742 10985873
EST534 99134 22710450
EST535 89250 38264452
EST536 86878 31661959
EST537 80888 42656923
EST538 65083 60652613
EST539 91130 55902744
EST54 94167 38578554
EST540 81015 44643124
EST541 67456 43721385
EST542 72120 47327910
EST543 77464 51340465
EST544 86126 51293936
EST545 73084 53401027
EST546 67633 47025844
EST547 71879 55035618
EST548 85397 50928522
EST549 84054 45740322
EST55 97034 43831871
EST550 82617 45475540
EST551 84583 40385643
EST552 83127 45507705
EST553 76330 51803549
EST554 72577 55457972
EST555 74318 51783360
EST556 81768 44394469
EST557 102881 47449493
EST558 111321 48611681
EST559 119270 50373084
EST56 92896 47720348
EST560 132617 59328352
EST561 92029 53702306
EST562 80192 52415993
EST563 80587 23747823
EST564 84290 8748634
EST565 101484 43476912
EST566 116433 57103289
EST567 78009 44258014
EST568 61727 38782552
EST569 74633 47314920
EST57 91637 41934932
EST570 76609 48922507
EST571 71557 43369521
EST572 76486 46279849
EST573 67372 51747027
EST574 85622 54633902
EST575 97537 52559980
EST576 76849 37191802
EST577 64204 42058868
EST578 70893 51546125
EST579 102461 62520932
EST58 109056 57187703
EST580 80330 45993254
EST581 75980 41327334
EST582 93203 18004510
EST583 98496 10593449
EST584 98503 10581700
EST585 80692 38212677
EST586 82656 45907644
EST587 88017 48139776
EST588 68399 49871134
EST589 81141 56492871
EST59 98545 48475187
EST590 90984 53386894
EST591 84581 56897785
EST592 79800 47525176
EST593 84856 48676756
EST594 78052 47303469
EST595 72591 51476656
EST596 59736 37736692
EST597 96580 28758359
EST598 71118 42634195
EST599 50719 33162808
EST6 54905 17436848
EST60 76735 32939627
EST600 51382 32776836
EST601 50395 35836335
EST602 76500 47764184
EST603 65593 47207901
EST604 87096 34828973
EST605 122599 11113868
EST606 118220 14538250
EST607 122492 11276527
EST608 122479 11293426
EST609 72945 42590732
EST61 67374 29818219
EST610 64008 49515080
EST611 75117 48865063
EST612 81242 52975617
EST613 68323 49640801
EST614 72508 43626067
EST615 66697 43100020
EST616 67217 41677698
EST617 97696 30129550
EST618 127287 11710945
EST619 106237 23469037
EST62 72249 31442049
EST620 72518 45943535
EST621 70354 52094639
EST622 81846 45560394
EST623 90496 50485117
EST624 74507 47336037
EST625 65347 33251230
EST626 79541 59528968
EST627 70469 48563523
EST628 106929 46470407
EST629 89300 55219589
EST63 70426 29558419
EST630 61530 47686732
EST631 62214 50477684
EST632 75348 49862447
EST633 79603 41435217
EST634 93922 54685666
EST635 81218 46170417
EST636 81307 42563356
EST637 71487 46909024
EST638 69745 51713243
EST639 90330 42185246
EST64 82076 33388667
EST640 77372 26862840
EST641 77667 24223632
EST642 75525 29436389
EST643 76242 27175730
EST644 76410 28589037
EST645 76141 29740751
EST646 75611 28900250
EST647 76351 27740977
EST648 76717 28957990
EST649 76295 29421151
EST65 74511 29817368
EST650 83170 44122596
EST651 80896 54295625
EST652 81996 59751197
EST653 81927 56080782
EST654 68506 34833375
EST655 61617 39783317
EST656 78697 47391273
EST657 44789 27711402
EST658 45669 36390725
EST659 58834 44897351
EST66 67895 27735432
EST660 58208 44643299
EST661 70587 46473000
EST662 77751 38753996
EST663 66512 43275280
EST664 94884 49595570
EST665 69129 41867548
EST666 65187 43630497
EST667 78043 49555452
EST668 78537 41906444
EST669 62753 39417461
EST67 67673 29744985
EST670 72405 50805111
EST671 70960 46186739
EST672 63087 45038124
EST673 70533 52032384
EST674 75793 45853481
EST675 70891 46180194
EST676 68053 49155956
EST677 73636 57989893
EST678 82241 69331377
EST679 82061 68977054
EST68 76617 36439906
EST680 76816 57413302
EST681 77852 37779620
EST682 68512 31767473
EST683 57393 35621864
EST684 64890 45820831
EST685 63914 41321087
EST686 67233 49575115
EST687 65788 42961172
EST688 58643 38786720
EST689 56192 38914349
EST69 73730 31999987
EST690 63794 42031593
EST691 68985 44863782
EST692 65655 45398300
EST693 65884 45976580
EST694 66338 44632479
EST695 69591 48407517
EST696 71116 58757346
EST697 65123 35859659
EST698 67886 40808763
EST699 67232 45718111
EST7 74531 29353676
EST70 74713 27946794
EST700 58836 37685684
EST701 66482 40159954
EST702 62052 37772885
EST703 68417 42900263
EST704 91094 52957334
EST705 101634 50160280
EST706 64483 38281370
EST707 54484 27415867
EST708 51079 32429682
EST709 55349 35448039
EST71 78372 29350783
EST710 58403 40783432
EST711 59403 38044544
EST712 61574 37897422
EST713 65106 41578832
EST714 56017 34981896
EST715 52551 32666158
EST716 68257 41488699
EST717 82804 42748375
EST718 80952 43379682
EST719 73930 28690794
EST72 78896 36089451
EST720 79639 39677882
EST721 78795 47575913
EST722 84381 51052260
EST723 74126 47520072
EST724 83107 45866367
EST725 57432 38399417
EST726 57745 37654655
EST727 61242 42030723
EST728 59726 39208507
EST729 59871 38843063
EST73 41013 11637622
EST730 62657 41174241
EST731 79381 47364849
EST732 89865 64582477
EST733 83140 44351405
EST734 73871 40219640
EST735 85126 43871961
EST736 90116 57729702
EST737 78093 59736870
EST738 73997 55829524
EST739 32657 19314859
EST74 40865 11295896
EST740 32542 19500137
EST741 32466 19773751
EST742 32795 18801648
EST743 65341 37702552
EST744 58780 34975557
EST745 58622 35366865
EST746 58970 34496169
EST747 65545 28292968
EST748 70982 14766785
EST749 71129 14368189
EST75 40926 12874674
EST750 70897 14908916
EST751 71309 13945963
EST752 70797 15141380
EST753 70861 34481890
EST754 89020 55325684
EST755 70442 48280660
EST756 71752 26942904
EST757 72202 27049739
EST758 73549 26090902
EST759 72018 26143980
EST76 41249 12479962
EST760 77283 26069424
EST761 71455 28957552
EST762 67403 25280536
EST77 41360 12721640
EST78 41138 13085889
EST79 41094 12789589
EST8 75810 30584188
EST80 40893 12251197
EST81 40665 12427604
EST82 41660 12464712
EST83 41663 12447454
EST84 41552 13230588
EST85 41405 13135422
EST86 44089 12546003
EST87 46795 22524087
EST88 43006 24688840
EST89 44103 18150995
EST9 77564 29870697
EST90 50781 23211667
EST91 51856 21478716
EST92 55678 26042356
EST93 89677 52504508
EST94 74933 32391408
EST95 73836 29125486
EST96 72799 30851338
EST97 76461 44529268
EST98 77297 41224622
EST99 75906 40081456
GSS1 90430 38662943
GSS10 74787 43607320
GSS100 80700 52986388
GSS101 74643 42476821
GSS102 73344 45758012
GSS103 73675 44924822
GSS104 73312 45571000
GSS105 73285 44771114
GSS106 75160 45685715
GSS107 81112 54360072
GSS108 83721 55541554
GSS109 80644 52886890
GSS11 70802 35983221
GSS110 82892 50228457
GSS111 84107 56519862
GSS112 79973 60846560
GSS113 90479 45928631
GSS114 90305 54158170
GSS115 74497 49731626
GSS116 88867 64483432
GSS117 82283 59525077
GSS118 75683 40992326
GSS119 81577 51559706
GSS12 73150 38495437
GSS120 95457 53312113
GSS121 84363 55617830
GSS122 84986 54716318
GSS123 82152 55248187
GSS124 76269 69393692
GSS125 76058 67097058
GSS126 79550 55612127
GSS127 72448 50209219
GSS128 72516 50071160
GSS129 73104 49091043
GSS13 76795 38906116
GSS130 72212 50636620
GSS131 73969 50198952
GSS132 84029 59934337
GSS133 80939 58571340
GSS134 69588 56089138
GSS135 71074 55294116
GSS136 75865 67791090
GSS137 75633 62681288
GSS138 77272 52414676
GSS139 86109 53641731
GSS14 71379 32114760
GSS140 94681 58088361
GSS141 93212 60013781
GSS142 81955 53757582
GSS143 89058 51052670
GSS144 73540 58576714
GSS145 114887 59690272
GSS146 110449 58535647
GSS147 86655 63416067
GSS148 53216 30401901
GSS149 67510 47849670
GSS15 70493 35055254
GSS150 72997 55893522
GSS151 72979 55923824
GSS152 72998 55892561
GSS153 73014 55864261
GSS154 72973 55935287
GSS155 72979 55924564
GSS156 75749 57729272
GSS157 83717 39291969
GSS158 88245 60143741
GSS159 86243 65371130
GSS16 78213 46093569
GSS160 88627 59283782
GSS161 91852 57052063
GSS162 83304 57868868
GSS163 75760 49071980
GSS164 75935 48772421
GSS165 92708 58649546
GSS166 88866 59688092
GSS167 86025 61517965
GSS168 103301 25411297
GSS169 102573 30070088
GSS17 70895 33315071
GSS170 78834 46724544
GSS171 80681 52772284
GSS172 54184 39212125
GSS173 52939 41236326
GSS174 61827 51347678
GSS175 59031 45452209
GSS176 57750 48398835
GSS177 57490 48792974
GSS178 58200 46566886
GSS179 58396 45982966
GSS18 58792 27918452
GSS180 58897 48102792
GSS181 58949 48419623
GSS182 58614 49456462
GSS183 58238 48405141
GSS184 58635 46087100
GSS185 58751 49388131
GSS186 60112 50295281
GSS187 60298 49791431
GSS188 60509 49159122
GSS189 60397 49494368
GSS19 56814 29015258
GSS190 60504 49173751
GSS191 60038 46907252
GSS192 59176 45278192
GSS193 58423 47650979
GSS194 58939 46037382
GSS195 58864 46272710
GSS196 58315 47992308
GSS197 58241 48223604
GSS198 58226 48429613
GSS199 60127 50008343
GSS2 89000 39334171
GSS20 57683 26671178
GSS200 59844 50860772
GSS201 59843 49441152
GSS202 60660 45799785
GSS203 60282 46972788
GSS204 59414 49654477
GSS205 59525 49316252
GSS206 59550 49241301
GSS207 59460 49515157
GSS208 59584 49137663
GSS209 59519 49334989
GSS21 61510 29536897
GSS210 59723 48713434
GSS211 59643 48959780
GSS212 59855 48311125
GSS213 58866 46148860
GSS214 58871 45984934
GSS215 58392 47631899
GSS216 58243 48157444
GSS217 58742 46240023
GSS218 57873 48042855
GSS219 64405 54263649
GSS22 64657 37608795
GSS220 64818 54767216
GSS221 90289 58835542
GSS222 83890 44421283
GSS223 78161 60667629
GSS224 84480 53821335
GSS225 91285 49694378
GSS226 75320 52058769
GSS227 71265 47120651
GSS228 71250 47156734
GSS229 96974 51450278
GSS23 57533 27069354
GSS230 99596 65018282
GSS231 90788 56949940
GSS232 95822 62944362
GSS233 95708 63087865
GSS234 96052 62663286
GSS235 94747 64131707
GSS236 95263 63418742
GSS237 92390 66996380
GSS238 94204 64745110
GSS239 94897 63873296
GSS24 66342 42114517
GSS240 92263 67158502
GSS241 93151 66051587
GSS242 94679 64153822
GSS243 91341 68648866
GSS244 94659 64798004
GSS245 89894 70057107
GSS246 85775 65424982
GSS247 44911 33629702
GSS248 87184 64446495
GSS249 83576 62756836
GSS25 67961 28174863
GSS250 103565 48487567
GSS251 68487 58452386
GSS252 68305 58780224
GSS253 69369 56628175
GSS254 69627 56126135
GSS255 70559 56034412
GSS256 76223 57617228
GSS257 75916 58210084
GSS258 87238 74899217
GSS259 81587 44434075
GSS26 58158 25404796
GSS260 92217 44635655
GSS261 84640 64736433
GSS262 71239 59054443
GSS263 69697 58673228
GSS264 65128 62492372
GSS265 73098 48811677
GSS266 86703 34731429
GSS267 112990 71341855
GSS268 96511 74565346
GSS269 92178 46259678
GSS27 65554 32027989
GSS270 109371 61539875
GSS271 120651 73180044
GSS272 117135 76147498
GSS273 103985 54987581
GSS274 82742 54666483
GSS275 95627 61125525
GSS276 107314 78650187
GSS277 108106 77812872
GSS278 106102 79983316
GSS279 104023 80029779
GSS28 65216 32514250
GSS280 76700 51240876
GSS281 109572 66442514
GSS282 109962 66304167
GSS283 104228 57934401
GSS284 68448 37538673
GSS285 78632 43509832
GSS286 75986 43310262
GSS287 105836 60318290
GSS288 92453 46450532
GSS289 101936 59583700
GSS29 77652 39788992
GSS290 114432 45477964
GSS291 116819 39727252
GSS292 98910 70068904
GSS293 95371 64166692
GSS294 95892 36542567
GSS295 95418 37268886
GSS296 96672 35161976
GSS297 94286 39168339
GSS298 101639 58186894
GSS299 94807 61168275
GSS3 87422 41844005
GSS30 82681 39696428
GSS300 94592 61132827
GSS301 95303 60106496
GSS302 87141 63544777
GSS303 83786 28453498
GSS304 84356 27350762
GSS305 85365 25360755
GSS306 28195 13296242
GSS31 74189 40416268
GSS32 70423 48221181
GSS33 79836 37788948
GSS34 75880 40335657
GSS35 74160 39904352
GSS36 87438 56459406
GSS37 87595 58177130
GSS38 85539 44928326
GSS39 86658 50308088
GSS4 79227 41150659
GSS40 86430 39784567
GSS41 83085 32240682
GSS42 81250 56927812
GSS43 80078 57990401
GSS44 72015 47525025
GSS45 72046 47412666
GSS46 77605 45677826
GSS47 77849 38797135
GSS48 83220 58005156
GSS49 86562 64828067
GSS5 78819 40567994
GSS50 81678 54317110
GSS51 93826 59328143
GSS52 88475 58772896
GSS53 76480 42036837
GSS54 72967 40705083
GSS55 86422 46909379
GSS56 88058 58563061
GSS57 76130 63968913
GSS58 70801 78004627
GSS59 85626 68955920
GSS6 78088 38842501
GSS60 89445 60067449
GSS61 63439 44860135
GSS62 66154 45425855
GSS63 89653 67227351
GSS64 84948 58382594
GSS65 86087 52984289
GSS66 85460 55665378
GSS67 93406 57830853
GSS68 97850 52547586
GSS69 97521 52983377
GSS7 77657 39174963
GSS70 98229 52046735
GSS71 99189 50772994
GSS72 99223 50728001
GSS73 99077 50923754
GSS74 99665 50142719
GSS75 97777 52642563
GSS76 91831 64743636
GSS77 89866 70739341
GSS78 88913 70107284
GSS79 87855 69638323
GSS8 75881 38134490
GSS80 87890 63944267
GSS81 88239 44628846
GSS82 78265 23302669
GSS83 78152 23566962
GSS84 84035 49203901
GSS85 77224 45333917
GSS86 88924 56137954
GSS87 84315 58640224
GSS88 75422 75718342
GSS89 78486 72974163
GSS9 72240 37167492
GSS90 84075 46680544
GSS91 85139 49478912
GSS92 75286 41387465
GSS93 79813 56497580
GSS94 76854 56728523
GSS95 82337 53198692
GSS96 83692 58804524
GSS97 85528 57668250
GSS98 87290 52278928
GSS99 82170 66917174
HTC1 24998 26954535
HTC10 65256 85976928
HTC11 66998 61009091
HTC12 69469 70263261
HTC13 12040 7552437
HTC2 15993 36013431
HTC3 15970 36547861
HTC4 16191 35357336
HTC5 15927 40313070
HTC6 16010 37271080
HTC7 51463 28046115
HTC8 80339 61968762
HTC9 73824 69577475
HTG1 1318 188929277
HTG10 1300 186477873
HTG100 1320 191168390
HTG101 1214 190176970
HTG102 1092 190018848
HTG103 1296 189976061
HTG104 1073 188004673
HTG105 1445 189573730
HTG106 1235 190022187
HTG107 1003 189691793
HTG108 814 173322191
HTG109 1062 193654866
HTG11 1452 184100451
HTG110 1088 193423561
HTG111 1042 189315130
HTG112 1078 191985988
HTG113 1130 191928071
HTG114 1120 192410998
HTG115 1143 192638062
HTG116 1210 192431924
HTG117 1244 191833703
HTG118 1200 191754005
HTG119 1254 191213761
HTG12 876 192056419
HTG120 357 37705043
HTG13 750 192437652
HTG14 744 192158023
HTG15 782 192230176
HTG16 803 192009637
HTG17 769 192283132
HTG18 2064 171033537
HTG19 1071 187903257
HTG2 2465 186071856
HTG20 963 189548030
HTG21 784 191909290
HTG22 923 190306412
HTG23 902 190717511
HTG24 811 191592140
HTG25 776 192067539
HTG26 868 191479631
HTG27 889 190824411
HTG28 946 190172111
HTG29 899 191050856
HTG3 2517 185290576
HTG30 927 190341026
HTG31 871 191395263
HTG32 966 189711739
HTG33 883 191133821
HTG34 862 191459235
HTG35 822 191882341
HTG36 946 190165839
HTG37 931 190843675
HTG38 936 190384520
HTG39 1042 189423761
HTG4 2553 188532563
HTG40 1206 186876762
HTG41 1260 188130356
HTG42 1175 188026307
HTG43 1153 188184187
HTG44 1119 191420899
HTG45 1274 190790953
HTG46 1177 191252803
HTG47 1134 191423493
HTG48 1040 191597494
HTG49 1019 189848294
HTG5 1284 185715991
HTG50 1127 190383730
HTG51 971 190299724
HTG52 1110 190345610
HTG53 1047 190452500
HTG54 1016 190035900
HTG55 969 189377307
HTG56 1023 189638300
HTG57 1025 190014190
HTG58 1052 188299817
HTG59 1110 188022804
HTG6 1274 185234665
HTG60 1135 189450719
HTG61 1089 189889158
HTG62 1071 189725708
HTG63 1174 189114234
HTG64 1173 187663471
HTG65 1288 184620446
HTG66 1231 185375419
HTG67 1237 184701930
HTG68 1248 184653564
HTG69 1200 187454311
HTG7 1277 185414872
HTG70 1125 189153833
HTG71 1119 188454488
HTG72 1103 191093967
HTG73 1137 191031874
HTG74 1221 191256930
HTG75 1115 190571611
HTG76 1181 190700276
HTG77 1121 190315991
HTG78 1203 190287752
HTG79 1137 190220371
HTG8 1459 184762119
HTG80 1113 190306026
HTG81 1231 188834779
HTG82 1277 187876076
HTG83 1150 190544599
HTG84 1167 190264118
HTG85 1125 190722336
HTG86 1218 190654228
HTG87 1148 191113823
HTG88 1179 191453814
HTG89 1131 191990683
HTG9 1200 186999351
HTG90 1187 192004907
HTG91 1100 191880090
HTG92 1197 192021328
HTG93 1077 190182465
HTG94 1088 189950166
HTG95 1015 189951355
HTG96 1035 190028946
HTG97 994 189716213
HTG98 1008 189729678
HTG99 982 189621779
INV1 84740 64161466
INV10 85200 66812266
INV11 86584 65434641
INV12 57441 90499073
INV13 2738 35811610
INV2 1506 186424679
INV3 790 167041062
INV4 50765 97271065
INV5 70821 81297570
INV6 23043 128331445
INV7 71584 74090113
INV8 77454 71564458
INV9 65924 83327494
MAM1 12458 166319267
MAM2 66123 90685840
MAM3 35742 123420229
MAM4 51594 47469509
PAT1 222610 70141260
PAT10 125442 99515062
PAT11 141738 62609680
PAT12 105794 59943621
PAT13 103555 50226633
PAT14 121471 53274919
PAT15 113046 61290522
PAT16 145018 54899409
PAT17 155519 69891391
PAT18 97490 122598443
PAT19 147595 87376862
PAT2 194518 84655123
PAT20 117408 104542101
PAT21 123717 103465007
PAT22 119286 106149134
PAT23 146234 86276481
PAT24 175260 64171427
PAT25 140517 61008125
PAT26 100420 79560422
PAT27 108697 70803288
PAT28 111347 66582863
PAT29 113599 67362592
PAT3 171984 95898893
PAT30 129236 68268266
PAT31 111310 78154097
PAT32 138112 29117385
PAT33 158493 24106566
PAT34 114729 48995749
PAT35 89551 87425403
PAT36 136214 100154123
PAT37 159279 101006643
PAT38 124693 122946139
PAT39 174828 89326200
PAT4 153750 106059356
PAT40 113497 129648415
PAT41 27632 180874595
PAT42 185412 93064780
PAT43 274593 6864825
PAT44 305893 8737479
PAT45 299628 30663237
PAT46 101597 48927614
PAT5 184018 85619906
PAT6 156356 93378118
PAT7 152399 81703403
PAT8 104673 119399316
PAT9 143539 89230831
PHG 3850 29750043
PLN1 58275 94961237
PLN10 20466 125761789
PLN11 17605 145150273
PLN12 17681 146581295
PLN13 17607 146693644
PLN14 22358 139795487
PLN15 1255 165552817
PLN16 1206 164015892
PLN17 19 181875765
PLN18 7 190147207
PLN19 39903 107550218
PLN2 1492 166359642
PLN20 76328 77138210
PLN21 77313 76850166
PLN22 51288 94980444
PLN23 14001 139965656
PLN24 35895 118227442
PLN25 78670 75592796
PLN26 99118 59411540
PLN27 77722 71693767
PLN28 79150 76847969
PLN29 77938 75832068
PLN3 1574 182833131
PLN30 28605 52248481
PLN4 1995 191719060
PLN5 35432 123142989
PLN6 75930 78740879
PLN7 75160 71376532
PLN8 31087 51284979
PLN9 27516 102616523
PRI1 33534 117131189
PRI10 1453 182636149
PRI11 1279 179349103
PRI12 1453 177964555
PRI13 1590 180241605
PRI14 1602 182142647
PRI15 1275 191950767
PRI16 1137 193836406
PRI17 1101 194347633
PRI18 1199 193575883
PRI19 8118 178900363
PRI2 1641 172599702
PRI20 46461 115670816
PRI21 61519 78424700
PRI22 31547 99698222
PRI23 2634 178482963
PRI24 2077 182264935
PRI25 1634 183006529
PRI26 2053 182456509
PRI27 2123 180103570
PRI28 12814 160004381
PRI29 8360 163362316
PRI3 1306 183556099
PRI30 57595 89349035
PRI31 32767 64937747
PRI32 19080 125624500
PRI33 20797 144670041
PRI34 68294 83493200
PRI35 64536 85843958
PRI36 30032 57035934
PRI4 1349 185561228
PRI5 1195 181186310
PRI6 1188 179183875
PRI7 1232 181021971
PRI8 1323 176571278
PRI9 1242 174654956
ROD1 29370 146080304
ROD10 976 181452610
ROD11 1037 185938760
ROD12 943 183051541
ROD13 1038 189479067
ROD14 952 180504980
ROD15 966 181941874
ROD16 1000 186084246
ROD17 10628 174288877
ROD18 26465 141205483
ROD19 1132 183058092
ROD2 911 174945476
ROD20 1184 184293692
ROD21 13975 163394567
ROD22 38533 70528780
ROD23 19355 116026533
ROD24 1814 189605079
ROD25 153423 19683112
ROD26 44385 50705764
ROD3 913 173662974
ROD4 903 174022951
ROD5 929 174225203
ROD6 983 179530200
ROD7 957 179813584
ROD8 994 182385252
ROD9 1003 182407283
STS1 84844 36529627
STS10 57841 44812491
STS11 57925 43638168
STS12 64591 43001803
STS13 88615 38408361
STS14 81147 35399727
STS2 84165 48236598
STS3 69728 27431057
STS4 78848 37497682
STS5 54788 32164909
STS6 54863 31907576
STS7 54669 32203229
STS8 55701 35698132
STS9 57887 44483446
SYN1 47470 71418834
SYN2 29245 39471564
TSA 2886 2546788
UNA 214 116246
VRL1 72146 66252224
VRL10 2464 1135757
VRL2 70522 64519814
VRL3 72569 63678593
VRL4 68829 69310786
VRL5 54367 73772208
VRL6 62488 72690424
VRL7 68207 66865933
VRL8 57091 72877777
VRL9 68553 72442860
VRT1 23636 155233932
VRT10 11261 176085848
VRT11 13332 171626663
VRT12 5290 184278638
VRT13 4141 187477666
VRT14 79683 69329315
VRT15 79708 67173661
VRT16 30997 28320602
VRT2 45273 126870866
VRT3 28486 143838410
VRT4 55807 103642550
VRT5 60909 66317570
VRT6 32081 71299801
VRT7 1167 191385937
VRT8 1277 190559463
VRT9 1334 189730569
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 167.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
and 'constructed' CON-division sequences:
Entries Bases Species
11535248 13124444947 Homo sapiens
7252378 8358715455 Mus musculus
1642662 5991517925 Rattus norvegicus
2086180 5228482576 Bos taurus
3188970 4578968522 Zea mays
2126845 3141652150 Sus scrofa
1588532 2932513510 Danio rerio
1205445 1533452587 Oryza sativa Japonica Group
227973 1352646211 Strongylocentrotus purpuratus
1673014 1142506965 Nicotiana tabacum
1410967 1044923875 Xenopus (Silurana) tropicalis
212933 996033334 Pan troglodytes
779849 911708853 Drosophila melanogaster
2210667 911688499 Arabidopsis thaliana
650352 905008645 Vitis vinifera
803827 869211632 Gallus gallus
76854 802815723 Macaca mulatta
1215317 748029713 Ciona intestinalis
1223247 706524422 Canis lupus familiaris
1111132 667180484 Triticum aestivum
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the index files and the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
August 15 2008
NCBI-GenBank Flat File Release 167.0
Bacterial Sequences (Part 1)
25389 loci, 102437874 bases, from 25389 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.2 Directory Files
3.2.1 Short Directory File
The short directory file contains brief descriptions of all of the
sequence entries contained in this release. These descriptions are in
fifteen groups, one group for each of the fifteen sequence entry
data files. The first record at the beginning of a group of entries
contains the name of the group in uppercase characters, beginning in
position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL,
OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL,
PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or
SEQUENCE TAGGED SITE. The second record is blank.
Each record in the short directory contains the sequence entry name
(LOCUS) in the first 12 positions, followed by a brief definition of
the sequence beginning in column 13. The definition is truncated (at
the end of a word) to leave room at the right margin for at least one
space, the sequence length, and the letters `bp'. The length of the
sequence is printed right-justified to column 77, followed by the
letters `bp' in columns 78 and 79. The next-to-last record for a group
has `ZZZZZZZZZZ' in its first ten positions (where the entry name
would normally appear). The last record is a blank line. An example of
the short directory file format, showing the descriptions of the last
entries in the Other Vertebrate sequence data file and the first
entries of the Invertebrate sequence data file, is reproduced below:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp
ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp
ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp
ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp
ZZZZZZZZZZ
INVERTEBRATE
AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp
ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp
ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp
ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 2. Short Directory File
3.3 Index Files
There are six files containing indices to the entries in this release:
Accession number index file (Accession and Version)
Secondary accession number index file
Keyword phrase index file
Author name index file
Journal citation index file
Gene name index file
The index keys (accession numbers, keywords, authors, journals, and
gene symbols.) of an index are sorted alphabetically. Following each
index key, the identifiers of the sequence entries containing that key
are listed (LOCUS name, division abbreviation, and primary accession
number). The division abbreviations are:
1. PRI - primate sequences
2. ROD - rodent sequences
3. MAM - other mammalian sequences
4. VRT - other vertebrate sequences
5. INV - invertebrate sequences
6. PLN - plant, fungal, and algal sequences
7. BCT - bacterial sequences
8. VRL - viral sequences
9. PHG - bacteriophage sequences
10. SYN - synthetic sequences
11. UNA - unannotated sequences
12. EST - EST sequences (expressed sequence tags)
13. PAT - patent sequences
14. STS - STS sequences (sequence tagged sites)
15. GSS - GSS sequences (genome survey sequences)
16. HTG - HTGS sequences (high throughput genomic sequences)
17. HTC - HTC sequences (high throughput cDNA sequences)
18. ENV - Environmental sampling sequences
19. CON - Constructed sequences
A line-oriented, TAB-delimited format is utilized for the gbaut.idx,
gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index
key is presented on its own line, and is followed by a
LOCUS/Division/Accession triplet for every record containing the key:
Indexed-Term
LOCUS-name1 Div-code1 Accession1
LOCUS-name2 Div-code2 Accession2
LOCUS-name3 Div-code3 Accession3
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
(H+,K+)-ATPASE BETA-SUBUNIT$
^IRATHKATPB^IROD^IM55655$
^IMUSATP4B1^IROD^IM64685$
^IMUSATP4B2^IROD^IM64686$
^IMUSATP4B3^IROD^IM64687$
^IMUSATP4B4^IROD^IM64688$
^IDOGATPASEB^IMAM^IM76486$
When viewed by a file browser such as 'less' or 'more' :
(H+,K+)-ATPASE BETA-SUBUNIT
RATHKATPB ROD M55655
MUSATP4B1 ROD M64685
MUSATP4B2 ROD M64686
MUSATP4B3 ROD M64687
MUSATP4B4 ROD M64688
DOGATPASEB MAM M76486
Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION
by the fact that they do not start with a TAB character. So one can
extract just the terms via simple text-processing:
perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey
The format of the primary accession number index file is slightly
different, with each indexed key (Accession.Version) present on
the same line as the LOCUS/Division/Accession triplet:
Accession1.Version1 Locus-name1 Div-code1 Accession1
Accession2.Version2 Locus-name2 Div-code2 Accession2
....
Here is an example of the format, in which TAB characters are displayed
as ^I, and carriage-returns/newlines as $ :
AC000102.1^IAC000102^IPRI^IAC000102$
AC000103.1^IAC000103^IPLN^IAC000103$
AC000104.1^IF19P19^IPLN^IAC000104$
AC000105.40^IAC000105^IPRI^IAC000105$
AC000106.1^IF7G19^IPLN^IAC000106$
AC000107.1^IAC000107^IPLN^IAC000107$
AC000108.1^IAC000108^IBCT^IAC000108$
AC000109.1^IHSAC000109^IPRI^IAC000109$
AC000110.1^IHSAC000110^IPRI^IAC000110$
When viewed by a file browser such as 'less' or 'more' :
AC000102.1 AC000102 PRI AC000102
AC000103.1 AC000103 PLN AC000103
AC000104.1 F19P19 PLN AC000104
AC000105.40 AC000105 PRI AC000105
AC000106.1 F7G19 PLN AC000106
AC000107.1 AC000107 PLN AC000107
AC000108.1 AC000108 BCT AC000108
AC000109.1 HSAC000109 PRI AC000109
AC000110.1 HSAC000110 PRI AC000110
3.3.1 Accession Number Index File - gbacc.idx
Accession numbers are unique six character or eight-character alphanumeric
identifiers of GenBank database entries. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. Accessions provide an unchanging identifier
for the data with which they are associated, and we encourage you to cite
accession numbers whenever you refer to data from GenBank.
GenBank entries can have both 'primary' and 'secondary' accessions
associated with them (see Section 3.5.6). Only primary accessions are present
in the gbacc.idx index.
3.3.2 Keyword Phrase Index File - gbkey.idx
Keyword phrases consist of names for gene products and other
characteristics of sequence entries.
3.3.3 Author Name Index File - gbaut*.idx
The author name index files list all of the author names that appear
in the references within sequence records.
3.3.4 Journal Citation Index File - gbjou.idx
The journal citation index file lists all of the citations that appear
in the references within sequence records.. All citations are truncated
to 80 characters.
3.3.5 Gene Name Index - gbgen.idx
The /gene qualifiers of many GenBank entries contain values other than
official gene symbols, such as the product or the standard name of the gene.
Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index
for this field, using both the GenBank /gene qualifier and the 'Gene.locus'
fields from the NCBI internal database as keys.
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is followed
by an integer key (a "GI") assigned to the sequence by NCBI.
Mandatory keyword/exactly one record.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1 GI:173593
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1 GI:173603
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.
The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.
GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67. See Section 3.3 for an explanation of division
codes.
Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.
The detailed format for the LOCUS line format is as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus name
29-29 space
30-40 Length of sequence, right-justified
41-41 space
42-43 bp
44-44 space
45-47 spaces, ss- (single-stranded), ds- (double-stranded), or
ms- (mixed-stranded)
48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), snRNA,
snoRNA. Left justified.
54-55 space
56-63 'linear' followed by two spaces, or 'circular'
64-64 space
65-67 The division code (see Section 3.3)
68-68 space
69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1 GI:6017929
^^^^^^^^^^ ^^^^^^^^^^
Compound NCBI GI
Accession Identifier
Number
A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .
Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:
- Some data sources processed by NCBI for incorporation into its Entrez
sequence retrieval system do not version their own sequences.
- GIs provide a uniform, integer identifier system for every sequence
NCBI has processed. Some products and systems derived from (or reliant
upon) NCBI products and services prefer to use these integer identifiers
because they can all be processed in the same manner.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence revision history web page is also available:
http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one in February 1999, when the
system was first introduced.
3.4.7.2 PROJECT Format
This line contains identifiers for the project(s) of which a GenBank sequence
record is a part. For example:
LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007
DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence.
ACCESSION AAWZ01000001 AAWZ01000000
VERSION AAWZ01000001.1 GI:125802685
PROJECT GenomeProject:18787
A PROJECT identifier consists of two data fields delimited by a semi-colon. The
first field provides the project identifier type ("GenomeProject"), while the second
contains the actual project identifier ("18787").
PROJECT ids of type GenomeProject are identifiers within the 'Entrez:Genome Project'
database at the NCBI:
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj
At the above URL, a search for 18787 would provide information about the sequencing
projects (underway or completed) for Anolis carolinensis, the centers performing the
sequencing and annotation, information about the organism, etc. For a more detailed
overview of Entrez's Genome Project database, see:
http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.
The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifier.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.
Remember, the most definitive documentation for the feature table can
be found at:
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
allele Obsolete; see variation feature key
attenuator Sequence related to transcription termination
C_region Span of the C immunological feature
CAAT_signal `CAAT box' in eukaryotic promoters
CDS Sequence coding for amino acids in protein (includes
stop codon)
conflict Independent sequence determinations differ
D-loop Displacement loop
D_segment Span of the D immunological feature
enhancer Cis-acting enhancer of promoter function
exon Region that codes for part of spliced mRNA
gene Region that defines a functional gene, possibly
including upstream (promotor, enhancer, etc)
and downstream control elements, and for which
a name has been assigned.
GC_signal `GC box' in eukaryotic promoters
iDNA Intervening DNA eliminated by recombination
intron Transcribed region excised by mRNA splicing
J_region Span of the J immunological feature
LTR Long terminal repeat
mat_peptide Mature peptide coding region (does not include stop codon)
misc_binding Miscellaneous binding site
misc_difference Miscellaneous difference feature
misc_feature Region of biological significance that cannot be described
by any other feature
misc_recomb Miscellaneous recombination feature
misc_RNA Miscellaneous transcript feature not defined by other RNA keys
misc_signal Miscellaneous signal
misc_structure Miscellaneous DNA or RNA structure
modified_base The indicated base is a modified nucleotide
mRNA Messenger RNA
mutation Obsolete: see variation feature key
N_region Span of the N immunological feature
old_sequence Presented sequence revises a previous version
polyA_signal Signal for cleavage & polyadenylation
polyA_site Site at which polyadenine is added to mRNA
precursor_RNA Any RNA species that is not yet the mature RNA product
prim_transcript Primary (unprocessed) transcript
primer Primer binding region used with PCR
primer_bind Non-covalent primer binding site
promoter A region involved in transcription initiation
protein_bind Non-covalent protein binding site on DNA or RNA
RBS Ribosome binding site
rep_origin Replication origin for duplex DNA
repeat_region Sequence containing repeated subsequences
repeat_unit One repeated unit of a repeat_region
rRNA Ribosomal RNA
S_region Span of the S immunological feature
satellite Satellite repeated sequence
scRNA Small cytoplasmic RNA
sig_peptide Signal peptide coding region
snRNA Small nuclear RNA
source Biological source of the sequence data represented by
a GenBank record. Mandatory feature, one or more per record.
For organisms that have been incorporated within the
NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
qualifier will be present (where NNNNN is the numeric
identifier assigned to the organism within the NCBI taxonomy
database).
stem_loop Hair-pin loop structure in DNA or RNA
STS Sequence Tagged Site; operationally unique sequence that
identifies the combination of primer spans used in a PCR assay
TATA_signal `TATA box' in eukaryotic promoters
terminator Sequence causing transcription termination
transit_peptide Transit peptide coding region
transposon Transposable element (TN)
tRNA Transfer RNA
unsure Authors are unsure about the sequence in this region
V_region Span of the V immunological feature
variation A related population contains stable mutation
- (hyphen) Placeholder
-10_signal `Pribnow box' in prokaryotic promoters
-35_signal `-35 box' in prokaryotic promoters
3'clip 3'-most region of a precursor transcript removed in processing
3'UTR 3' untranslated region (trailer)
5'clip 5'-most region of a precursor transcript removed in processing
5'UTR 5' untranslated region (leader)
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.
The following is a partial list of feature qualifiers.
/anticodon Location of the anticodon of tRNA and the amino acid
for which it codes
/bound_moiety Moiety bound
/citation Reference to a citation providing the claim of or
evidence for a feature
/codon Specifies a codon that is different from any found in the
reference genetic code
/codon_start Indicates the first base of the first complete codon
in a CDS (as 1 or 2 or 3)
/cons_splice Identifies intron splice sites that do not conform to
the 5'-GT... AG-3' splice site consensus
/db_xref A database cross-reference; pointer to related information
in another database. A description of all cross-references
can be found at:
http://www.ncbi.nlm.nih.gov/collab/db_xref.html
/direction Direction of DNA replication
/EC_number Enzyme Commission number for the enzyme product of the
sequence
/evidence Value indicating the nature of supporting evidence
/frequency Frequency of the occurrence of a feature
/function Function attributed to a sequence
/gene Symbol of the gene corresponding to a sequence region (usable
with all features)
/label A label used to permanently identify a feature
/map Map position of the feature in free-format text
/mod_base Abbreviation for a modified nucleotide base
/note Any comment or additional information
/number A number indicating the order of genetic elements
(e.g., exons or introns) in the 5 to 3 direction
/organism Name of the organism that is the source of the
sequence data in the record.
/partial Differentiates between complete regions and partial ones
/phenotype Phenotype conferred by the feature
/product Name of a product encoded by a coding region (CDS)
feature
/pseudo Indicates that this feature is a non-functional
version of the element named by the feature key
/rpt_family Type of repeated sequence; Alu or Kpn, for example
/rpt_type Organization of repeated sequence
/rpt_unit Identity of repeat unit that constitutes a repeat_region
/standard_name Accepted standard name for this feature
/transl_except Translational exception: single codon, the translation
of which does not conform to the reference genetic code
/translation Amino acid translation of a coding region
/type Name of a strain if different from that in the SOURCE field
/usedin Indicates that feature is used in a compound feature
in another entry
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS that spans more
than one entry.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
gene, 5' end.
ACCESSION M55673 M25818 M27095
KEYWORDS phosphoglycerate mutase.
SEGMENT 1 of 2
.
.
.
FEATURES Location/Qualifiers
CAAT_signal 1751..1755
/gene="PGAM-M"
TATA_signal 1791..1799
/gene="PGAM-M"
exon 1820..2274
/number=1
/EC_number="5.4.2.1"
/gene="PGAM-M"
intron 2275..2377
/number=1
/gene="PGAM2"
exon 2378..2558
/number=2
/gene="PGAM-M"
.
.
.
//
LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990
DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
exon 3.
ACCESSION M55674 M25818 M27096
KEYWORDS phosphoglycerate mutase.
SEGMENT 2 of 2
.
.
.
FEATURES Location/Qualifiers
exon 255..457
/number=3
/gene="PGAM-M"
intron order(M55673:2559..>3688,<1..254)
/number=2
/gene="PGAM-M"
mRNA join(M55673:1820..2274,M55673:2378..2558,255..457)
/gene="PGAM-M"
CDS join(M55673:1861..2274,M55673:2378..2558,255..421)
/note="muscle-specific isozyme"
/gene="PGAM2"
/product="phosphoglycerate mutase"
/codon_start=1
/translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
.
.
.
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Joining Sequences
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
[email protected]
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:
[email protected]
The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene. The
gene symbol index (gbgen.idx) is created from the data in the /gene qualifier
and therefore may contain data other than official gene symbols.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: [email protected] or by phone: 301-496-2475.
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL.
GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008)
The following statement is an example of how you may cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'
(1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:
ftp://bio-mirror.net/biomirror/genbank/
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at [email protected] or by
phone at 301-496-2475.
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Sequin can be used to submit revisions to previous
submissions. In addition, suggestions and corrections can be sent by
electronic mail to: [email protected]. Please be certain to
indicate the GenBank release number (e.g., Release 167.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Release Coordination
Mark Cavanaugh
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun,
Larry Chlumsky, Karen Clark, Irene Fang, Linda Frisse, Michael Fetchko,
Andrea Gocke, Anjanette Johnston, Mark Landree, Richard McVeigh,
Ilene Mizrachi, DeAnne Olsen Cravaritis, Chris O'Sullivan, Leigh Riley,
Gert Roosen, Susan Schafer, Melissa Wright, and Linda Yankie
Data Management and Preparation
Vladimir Alekseyev, Serge Bazhin, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
WonHee Jang, Jonathan Kans, Michael Kimelman, Jim Ostell, Carolyn Shenmen,
Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
Hanzhen Sun, Tatiana Tatusova, Aleksey Vysokolov, Lukas Wagner, Jane Weisemann,
Eugene Yaschenko, Sergey Zhdanov
Database Administration
Slava Khotomliansky, Igor Lozitskiy, Ben Slade, Constantin Vasilyev
User Support
Medha Bhagwat, Peter Cooper, Wayne Matten, Scott McGinnis, Monica Romiti,
Eric Sayers, Tao Tao, Majda Valjavec-Gratian, David Wheeler
Project Direction
David Lipman
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at [email protected], by phone at (301) 496-2475,
or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
FAX: (301) 480-9241
